Citrus Sinensis ID: 027995
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 215 | ||||||
| 224136530 | 199 | predicted protein [Populus trichocarpa] | 0.879 | 0.949 | 0.915 | 3e-98 | |
| 118488800 | 199 | unknown [Populus trichocarpa] | 0.879 | 0.949 | 0.910 | 9e-98 | |
| 351726572 | 237 | uncharacterized protein LOC100306603 [Gl | 0.972 | 0.881 | 0.823 | 9e-98 | |
| 255571119 | 210 | uridylate kinase plant, putative [Ricinu | 0.948 | 0.971 | 0.857 | 3e-97 | |
| 224067399 | 199 | predicted protein [Populus trichocarpa] | 0.879 | 0.949 | 0.894 | 2e-96 | |
| 357513083 | 208 | Uridylate kinase [Medicago truncatula] g | 0.958 | 0.990 | 0.805 | 1e-95 | |
| 225454048 | 210 | PREDICTED: uridylate kinase isoform 1 [V | 0.962 | 0.985 | 0.831 | 1e-95 | |
| 449432344 | 209 | PREDICTED: UMP/CMP kinase-like [Cucumis | 0.958 | 0.985 | 0.816 | 1e-95 | |
| 351721579 | 207 | uncharacterized protein LOC100500111 [Gl | 0.958 | 0.995 | 0.826 | 2e-95 | |
| 30690243 | 208 | Uridylate kinase [Arabidopsis thaliana] | 0.939 | 0.971 | 0.836 | 2e-95 |
| >gi|224136530|ref|XP_002326883.1| predicted protein [Populus trichocarpa] gi|222835198|gb|EEE73633.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 363 bits (932), Expect = 3e-98, Method: Compositional matrix adjust.
Identities = 173/189 (91%), Positives = 185/189 (97%)
Query: 19 KKPTVVFVLGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIKSGSENGTMIQNMIKEGK 78
KKPTVVFVLGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIKSGSENGTMIQNMIKEGK
Sbjct: 9 KKPTVVFVLGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIKSGSENGTMIQNMIKEGK 68
Query: 79 IVPSEVTIKLLQKAMEESGNDKFLIDGFPRNEENRAAFEAVTKIEPEFVLFFDCSEEEME 138
IVPSEVTIKLLQKAM++SGNDKFLIDGFPRNEENRAAFEAVTKIEP FVLFFDC EEEME
Sbjct: 69 IVPSEVTIKLLQKAMQDSGNDKFLIDGFPRNEENRAAFEAVTKIEPAFVLFFDCPEEEME 128
Query: 139 RRILNRNQGREDDNVETIRKRFKVFLESSLPVVQYYEAKGKVRKIDAAKPVAEVFDAVKA 198
RRIL+RNQGREDDN+ETIRKRFKVFLESSLPVV+YY++KGKV+K+DAAKP+ EVF+ VKA
Sbjct: 129 RRILSRNQGREDDNIETIRKRFKVFLESSLPVVEYYDSKGKVQKVDAAKPIDEVFEVVKA 188
Query: 199 VFTPKDEKV 207
+FTPKDEKV
Sbjct: 189 IFTPKDEKV 197
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|118488800|gb|ABK96210.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|351726572|ref|NP_001237387.1| uncharacterized protein LOC100306603 [Glycine max] gi|255629041|gb|ACU14865.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255571119|ref|XP_002526510.1| uridylate kinase plant, putative [Ricinus communis] gi|223534185|gb|EEF35901.1| uridylate kinase plant, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224067399|ref|XP_002302480.1| predicted protein [Populus trichocarpa] gi|118488191|gb|ABK95915.1| unknown [Populus trichocarpa] gi|222844206|gb|EEE81753.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357513083|ref|XP_003626830.1| Uridylate kinase [Medicago truncatula] gi|217075148|gb|ACJ85934.1| unknown [Medicago truncatula] gi|355520852|gb|AET01306.1| Uridylate kinase [Medicago truncatula] gi|388507198|gb|AFK41665.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|225454048|ref|XP_002263322.1| PREDICTED: uridylate kinase isoform 1 [Vitis vinifera] gi|359489116|ref|XP_003633878.1| PREDICTED: uridylate kinase isoform 2 [Vitis vinifera] gi|359489119|ref|XP_003633879.1| PREDICTED: uridylate kinase isoform 3 [Vitis vinifera] gi|297744838|emb|CBI38106.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449432344|ref|XP_004133959.1| PREDICTED: UMP/CMP kinase-like [Cucumis sativus] gi|449515542|ref|XP_004164808.1| PREDICTED: UMP/CMP kinase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|351721579|ref|NP_001236958.1| uncharacterized protein LOC100500111 [Glycine max] gi|255629285|gb|ACU14987.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|30690243|ref|NP_850867.1| Uridylate kinase [Arabidopsis thaliana] gi|117958619|gb|ABK59674.1| At5g26667 [Arabidopsis thaliana] gi|332006175|gb|AED93558.1| Uridylate kinase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 215 | ||||||
| TAIR|locus:1005716878 | 208 | PYR6 [Arabidopsis thaliana (ta | 0.879 | 0.908 | 0.851 | 2.7e-84 | |
| TAIR|locus:2101472 | 204 | AT3G60180 [Arabidopsis thalian | 0.930 | 0.980 | 0.695 | 1.6e-72 | |
| TAIR|locus:2122644 | 249 | AT4G25280 [Arabidopsis thalian | 0.855 | 0.738 | 0.6 | 2.3e-55 | |
| TAIR|locus:4515103290 | 136 | AT3G60961 [Arabidopsis thalian | 0.595 | 0.941 | 0.719 | 6e-48 | |
| UNIPROTKB|Q5ZKE7 | 196 | CMPK1 "UMP-CMP kinase" [Gallus | 0.809 | 0.887 | 0.538 | 4.4e-45 | |
| DICTYBASE|DDB_G0287495 | 195 | pyrK "uridine monophosphate/cy | 0.809 | 0.892 | 0.539 | 7.1e-45 | |
| ZFIN|ZDB-GENE-040426-2113 | 225 | cmpk "cytidylate kinase" [Dani | 0.827 | 0.791 | 0.526 | 5e-44 | |
| UNIPROTKB|Q2KIW9 | 196 | CMPK1 "UMP-CMP kinase" [Bos ta | 0.809 | 0.887 | 0.527 | 6.4e-44 | |
| UNIPROTKB|P30085 | 196 | CMPK1 "UMP-CMP kinase" [Homo s | 0.809 | 0.887 | 0.527 | 6.4e-44 | |
| UNIPROTKB|F1PIG2 | 228 | CMPK1 "Uncharacterized protein | 0.809 | 0.763 | 0.521 | 1e-43 |
| TAIR|locus:1005716878 PYR6 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 844 (302.2 bits), Expect = 2.7e-84, P = 2.7e-84
Identities = 161/189 (85%), Positives = 177/189 (93%)
Query: 27 LGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIKSGSENGTMIQNMIKEGKIVPSEVTI 86
LGGPGSGKGTQCA IVEH+GYTHLSAGDLLRAEIKSGSENGTMIQNMIKEGKIVPSEVTI
Sbjct: 20 LGGPGSGKGTQCAYIVEHYGYTHLSAGDLLRAEIKSGSENGTMIQNMIKEGKIVPSEVTI 79
Query: 87 KLLQKAMEESGNDKFLIDGFPRNEENRAAFEAVTKIEPEFVLFFDCSEEEMERRILNRNQ 146
KLLQKA++E+GNDKFLIDGFPRNEENRAAFE VT+IEP+FVLFFDC EEEME+R+L RNQ
Sbjct: 80 KLLQKAIQENGNDKFLIDGFPRNEENRAAFEKVTEIEPKFVLFFDCPEEEMEKRLLGRNQ 139
Query: 147 GREDDNVETIRKRFKVFLESSLPVVQYYEAKGKVRKIDAAKPVAEVFDAVKAVFTPKDEK 206
GREDDN+ETIRKRFKVFLESSLPV+ YYEAKGKVRKI+AAKP+ VF+ VKA+F+P+ EK
Sbjct: 140 GREDDNIETIRKRFKVFLESSLPVIHYYEAKGKVRKINAAKPIEAVFEEVKAIFSPEAEK 199
Query: 207 VKHYSCTIL 215
VK SC IL
Sbjct: 200 VKLNSCAIL 208
|
|
| TAIR|locus:2101472 AT3G60180 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2122644 AT4G25280 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:4515103290 AT3G60961 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZKE7 CMPK1 "UMP-CMP kinase" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0287495 pyrK "uridine monophosphate/cytidine monophosphate kinase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-2113 cmpk "cytidylate kinase" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2KIW9 CMPK1 "UMP-CMP kinase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P30085 CMPK1 "UMP-CMP kinase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PIG2 CMPK1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 215 | |||
| TIGR01359 | 183 | TIGR01359, UMP_CMP_kin_fam, UMP-CMP kinase family | 1e-105 | |
| PLN02200 | 234 | PLN02200, PLN02200, adenylate kinase family protei | 5e-91 | |
| cd01428 | 194 | cd01428, ADK, Adenylate kinase (ADK) catalyzes the | 3e-68 | |
| TIGR01360 | 188 | TIGR01360, aden_kin_iso1, adenylate kinase, isozym | 2e-62 | |
| pfam00406 | 186 | pfam00406, ADK, Adenylate kinase | 3e-59 | |
| TIGR01351 | 210 | TIGR01351, adk, adenylate kinase | 3e-52 | |
| PRK00279 | 215 | PRK00279, adk, adenylate kinase; Reviewed | 1e-51 | |
| COG0563 | 178 | COG0563, Adk, Adenylate kinase and related kinases | 5e-44 | |
| PRK02496 | 184 | PRK02496, adk, adenylate kinase; Provisional | 8e-39 | |
| PRK14527 | 191 | PRK14527, PRK14527, adenylate kinase; Provisional | 1e-37 | |
| PRK14531 | 183 | PRK14531, PRK14531, adenylate kinase; Provisional | 4e-33 | |
| PRK14530 | 215 | PRK14530, PRK14530, adenylate kinase; Provisional | 8e-31 | |
| PRK14532 | 188 | PRK14532, PRK14532, adenylate kinase; Provisional | 1e-30 | |
| PRK14528 | 186 | PRK14528, PRK14528, adenylate kinase; Provisional | 2e-28 | |
| PLN02459 | 261 | PLN02459, PLN02459, probable adenylate kinase | 1e-24 | |
| PLN02842 | 505 | PLN02842, PLN02842, nucleotide kinase | 7e-24 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 1e-20 | |
| PRK14526 | 211 | PRK14526, PRK14526, adenylate kinase; Provisional | 2e-20 | |
| PLN02674 | 244 | PLN02674, PLN02674, adenylate kinase | 3e-19 | |
| PTZ00088 | 229 | PTZ00088, PTZ00088, adenylate kinase 1; Provisiona | 1e-15 | |
| PRK14529 | 223 | PRK14529, PRK14529, adenylate kinase; Provisional | 2e-14 | |
| pfam13207 | 114 | pfam13207, AAA_17, AAA domain | 5e-09 | |
| pfam13671 | 143 | pfam13671, AAA_33, AAA domain | 7e-06 | |
| pfam13238 | 128 | pfam13238, AAA_18, AAA domain | 2e-05 | |
| cd02020 | 147 | cd02020, CMPK, Cytidine monophosphate kinase (CMPK | 1e-04 | |
| PRK04182 | 180 | PRK04182, PRK04182, cytidylate kinase; Provisional | 2e-04 | |
| COG1102 | 179 | COG1102, Cmk, Cytidylate kinase [Nucleotide transp | 4e-04 | |
| COG0125 | 208 | COG0125, Tmk, Thymidylate kinase [Nucleotide trans | 0.001 | |
| cd01672 | 200 | cd01672, TMPK, Thymidine monophosphate kinase (TMP | 0.002 | |
| TIGR02173 | 171 | TIGR02173, cyt_kin_arch, cytidylate kinase, putati | 0.002 |
| >gnl|CDD|130426 TIGR01359, UMP_CMP_kin_fam, UMP-CMP kinase family | Back alignment and domain information |
|---|
Score = 300 bits (771), Expect = e-105
Identities = 118/182 (64%), Positives = 149/182 (81%), Gaps = 4/182 (2%)
Query: 23 VVFVLGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIKSGSENGTMIQNMIKEGKIVPS 82
VVFVLGGPGSGKGTQCA IVE+FG+THLSAGDLLRAEIKSGSENG +I++MIK GKIVPS
Sbjct: 1 VVFVLGGPGSGKGTQCAKIVENFGFTHLSAGDLLRAEIKSGSENGELIESMIKNGKIVPS 60
Query: 83 EVTIKLLQKAMEESGNDKFLIDGFPRNEENRAAFEAV--TKIEPEFVLFFDCSEEEMERR 140
EVT+KLL+ A++ G+ KFLIDGFPRNEEN A+E + K+ +FVLFFDC EE M +R
Sbjct: 61 EVTVKLLKNAIQADGSKKFLIDGFPRNEENLEAWEKLMDNKVNFKFVLFFDCPEEVMIKR 120
Query: 141 ILNRNQ--GREDDNVETIRKRFKVFLESSLPVVQYYEAKGKVRKIDAAKPVAEVFDAVKA 198
+L R Q GR DDN+E+I+KRF+ + E +LPV+++YE KGKV++I+A V EVF+ V+
Sbjct: 121 LLKRGQSSGRVDDNIESIKKRFRTYNEQTLPVIEHYENKGKVKEINAEGSVEEVFEDVEK 180
Query: 199 VF 200
+F
Sbjct: 181 IF 182
|
This subfamily of the adenylate kinase superfamily contains examples of UMP-CMP kinase, as well as others proteins with unknown specificity, some currently designated adenylate kinase. All known members are eukaryotic. Length = 183 |
| >gnl|CDD|215125 PLN02200, PLN02200, adenylate kinase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|238713 cd01428, ADK, Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >gnl|CDD|130427 TIGR01360, aden_kin_iso1, adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|201213 pfam00406, ADK, Adenylate kinase | Back alignment and domain information |
|---|
| >gnl|CDD|233369 TIGR01351, adk, adenylate kinase | Back alignment and domain information |
|---|
| >gnl|CDD|234711 PRK00279, adk, adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223637 COG0563, Adk, Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|179433 PRK02496, adk, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237745 PRK14527, PRK14527, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172997 PRK14531, PRK14531, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237747 PRK14530, PRK14530, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184729 PRK14532, PRK14532, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172994 PRK14528, PRK14528, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215253 PLN02459, PLN02459, probable adenylate kinase | Back alignment and domain information |
|---|
| >gnl|CDD|178435 PLN02842, PLN02842, nucleotide kinase | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172992 PRK14526, PRK14526, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178279 PLN02674, PLN02674, adenylate kinase | Back alignment and domain information |
|---|
| >gnl|CDD|240262 PTZ00088, PTZ00088, adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237746 PRK14529, PRK14529, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221983 pfam13207, AAA_17, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|222307 pfam13671, AAA_33, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|222000 pfam13238, AAA_18, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|238978 cd02020, CMPK, Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >gnl|CDD|235244 PRK04182, PRK04182, cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224027 COG1102, Cmk, Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223203 COG0125, Tmk, Thymidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|238835 cd01672, TMPK, Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor | Back alignment and domain information |
|---|
| >gnl|CDD|233761 TIGR02173, cyt_kin_arch, cytidylate kinase, putative | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 215 | |||
| KOG3079 | 195 | consensus Uridylate kinase/adenylate kinase [Nucle | 100.0 | |
| PLN02674 | 244 | adenylate kinase | 100.0 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 100.0 | |
| PLN02459 | 261 | probable adenylate kinase | 100.0 | |
| PLN02200 | 234 | adenylate kinase family protein | 100.0 | |
| PRK13808 | 333 | adenylate kinase; Provisional | 100.0 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 100.0 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 100.0 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 100.0 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 100.0 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 100.0 | |
| PRK14529 | 223 | adenylate kinase; Provisional | 100.0 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 99.97 | |
| PRK02496 | 184 | adk adenylate kinase; Provisional | 99.97 | |
| PRK14526 | 211 | adenylate kinase; Provisional | 99.97 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 99.97 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 99.97 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 99.96 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 99.96 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 99.96 | |
| PF00406 | 151 | ADK: Adenylate kinase; InterPro: IPR000850 Adenyla | 99.95 | |
| PLN02842 | 505 | nucleotide kinase | 99.95 | |
| KOG3078 | 235 | consensus Adenylate kinase [Nucleotide transport a | 99.91 | |
| PRK01184 | 184 | hypothetical protein; Provisional | 99.86 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 99.83 | |
| PRK13973 | 213 | thymidylate kinase; Provisional | 99.82 | |
| PRK03839 | 180 | putative kinase; Provisional | 99.8 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 99.79 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 99.79 | |
| PRK06217 | 183 | hypothetical protein; Validated | 99.79 | |
| PRK13975 | 196 | thymidylate kinase; Provisional | 99.78 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 99.76 | |
| COG0125 | 208 | Tmk Thymidylate kinase [Nucleotide transport and m | 99.76 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 99.76 | |
| PLN02924 | 220 | thymidylate kinase | 99.76 | |
| PRK13974 | 212 | thymidylate kinase; Provisional | 99.75 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 99.75 | |
| PRK14730 | 195 | coaE dephospho-CoA kinase; Provisional | 99.75 | |
| COG0703 | 172 | AroK Shikimate kinase [Amino acid transport and me | 99.74 | |
| COG0283 | 222 | Cmk Cytidylate kinase [Nucleotide transport and me | 99.74 | |
| PRK00081 | 194 | coaE dephospho-CoA kinase; Reviewed | 99.74 | |
| PRK04182 | 180 | cytidylate kinase; Provisional | 99.74 | |
| PRK08356 | 195 | hypothetical protein; Provisional | 99.74 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 99.74 | |
| TIGR02173 | 171 | cyt_kin_arch cytidylate kinase, putative. Proteins | 99.73 | |
| PRK13948 | 182 | shikimate kinase; Provisional | 99.73 | |
| PRK00698 | 205 | tmk thymidylate kinase; Validated | 99.73 | |
| cd01672 | 200 | TMPK Thymidine monophosphate kinase (TMPK), also k | 99.72 | |
| TIGR00041 | 195 | DTMP_kinase thymidylate kinase. Function: phosphor | 99.72 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 99.71 | |
| COG1428 | 216 | Deoxynucleoside kinases [Nucleotide transport and | 99.71 | |
| PRK13946 | 184 | shikimate kinase; Provisional | 99.71 | |
| PRK14734 | 200 | coaE dephospho-CoA kinase; Provisional | 99.71 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 99.71 | |
| PRK14733 | 204 | coaE dephospho-CoA kinase; Provisional | 99.71 | |
| cd02030 | 219 | NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO | 99.7 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 99.7 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 99.7 | |
| PRK03731 | 171 | aroL shikimate kinase II; Reviewed | 99.69 | |
| PRK14731 | 208 | coaE dephospho-CoA kinase; Provisional | 99.69 | |
| COG2019 | 189 | AdkA Archaeal adenylate kinase [Nucleotide transpo | 99.69 | |
| PRK07933 | 213 | thymidylate kinase; Validated | 99.69 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 99.68 | |
| PRK12339 | 197 | 2-phosphoglycerate kinase; Provisional | 99.68 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 99.67 | |
| COG0237 | 201 | CoaE Dephospho-CoA kinase [Coenzyme metabolism] | 99.66 | |
| PF02223 | 186 | Thymidylate_kin: Thymidylate kinase; InterPro: IPR | 99.66 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 99.66 | |
| PLN02422 | 232 | dephospho-CoA kinase | 99.66 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 99.66 | |
| PRK14732 | 196 | coaE dephospho-CoA kinase; Provisional | 99.66 | |
| PTZ00451 | 244 | dephospho-CoA kinase; Provisional | 99.64 | |
| TIGR00152 | 188 | dephospho-CoA kinase. This model produces scores i | 99.64 | |
| COG3265 | 161 | GntK Gluconate kinase [Carbohydrate transport and | 99.64 | |
| PRK13976 | 209 | thymidylate kinase; Provisional | 99.64 | |
| PRK12338 | 319 | hypothetical protein; Provisional | 99.64 | |
| PRK13477 | 512 | bifunctional pantoate ligase/cytidylate kinase; Pr | 99.63 | |
| KOG3354 | 191 | consensus Gluconate kinase [Carbohydrate transport | 99.63 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 99.63 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 99.61 | |
| PRK14737 | 186 | gmk guanylate kinase; Provisional | 99.61 | |
| TIGR00017 | 217 | cmk cytidylate kinase. This family consists of cyt | 99.61 | |
| cd02022 | 179 | DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 | 99.61 | |
| PLN02199 | 303 | shikimate kinase | 99.61 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 99.6 | |
| KOG3347 | 176 | consensus Predicted nucleotide kinase/nuclear prot | 99.6 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 99.59 | |
| PF01121 | 180 | CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th | 99.59 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 99.59 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 99.59 | |
| cd01673 | 193 | dNK Deoxyribonucleoside kinase (dNK) catalyzes the | 99.58 | |
| PRK14021 | 542 | bifunctional shikimate kinase/3-dehydroquinate syn | 99.58 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 99.58 | |
| COG0529 | 197 | CysC Adenylylsulfate kinase and related kinases [I | 99.58 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 99.57 | |
| COG0194 | 191 | Gmk Guanylate kinase [Nucleotide transport and met | 99.57 | |
| KOG3220 | 225 | consensus Similar to bacterial dephospho-CoA kinas | 99.57 | |
| KOG3327 | 208 | consensus Thymidylate kinase/adenylate kinase [Nuc | 99.57 | |
| PRK14738 | 206 | gmk guanylate kinase; Provisional | 99.56 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 99.56 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 99.55 | |
| KOG3877 | 393 | consensus NADH:ubiquinone oxidoreductase, NDUFA10/ | 99.55 | |
| PRK09825 | 176 | idnK D-gluconate kinase; Provisional | 99.54 | |
| PRK03333 | 395 | coaE dephospho-CoA kinase/protein folding accessor | 99.54 | |
| PF01202 | 158 | SKI: Shikimate kinase; InterPro: IPR000623 Shikima | 99.54 | |
| PRK00023 | 225 | cmk cytidylate kinase; Provisional | 99.54 | |
| PRK11860 | 661 | bifunctional 3-phosphoshikimate 1-carboxyvinyltran | 99.53 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 99.53 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 99.52 | |
| smart00072 | 184 | GuKc Guanylate kinase homologues. Active enzymes c | 99.52 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 99.51 | |
| PRK11545 | 163 | gntK gluconate kinase 1; Provisional | 99.5 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 99.48 | |
| PRK04220 | 301 | 2-phosphoglycerate kinase; Provisional | 99.48 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 99.47 | |
| PF07931 | 174 | CPT: Chloramphenicol phosphotransferase-like prote | 99.46 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 99.46 | |
| TIGR00455 | 184 | apsK adenylylsulfate kinase (apsK). Important resi | 99.45 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 99.45 | |
| PRK12269 | 863 | bifunctional cytidylate kinase/ribosomal protein S | 99.45 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 99.45 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 99.44 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 99.44 | |
| PRK06696 | 223 | uridine kinase; Validated | 99.44 | |
| PRK05416 | 288 | glmZ(sRNA)-inactivating NTPase; Provisional | 99.43 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 99.42 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 99.4 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 99.4 | |
| PRK12337 | 475 | 2-phosphoglycerate kinase; Provisional | 99.4 | |
| PRK13951 | 488 | bifunctional shikimate kinase/3-dehydroquinate syn | 99.39 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 99.39 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 99.38 | |
| PRK05537 | 568 | bifunctional sulfate adenylyltransferase subunit 1 | 99.38 | |
| PRK07667 | 193 | uridine kinase; Provisional | 99.38 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 99.36 | |
| PLN02348 | 395 | phosphoribulokinase | 99.34 | |
| COG2074 | 299 | 2-phosphoglycerate kinase [Carbohydrate transport | 99.34 | |
| PF03668 | 284 | ATP_bind_2: P-loop ATPase protein family; InterPro | 99.33 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 99.32 | |
| COG0645 | 170 | Predicted kinase [General function prediction only | 99.32 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 99.31 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 99.28 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 99.28 | |
| PLN02772 | 398 | guanylate kinase | 99.28 | |
| COG3709 | 192 | Uncharacterized component of phosphonate metabolis | 99.27 | |
| PF06414 | 199 | Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e | 99.27 | |
| PF00625 | 183 | Guanylate_kin: Guanylate kinase; InterPro: IPR0081 | 99.27 | |
| KOG3308 | 225 | consensus Uncharacterized protein of the uridine k | 99.27 | |
| PRK15453 | 290 | phosphoribulokinase; Provisional | 99.24 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 99.24 | |
| PHA03132 | 580 | thymidine kinase; Provisional | 99.24 | |
| PRK07429 | 327 | phosphoribulokinase; Provisional | 99.23 | |
| COG4639 | 168 | Predicted kinase [General function prediction only | 99.23 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 99.23 | |
| KOG4235 | 244 | consensus Mitochondrial thymidine kinase 2/deoxygu | 99.23 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 99.22 | |
| TIGR03575 | 340 | selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti | 99.22 | |
| COG1660 | 286 | Predicted P-loop-containing kinase [General functi | 99.2 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 99.19 | |
| PF01591 | 222 | 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR0130 | 99.18 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 99.11 | |
| cd02026 | 273 | PRK Phosphoribulokinase (PRK) is an enzyme involve | 99.07 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 99.07 | |
| PLN02318 | 656 | phosphoribulokinase/uridine kinase | 99.05 | |
| COG4185 | 187 | Uncharacterized protein conserved in bacteria [Fun | 99.05 | |
| cd02029 | 277 | PRK_like Phosphoribulokinase-like (PRK-like) is a | 99.03 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 98.96 | |
| PHA03136 | 378 | thymidine kinase; Provisional | 98.95 | |
| KOG3062 | 281 | consensus RNA polymerase II elongator associated p | 98.86 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 98.85 | |
| KOG0635 | 207 | consensus Adenosine 5'-phosphosulfate kinase [Inor | 98.85 | |
| COG1072 | 283 | CoaA Panthothenate kinase [Coenzyme metabolism] | 98.8 | |
| PF08303 | 168 | tRNA_lig_kinase: tRNA ligase kinase domain; InterP | 98.72 | |
| PF13189 | 179 | Cytidylate_kin2: Cytidylate kinase-like family; PD | 98.71 | |
| PF13521 | 163 | AAA_28: AAA domain; PDB: 1LW7_A. | 98.66 | |
| PRK06761 | 282 | hypothetical protein; Provisional | 98.6 | |
| PHA03135 | 343 | thymidine kinase; Provisional | 98.59 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 98.58 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 98.55 | |
| PHA03134 | 340 | thymidine kinase; Provisional | 98.53 | |
| PRK00091 | 307 | miaA tRNA delta(2)-isopentenylpyrophosphate transf | 98.5 | |
| PHA03138 | 340 | thymidine kinase; Provisional | 98.49 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 98.43 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 98.43 | |
| PLN02840 | 421 | tRNA dimethylallyltransferase | 98.42 | |
| COG3896 | 205 | Chloramphenicol 3-O-phosphotransferase [Defense me | 98.42 | |
| PF13173 | 128 | AAA_14: AAA domain | 98.4 | |
| PF01745 | 233 | IPT: Isopentenyl transferase; InterPro: IPR002648 | 98.39 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 98.38 | |
| PRK08099 | 399 | bifunctional DNA-binding transcriptional repressor | 98.38 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 98.37 | |
| TIGR03707 | 230 | PPK2_P_aer polyphosphate kinase 2, PA0141 family. | 98.33 | |
| KOG0707 | 231 | consensus Guanylate kinase [Nucleotide transport a | 98.29 | |
| KOG0730 | 693 | consensus AAA+-type ATPase [Posttranslational modi | 98.28 | |
| PLN02748 | 468 | tRNA dimethylallyltransferase | 98.28 | |
| TIGR00174 | 287 | miaA tRNA isopentenyltransferase (miaA). Catalyzes | 98.26 | |
| PF01712 | 146 | dNK: Deoxynucleoside kinase; InterPro: IPR002624 T | 98.24 | |
| PRK09087 | 226 | hypothetical protein; Validated | 98.23 | |
| PHA02575 | 227 | 1 deoxynucleoside monophosphate kinase; Provisiona | 98.22 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 98.21 | |
| PF05729 | 166 | NACHT: NACHT domain | 98.2 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 98.2 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 98.18 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 98.18 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 98.17 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 98.16 | |
| TIGR03708 | 493 | poly_P_AMP_trns polyphosphate:AMP phosphotransfera | 98.16 | |
| KOG4622 | 291 | consensus Predicted nucleotide kinase [General fun | 98.16 | |
| PHA03133 | 368 | thymidine kinase; Provisional | 98.16 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 98.15 | |
| COG0324 | 308 | MiaA tRNA delta(2)-isopentenylpyrophosphate transf | 98.15 | |
| PLN02796 | 347 | D-glycerate 3-kinase | 98.14 | |
| TIGR03709 | 264 | PPK2_rel_1 polyphosphate:nucleotide phosphotransfe | 98.14 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 98.12 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 98.11 | |
| PRK14729 | 300 | miaA tRNA delta(2)-isopentenylpyrophosphate transf | 98.11 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 98.11 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 98.1 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 98.1 | |
| KOG0780 | 483 | consensus Signal recognition particle, subunit Srp | 98.1 | |
| PLN03046 | 460 | D-glycerate 3-kinase; Provisional | 98.08 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 98.08 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 98.08 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 98.08 | |
| TIGR01223 | 182 | Pmev_kin_anim phosphomevalonate kinase, animal typ | 98.08 | |
| COG4240 | 300 | Predicted kinase [General function prediction only | 98.06 | |
| COG3911 | 183 | Predicted ATPase [General function prediction only | 98.02 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 98.02 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 98.01 | |
| PF03976 | 228 | PPK2: Polyphosphate kinase 2 (PPK2); InterPro: IPR | 98.01 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 98.01 | |
| COG0552 | 340 | FtsY Signal recognition particle GTPase [Intracell | 98.0 | |
| KOG2702 | 323 | consensus Predicted panthothenate kinase/uridine k | 97.99 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.98 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 97.98 | |
| PRK06620 | 214 | hypothetical protein; Validated | 97.98 | |
| COG0541 | 451 | Ffh Signal recognition particle GTPase [Intracellu | 97.97 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 97.97 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 97.96 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 97.95 | |
| KOG0738 | 491 | consensus AAA+-type ATPase [Posttranslational modi | 97.95 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 97.95 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 97.95 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 97.95 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 97.94 | |
| PRK09169 | 2316 | hypothetical protein; Validated | 97.94 | |
| KOG4238 | 627 | consensus Bifunctional ATP sulfurylase/adenosine 5 | 97.94 | |
| PF02367 | 123 | UPF0079: Uncharacterised P-loop hydrolase UPF0079; | 97.93 | |
| KOG1384 | 348 | consensus tRNA delta(2)-isopentenylpyrophosphate t | 97.93 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 97.92 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 97.92 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 97.91 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 97.9 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 97.9 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 97.89 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 97.89 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 97.89 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 97.88 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 97.88 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 97.88 | |
| COG1855 | 604 | ATPase (PilT family) [General function prediction | 97.88 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 97.88 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 97.85 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 97.85 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 97.84 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 97.83 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 97.83 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 97.83 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 97.82 | |
| TIGR00101 | 199 | ureG urease accessory protein UreG. This model rep | 97.81 | |
| PF10662 | 143 | PduV-EutP: Ethanolamine utilisation - propanediol | 97.81 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 97.81 | |
| KOG0743 | 457 | consensus AAA+-type ATPase [Posttranslational modi | 97.81 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 97.8 | |
| TIGR01526 | 325 | nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr | 97.8 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 97.8 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 97.8 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 97.8 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 97.79 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 97.79 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 97.78 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 97.78 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 97.78 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 97.77 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 97.77 | |
| PRK11784 | 345 | tRNA 2-selenouridine synthase; Provisional | 97.77 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 97.77 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 97.77 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 97.76 | |
| PRK12377 | 248 | putative replication protein; Provisional | 97.76 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 97.75 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 97.75 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 97.75 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 97.75 | |
| TIGR01618 | 220 | phage_P_loop phage nucleotide-binding protein. Thi | 97.75 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 97.74 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 97.74 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 97.74 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 97.74 | |
| COG0378 | 202 | HypB Ni2+-binding GTPase involved in regulation of | 97.74 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 97.73 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 97.72 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 97.72 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 97.72 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 97.72 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 97.71 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 97.71 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 97.71 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 97.7 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 97.7 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 97.7 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 97.7 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 97.68 | |
| PRK10646 | 153 | ADP-binding protein; Provisional | 97.68 | |
| COG0802 | 149 | Predicted ATPase or kinase [General function predi | 97.68 | |
| KOG0739 | 439 | consensus AAA+-type ATPase [Posttranslational modi | 97.68 | |
| PRK13695 | 174 | putative NTPase; Provisional | 97.68 | |
| TIGR00073 | 207 | hypB hydrogenase accessory protein HypB. HypB is i | 97.68 | |
| KOG2004 | 906 | consensus Mitochondrial ATP-dependent protease PIM | 97.68 | |
| KOG0734 | 752 | consensus AAA+-type ATPase containing the peptidas | 97.68 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 97.67 | |
| KOG1969 | 877 | consensus DNA replication checkpoint protein CHL12 | 97.67 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 97.67 | |
| KOG1533 | 290 | consensus Predicted GTPase [General function predi | 97.67 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 97.67 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 97.67 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 97.66 | |
| PF08477 | 119 | Miro: Miro-like protein; InterPro: IPR013684 Mitoc | 97.66 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 97.65 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 97.65 | |
| TIGR03708 | 493 | poly_P_AMP_trns polyphosphate:AMP phosphotransfera | 97.65 | |
| PHA02244 | 383 | ATPase-like protein | 97.65 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 97.64 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 97.64 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 97.64 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 97.63 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 97.63 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 97.63 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 97.63 | |
| PRK14490 | 369 | putative bifunctional molybdopterin-guanine dinucl | 97.63 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 97.63 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 97.63 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 97.62 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 97.62 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 97.62 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 97.62 | |
| PF00693 | 281 | Herpes_TK: Thymidine kinase from herpesvirus; Inte | 97.62 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 97.62 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 97.62 | |
| KOG0234 | 438 | consensus Fructose-6-phosphate 2-kinase/fructose-2 | 97.62 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 97.62 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 97.62 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 97.61 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 97.61 | |
| KOG2170 | 344 | consensus ATPase of the AAA+ superfamily [General | 97.61 | |
| KOG1970 | 634 | consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 | 97.6 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 97.6 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 97.6 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 97.59 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 97.59 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 97.59 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 97.59 | |
| cd03116 | 159 | MobB Molybdenum is an essential trace element in t | 97.58 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 97.58 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 97.58 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 97.57 | |
| PRK13768 | 253 | GTPase; Provisional | 97.57 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 97.57 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 97.57 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 97.57 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 97.57 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 97.57 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 97.57 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 97.57 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 97.56 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 97.56 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 97.56 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 97.56 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 97.56 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 97.55 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 97.55 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 97.55 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 97.55 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 97.54 | |
| cd01918 | 149 | HprK_C HprK/P, the bifunctional histidine-containi | 97.54 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 97.54 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 97.54 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 97.54 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 97.54 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 97.54 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 97.54 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 97.54 | |
| COG1219 | 408 | ClpX ATP-dependent protease Clp, ATPase subunit [P | 97.54 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 97.53 | |
| PRK15177 | 213 | Vi polysaccharide export ATP-binding protein VexC; | 97.53 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 97.53 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 97.53 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 97.53 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 97.53 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 97.53 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 97.52 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 97.52 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 97.52 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 97.52 | |
| cd04155 | 173 | Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f | 97.52 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 97.51 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 97.51 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 97.51 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 97.51 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 97.51 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 97.51 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 97.51 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 97.51 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 97.51 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 97.5 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 97.5 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 97.5 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 97.5 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 97.5 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 97.5 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 97.5 | |
| COG4778 | 235 | PhnL ABC-type phosphonate transport system, ATPase | 97.5 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 97.5 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 97.49 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 97.49 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 97.49 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 97.49 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 97.49 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 97.49 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 97.49 | |
| COG1127 | 263 | Ttg2A ABC-type transport system involved in resist | 97.49 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 97.49 | |
| PHA02624 | 647 | large T antigen; Provisional | 97.48 | |
| PF01926 | 116 | MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I | 97.48 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 97.48 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 97.48 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 97.48 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 97.48 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 97.48 | |
| cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 97.47 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.47 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 97.47 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 97.47 | |
| TIGR01184 | 230 | ntrCD nitrate transport ATP-binding subunits C and | 97.47 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 97.47 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 97.47 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 97.46 | |
| KOG0609 | 542 | consensus Calcium/calmodulin-dependent serine prot | 97.46 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 97.46 | |
| PRK08181 | 269 | transposase; Validated | 97.46 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 97.46 | |
| TIGR02770 | 230 | nickel_nikD nickel import ATP-binding protein NikD | 97.46 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 97.46 | |
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 97.46 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 97.45 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 97.45 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 97.45 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 97.45 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 97.44 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 97.44 | |
| COG1763 | 161 | MobB Molybdopterin-guanine dinucleotide biosynthes | 97.44 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 97.44 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 97.43 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 97.43 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 97.43 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 97.43 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 97.43 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 97.43 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 97.43 | |
| cd03278 | 197 | ABC_SMC_barmotin Barmotin is a tight junction-asso | 97.43 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 97.43 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 97.43 | |
| TIGR03771 | 223 | anch_rpt_ABC anchored repeat-type ABC transporter, | 97.43 | |
| cd03297 | 214 | ABC_ModC_molybdenum_transporter ModC is an ABC-typ | 97.43 | |
| cd03250 | 204 | ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. | 97.42 | |
| KOG2878 | 282 | consensus Predicted kinase [General function predi | 97.42 | |
| KOG1532 | 366 | consensus GTPase XAB1, interacts with DNA repair p | 97.42 | |
| cd04163 | 168 | Era Era subfamily. Era (E. coli Ras-like protein) | 97.42 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 97.42 | |
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 97.42 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 97.42 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 97.42 | |
| cd03251 | 234 | ABCC_MsbA MsbA is an essential ABC transporter, cl | 97.42 | |
| cd03245 | 220 | ABCC_bacteriocin_exporters ABC-type bacteriocin ex | 97.42 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 97.42 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 97.42 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 97.41 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 97.41 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 97.41 | |
| COG1220 | 444 | HslU ATP-dependent protease HslVU (ClpYQ), ATPase | 97.41 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 97.41 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 97.41 | |
| PRK13764 | 602 | ATPase; Provisional | 97.41 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 97.41 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 97.41 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 97.41 | |
| TIGR03005 | 252 | ectoine_ehuA ectoine/hydroxyectoine ABC transporte | 97.41 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 97.41 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 97.41 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 97.41 |
| >KOG3079 consensus Uridylate kinase/adenylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.6e-35 Score=200.82 Aligned_cols=185 Identities=55% Similarity=1.006 Sum_probs=172.8
Q ss_pred CCCCCeEEEEEcCCCCChHHHHHHHHHHhCCeEeeHHHHHHHHHHc-CCCcHHHHHHHHHcCCCCCHHHHHHHHHHHHHc
Q 027995 17 TVKKPTVVFVLGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIKS-GSENGTMIQNMIKEGKIVPSEVTIKLLQKAMEE 95 (215)
Q Consensus 17 ~~~~~~~I~i~G~~gsGKsTla~~La~~~~~~~i~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 95 (215)
.+.++++|++.|+|||||-|.|.+++++++|.|++.||++|+...+ +++.+..+.+++.+|..+|.+...++++.++.+
T Consensus 4 ~~~~~~IifVlGGPGsgKgTqC~kiv~ky~ftHlSaGdLLR~E~~~~gse~g~~I~~~i~~G~iVP~ei~~~LL~~am~~ 83 (195)
T KOG3079|consen 4 KLDKPPIIFVLGGPGSGKGTQCEKIVEKYGFTHLSAGDLLRAEIASAGSERGALIKEIIKNGDLVPVEITLSLLEEAMRS 83 (195)
T ss_pred cccCCCEEEEEcCCCCCcchHHHHHHHHcCceeecHHHHHHHHHccccChHHHHHHHHHHcCCcCcHHHHHHHHHHHHHh
Confidence 4567899999999999999999999999999999999999999999 999999999999999999999999999999988
Q ss_pred cCC-CeEEEeCCCCCHHHHHHHHHhcCC-CCcEEEEEecCHHHHHHHHhhccCC--CCCCcHHHHHHHHHHHhhcchhHH
Q 027995 96 SGN-DKFLIDGFPRNEENRAAFEAVTKI-EPEFVLFFDCSEEEMERRILNRNQG--REDDNVETIRKRFKVFLESSLPVV 171 (215)
Q Consensus 96 ~~~-~~~iidg~~~~~~~~~~~~~~~~~-~~~~~i~L~~~~e~~~~R~~~r~~~--~~~~~~~~~~~~~~~~~~~~~~~~ 171 (215)
... .++++||||++.++...|.. ... .+++++|++|+.|++.+|+..|.++ |.+++.+.+.+|++.|.....|++
T Consensus 84 ~~~~~~fLIDGyPR~~~q~~~fe~-~i~~~~~fvl~fdc~ee~~l~Rll~R~q~~~R~DDn~esikkR~et~~~~t~Pvi 162 (195)
T KOG3079|consen 84 SGDSNGFLIDGYPRNVDQLVEFER-KIQGDPDFVLFFDCPEETMLKRLLHRGQSNSRSDDNEESIKKRLETYNKSTLPVI 162 (195)
T ss_pred cCCCCeEEecCCCCChHHHHHHHH-HhcCCCCEEEEEeCCHHHHHHHHHhhcccCCCCCCchHHHHHHHHHHHHcchHHH
Confidence 774 45999999999999999998 555 7999999999999999999999333 899999999999999999999999
Q ss_pred HHHHhcCcEEEEcCCCCHHHHHHHHHHhhCC
Q 027995 172 QYYEAKGKVRKIDAAKPVAEVFDAVKAVFTP 202 (215)
Q Consensus 172 ~~~~~~~~~~~id~~~~~~e~~~~i~~~l~~ 202 (215)
++|+..+.+..+|++.+++++++.+.+.+..
T Consensus 163 ~~~e~kg~l~~i~a~~~~d~Vf~~v~~~id~ 193 (195)
T KOG3079|consen 163 EYYEKKGKLLKINAERSVDDVFEEVVTAIDA 193 (195)
T ss_pred HHHHccCcEEEecCCCCHHHHHHHHHHHhhc
Confidence 9999999999999999999999999988764
|
|
| >PLN02674 adenylate kinase | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02459 probable adenylate kinase | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >PRK13808 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
| >PRK14529 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14526 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction |
Back alignment and domain information |
|---|
| >PLN02842 nucleotide kinase | Back alignment and domain information |
|---|
| >KOG3078 consensus Adenylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK01184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13973 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK13975 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02924 thymidylate kinase | Back alignment and domain information |
|---|
| >PRK13974 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14730 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00081 coaE dephospho-CoA kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK04182 cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08356 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02173 cyt_kin_arch cytidylate kinase, putative | Back alignment and domain information |
|---|
| >PRK13948 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00698 tmk thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor | Back alignment and domain information |
|---|
| >TIGR00041 DTMP_kinase thymidylate kinase | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13946 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14734 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >PRK14733 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK03731 aroL shikimate kinase II; Reviewed | Back alignment and domain information |
|---|
| >PRK14731 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07933 thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >PRK12339 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PLN02422 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14732 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00451 dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00152 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13976 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12338 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >PRK14737 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00017 cmk cytidylate kinase | Back alignment and domain information |
|---|
| >cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 | Back alignment and domain information |
|---|
| >PLN02199 shikimate kinase | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) | Back alignment and domain information |
|---|
| >PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3220 consensus Similar to bacterial dephospho-CoA kinase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3327 consensus Thymidylate kinase/adenylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14738 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >KOG3877 consensus NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK09825 idnK D-gluconate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 | Back alignment and domain information |
|---|
| >PRK00023 cmk cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >smart00072 GuKc Guanylate kinase homologues | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11545 gntK gluconate kinase 1; Provisional | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PRK04220 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >TIGR00455 apsK adenylylsulfate kinase (apsK) | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >PRK12337 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PLN02348 phosphoribulokinase | Back alignment and domain information |
|---|
| >COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >COG0645 Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >PLN02772 guanylate kinase | Back alignment and domain information |
|---|
| >COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] | Back alignment and domain information |
|---|
| >PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 | Back alignment and domain information |
|---|
| >KOG3308 consensus Uncharacterized protein of the uridine kinase family [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15453 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >PHA03132 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07429 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >COG4639 Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >KOG4235 consensus Mitochondrial thymidine kinase 2/deoxyguanosine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic | Back alignment and domain information |
|---|
| >COG1660 Predicted P-loop-containing kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >PF01591 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR013079 6-Phosphofructo-2-kinase (2 | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PLN02318 phosphoribulokinase/uridine kinase | Back alignment and domain information |
|---|
| >COG4185 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >PHA03136 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3062 consensus RNA polymerase II elongator associated protein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >KOG0635 consensus Adenosine 5'-phosphosulfate kinase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF08303 tRNA_lig_kinase: tRNA ligase kinase domain; InterPro: IPR015966 This entry represents a kinase domain found in fungal tRNA ligases [] | Back alignment and domain information |
|---|
| >PF13189 Cytidylate_kin2: Cytidylate kinase-like family; PDB: 3FDI_A | Back alignment and domain information |
|---|
| >PF13521 AAA_28: AAA domain; PDB: 1LW7_A | Back alignment and domain information |
|---|
| >PRK06761 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA03135 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA03134 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed | Back alignment and domain information |
|---|
| >PHA03138 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PLN02840 tRNA dimethylallyltransferase | Back alignment and domain information |
|---|
| >COG3896 Chloramphenicol 3-O-phosphotransferase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03707 PPK2_P_aer polyphosphate kinase 2, PA0141 family | Back alignment and domain information |
|---|
| >KOG0707 consensus Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN02748 tRNA dimethylallyltransferase | Back alignment and domain information |
|---|
| >TIGR00174 miaA tRNA isopentenyltransferase (miaA) | Back alignment and domain information |
|---|
| >PF01712 dNK: Deoxynucleoside kinase; InterPro: IPR002624 This family consists of various deoxynucleoside kinases including cytidine (2 | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PHA02575 1 deoxynucleoside monophosphate kinase; Provisional | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >TIGR03708 poly_P_AMP_trns polyphosphate:AMP phosphotransferase | Back alignment and domain information |
|---|
| >KOG4622 consensus Predicted nucleotide kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PHA03133 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN02796 D-glycerate 3-kinase | Back alignment and domain information |
|---|
| >TIGR03709 PPK2_rel_1 polyphosphate:nucleotide phosphotransferase, PPK2 family | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PLN03046 D-glycerate 3-kinase; Provisional | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01223 Pmev_kin_anim phosphomevalonate kinase, animal type | Back alignment and domain information |
|---|
| >COG4240 Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3911 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF03976 PPK2: Polyphosphate kinase 2 (PPK2); InterPro: IPR022488 This presumed domain is found in one or two copies per protein | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG2702 consensus Predicted panthothenate kinase/uridine kinase-related protein [Nucleotide transport and metabolism; Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PRK09169 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG4238 consensus Bifunctional ATP sulfurylase/adenosine 5'-phosphosulfate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop | Back alignment and domain information |
|---|
| >KOG1384 consensus tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >COG1855 ATPase (PilT family) [General function prediction only] | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR00101 ureG urease accessory protein UreG | Back alignment and domain information |
|---|
| >PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PRK11784 tRNA 2-selenouridine synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >TIGR01618 phage_P_loop phage nucleotide-binding protein | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK10646 ADP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG0802 Predicted ATPase or kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >TIGR00073 hypB hydrogenase accessory protein HypB | Back alignment and domain information |
|---|
| >KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1533 consensus Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >TIGR03708 poly_P_AMP_trns polyphosphate:AMP phosphotransferase | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >PF00693 Herpes_TK: Thymidine kinase from herpesvirus; InterPro: IPR001889 The thymidine kinase from Herpesviridae catalyses the reaction: |
Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >KOG0234 consensus Fructose-6-phosphate 2-kinase/fructose-2,6-biphosphatase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd04155 Arl3 Arl3 subfamily | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0609 consensus Calcium/calmodulin-dependent serine protein kinase/membrane-associated guanylate kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02770 nickel_nikD nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB | Back alignment and domain information |
|---|
| >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C | Back alignment and domain information |
|---|
| >KOG2878 consensus Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd04163 Era Era subfamily | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins | Back alignment and domain information |
|---|
| >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 215 | ||||
| 1tev_A | 196 | Crystal Structure Of The Human UmpCMP KINASE IN OPE | 5e-47 | ||
| 1qf9_A | 194 | Ph Influences Fluoride Coordination Number Of The A | 4e-45 | ||
| 1uky_A | 203 | Substrate Specificity And Assembly Of Catalytic Cen | 3e-44 | ||
| 3adk_A | 195 | Refined Structure Of Porcine Cytosolic Adenylate Ki | 4e-39 | ||
| 1z83_A | 196 | Crystal Structure Of Human Ak1a In Complex With Ap5 | 8e-38 | ||
| 3umf_A | 217 | Schistosoma Mansoni Adenylate Kinase Length = 217 | 7e-37 | ||
| 2bwj_A | 199 | Structure Of Adenylate Kinase 5 Length = 199 | 5e-34 | ||
| 2rgx_A | 206 | Crystal Structure Of Adenylate Kinase From Aquifex | 3e-25 | ||
| 3cm0_A | 186 | Crystal Structure Of Adenylate Kinase From Thermus | 5e-24 | ||
| 1ake_A | 214 | Structure Of The Complex Between Adenylate Kinase F | 5e-24 | ||
| 3hpr_A | 214 | Crystal Structure Of V148g Adenylate Kinase From E. | 6e-24 | ||
| 1e4v_A | 214 | Mutant G10v Of Adenylate Kinase From E. Coli, Modif | 6e-23 | ||
| 1e4y_A | 214 | Mutant P9l Of Adenylate Kinase From E. Coli, Modifi | 1e-21 | ||
| 3fb4_A | 216 | Crystal Structure Of Adenylate Kinase From Mariniba | 1e-21 | ||
| 3be4_A | 217 | Crystal Structure Of Cryptosporidium Parvum Adenyla | 3e-21 | ||
| 3tlx_A | 243 | Crystal Structure Of Pf10_0086, Adenylate Kinase Fr | 3e-21 | ||
| 1s3g_A | 217 | Crystal Structure Of Adenylate Kinase From Bacillus | 4e-21 | ||
| 2ak3_A | 226 | The Three-Dimensional Structure Of The Complex Betw | 6e-21 | ||
| 1zd8_A | 227 | Structure Of Human Adenylate Kinase 3 Like 1 Length | 6e-21 | ||
| 1zin_A | 217 | Adenylate Kinase With Bound Ap5a Length = 217 | 2e-20 | ||
| 2c9y_A | 242 | Structure Of Human Adenylate Kinase 2 Length = 242 | 2e-20 | ||
| 2ar7_A | 246 | Crystal Structure Of Human Adenylate Kinase 4, Ak4 | 2e-20 | ||
| 1p4s_A | 181 | Solution Structure Of Mycobacterium Tuberculosis Ad | 3e-20 | ||
| 2cdn_A | 201 | Crystal Structure Of Mycobacterium Tuberculosis Ade | 3e-20 | ||
| 1ak2_A | 233 | Adenylate Kinase Isoenzyme-2 Length = 233 | 4e-20 | ||
| 1zak_A | 222 | Adenylate Kinase From Maize In Complex With The Inh | 7e-20 | ||
| 3ndp_A | 231 | Crystal Structure Of Human Ak4(L171p) Length = 231 | 8e-20 | ||
| 3dkv_A | 217 | Crystal Structure Of Adenylate Kinase Variant Aklse | 2e-19 | ||
| 2qaj_A | 217 | Crystal Structure Of A Thermostable Mutant Of Bacil | 9e-18 | ||
| 2eu8_A | 216 | Crystal Structure Of A Thermostable Mutant Of Bacil | 9e-18 | ||
| 2p3s_A | 217 | Crystal Structure Of A Thermostable Mutant Of Bacil | 9e-18 | ||
| 1p3j_A | 217 | Adenylate Kinase From Bacillus Subtilis Length = 21 | 1e-17 | ||
| 2ori_A | 216 | Crystal Structure Of A Thermostable Mutant Of Bacil | 1e-17 | ||
| 3dl0_A | 216 | Crystal Structure Of Adenylate Kinase Variant Aklse | 2e-17 | ||
| 1aky_A | 220 | High-Resolution Structures Of Adenylate Kinase From | 3e-17 | ||
| 2oo7_A | 217 | Crystal Structure Of A Thermostable Mutant Of Bacil | 3e-17 | ||
| 3aky_A | 220 | Stability, Activity And Structure Of Adenylate Kina | 3e-17 | ||
| 3gmt_A | 230 | Crystal Structure Of Adenylate Kinase From Burkhold | 6e-17 | ||
| 2osb_A | 216 | Crystal Structure Of A Thermostable Mutant Of Bacil | 7e-17 | ||
| 1dvr_A | 220 | Structure Of A Mutant Adenylate Kinase Ligated With | 2e-15 | ||
| 3l0p_A | 223 | Crystal Structures Of Iron Containing Adenylate Kin | 1e-13 | ||
| 2xb4_A | 223 | Crystal Structures Of Zinc Containing Adenylate Kin | 1e-13 |
| >pdb|1TEV|A Chain A, Crystal Structure Of The Human UmpCMP KINASE IN OPEN Conformation Length = 196 | Back alignment and structure |
|
| >pdb|1QF9|A Chain A, Ph Influences Fluoride Coordination Number Of The Alfx Phosphoryl Transfer Transition State Analog In UmpCMP Kinase Length = 194 | Back alignment and structure |
| >pdb|1UKY|A Chain A, Substrate Specificity And Assembly Of Catalytic Center Derived From Two Structures Of Ligated Uridylate Kinase Length = 203 | Back alignment and structure |
| >pdb|3ADK|A Chain A, Refined Structure Of Porcine Cytosolic Adenylate Kinase At 2.1 Angstroms Resolution Length = 195 | Back alignment and structure |
| >pdb|1Z83|A Chain A, Crystal Structure Of Human Ak1a In Complex With Ap5a Length = 196 | Back alignment and structure |
| >pdb|3UMF|A Chain A, Schistosoma Mansoni Adenylate Kinase Length = 217 | Back alignment and structure |
| >pdb|2BWJ|A Chain A, Structure Of Adenylate Kinase 5 Length = 199 | Back alignment and structure |
| >pdb|2RGX|A Chain A, Crystal Structure Of Adenylate Kinase From Aquifex Aeolicus In Complex With Ap5a Length = 206 | Back alignment and structure |
| >pdb|3CM0|A Chain A, Crystal Structure Of Adenylate Kinase From Thermus Thermophilus Hb8 Length = 186 | Back alignment and structure |
| >pdb|1AKE|A Chain A, Structure Of The Complex Between Adenylate Kinase From Escherichia Coli And The Inhibitor Ap5a Refined At 1.9 Angstroms Resolution: A Model For A Catalytic Transition State Length = 214 | Back alignment and structure |
| >pdb|3HPR|A Chain A, Crystal Structure Of V148g Adenylate Kinase From E. Coli, In Complex With Ap5a Length = 214 | Back alignment and structure |
| >pdb|1E4V|A Chain A, Mutant G10v Of Adenylate Kinase From E. Coli, Modified In The Gly-Loop Length = 214 | Back alignment and structure |
| >pdb|1E4Y|A Chain A, Mutant P9l Of Adenylate Kinase From E. Coli, Modified In The Gly-Loop Length = 214 | Back alignment and structure |
| >pdb|3FB4|A Chain A, Crystal Structure Of Adenylate Kinase From Marinibacillus Marinus Length = 216 | Back alignment and structure |
| >pdb|3BE4|A Chain A, Crystal Structure Of Cryptosporidium Parvum Adenylate Kinase Cgd5_3360 Length = 217 | Back alignment and structure |
| >pdb|3TLX|A Chain A, Crystal Structure Of Pf10_0086, Adenylate Kinase From Plasmodium Falciparum Length = 243 | Back alignment and structure |
| >pdb|1S3G|A Chain A, Crystal Structure Of Adenylate Kinase From Bacillus Globisporus Length = 217 | Back alignment and structure |
| >pdb|2AK3|A Chain A, The Three-Dimensional Structure Of The Complex Between Mitochondrial Matrix Adenylate Kinase And Its Substrate Amp At 1.85 Angstroms Resolution Length = 226 | Back alignment and structure |
| >pdb|1ZD8|A Chain A, Structure Of Human Adenylate Kinase 3 Like 1 Length = 227 | Back alignment and structure |
| >pdb|1ZIN|A Chain A, Adenylate Kinase With Bound Ap5a Length = 217 | Back alignment and structure |
| >pdb|2C9Y|A Chain A, Structure Of Human Adenylate Kinase 2 Length = 242 | Back alignment and structure |
| >pdb|2AR7|A Chain A, Crystal Structure Of Human Adenylate Kinase 4, Ak4 Length = 246 | Back alignment and structure |
| >pdb|1P4S|A Chain A, Solution Structure Of Mycobacterium Tuberculosis Adenylate Kinase Length = 181 | Back alignment and structure |
| >pdb|2CDN|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Adenylate Kinase Complexed With Two Molecules Of Adp And Mg Length = 201 | Back alignment and structure |
| >pdb|1AK2|A Chain A, Adenylate Kinase Isoenzyme-2 Length = 233 | Back alignment and structure |
| >pdb|1ZAK|A Chain A, Adenylate Kinase From Maize In Complex With The Inhibitor P1,P5-Bis(Adenosine-5'-)pentaphosphate (Ap5a) Length = 222 | Back alignment and structure |
| >pdb|3NDP|A Chain A, Crystal Structure Of Human Ak4(L171p) Length = 231 | Back alignment and structure |
| >pdb|3DKV|A Chain A, Crystal Structure Of Adenylate Kinase Variant Aklse1 Length = 217 | Back alignment and structure |
| >pdb|2QAJ|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (Q199rG213E) Length = 217 | Back alignment and structure |
| >pdb|2EU8|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (Q199r) Length = 216 | Back alignment and structure |
| >pdb|2P3S|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (G214rQ199R) Length = 217 | Back alignment and structure |
| >pdb|1P3J|A Chain A, Adenylate Kinase From Bacillus Subtilis Length = 217 | Back alignment and structure |
| >pdb|2ORI|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (A193vQ199R) Length = 216 | Back alignment and structure |
| >pdb|3DL0|A Chain A, Crystal Structure Of Adenylate Kinase Variant Aklse3 Length = 216 | Back alignment and structure |
| >pdb|1AKY|A Chain A, High-Resolution Structures Of Adenylate Kinase From Yeast Ligated With Inhibitor Ap5a, Showing The Pathway Of Phosphoryl Transfer Length = 220 | Back alignment and structure |
| >pdb|2OO7|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (T179iQ199R) Length = 217 | Back alignment and structure |
| >pdb|3AKY|A Chain A, Stability, Activity And Structure Of Adenylate Kinase Mutants Length = 220 | Back alignment and structure |
| >pdb|3GMT|A Chain A, Crystal Structure Of Adenylate Kinase From Burkholderia Pseu Length = 230 | Back alignment and structure |
| >pdb|2OSB|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (q16l/q199r/) Length = 216 | Back alignment and structure |
| >pdb|1DVR|A Chain A, Structure Of A Mutant Adenylate Kinase Ligated With An Atp- Analogue Showing Domain Closure Over Atp Length = 220 | Back alignment and structure |
| >pdb|3L0P|A Chain A, Crystal Structures Of Iron Containing Adenylate Kinase From Desulfovibrio Gigas Length = 223 | Back alignment and structure |
| >pdb|2XB4|A Chain A, Crystal Structures Of Zinc Containing Adenylate Kinase From Desulfovibrio Gigas Length = 223 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 215 | |||
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 5e-98 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 3e-95 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 4e-95 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 3e-94 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 2e-92 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 1e-54 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 1e-53 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 6e-53 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 1e-52 | |
| 2rgx_A | 206 | Adenylate kinase; transferase(phosphotransferase), | 1e-52 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 1e-51 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 1e-51 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 3e-51 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 4e-51 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 4e-51 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 7e-51 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 1e-50 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 1e-49 | |
| 3gmt_A | 230 | Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle | 2e-48 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 2e-44 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 1e-25 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 2e-22 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 5e-11 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 7e-11 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 9e-11 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 3e-09 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 2e-07 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 4e-07 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 3e-06 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 5e-06 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 5e-06 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 9e-06 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 3e-05 | |
| 2ccj_A | 205 | DTMP kinase, thymidylate kinase; transferase, nucl | 4e-05 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 5e-05 | |
| 3tmk_A | 216 | Thymidylate kinase; phosphotransferase; HET: T5A; | 5e-05 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 8e-05 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 9e-05 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 1e-04 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 2e-04 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 2e-04 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 2e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-04 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 3e-04 |
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Length = 194 | Back alignment and structure |
|---|
Score = 282 bits (723), Expect = 5e-98
Identities = 101/186 (54%), Positives = 132/186 (70%), Gaps = 4/186 (2%)
Query: 19 KKPTVVFVLGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIKSGSENGTMIQNMIKEGK 78
KP VVFVLGGPGSGKGTQCANIV FG+ HLSAGDLLR E +SGS++G MI MIK G+
Sbjct: 4 SKPNVVFVLGGPGSGKGTQCANIVRDFGWVHLSAGDLLRQEQQSGSKDGEMIATMIKNGE 63
Query: 79 IVPSEVTIKLLQKAMEESGNDKFLIDGFPRNEENRAAFEAV--TKIEPEFVLFFDCSEEE 136
IVPS VT+KLL+ A++ + FL+DGFPRNEEN ++E ++ +FVLFFDC EE
Sbjct: 64 IVPSIVTVKLLKNAIDANQGKNFLVDGFPRNEENNNSWEENMKDFVDTKFVLFFDCPEEV 123
Query: 137 MERRILNRNQ--GREDDNVETIRKRFKVFLESSLPVVQYYEAKGKVRKIDAAKPVAEVFD 194
M +R+L R + GR DDN+E+I+KRF F + V+ +Y KV+ I A + V EV++
Sbjct: 124 MTQRLLKRGESSGRSDDNIESIKKRFNTFNVQTKLVIDHYNKFDKVKIIPANRDVNEVYN 183
Query: 195 AVKAVF 200
V+ +F
Sbjct: 184 DVENLF 189
|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Length = 199 | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Length = 196 | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Length = 203 | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Length = 196 | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Length = 186 | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Length = 246 | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Length = 227 | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Length = 201 | Back alignment and structure |
|---|
| >2rgx_A Adenylate kinase; transferase(phosphotransferase), ATP-binding, nucleo binding, transferase; HET: AP5; 1.90A {Aquifex aeolicus} PDB: 2rh5_A Length = 206 | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Length = 217 | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Length = 243 | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Length = 216 | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, cytoplasm, metal-binding, nucleotide biosynthesis, nucleotide-binding; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Length = 216 | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Length = 220 | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Length = 222 | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Length = 233 | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Length = 214 | Back alignment and structure |
|---|
| >3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Length = 230 | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Length = 223 | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Length = 179 | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Length = 189 | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Length = 181 | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Length = 193 | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Length = 180 | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Length = 192 | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Length = 301 | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Length = 253 | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Length = 202 | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Length = 194 | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Length = 191 | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Length = 184 | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Length = 229 | Back alignment and structure |
|---|
| >2ccj_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, ATP-binding; HET: TMP; 1.7A {Staphylococcus aureus} PDB: 2cck_A 2ccg_A* Length = 205 | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Length = 287 | Back alignment and structure |
|---|
| >3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Length = 216 | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Length = 260 | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Length = 178 | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Length = 214 | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Length = 236 | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Length = 200 | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Length = 195 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 3uwk_A* 3uwo_A* 3uxm_A* Length = 213 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 215 | |||
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 100.0 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 100.0 | |
| 3gmt_A | 230 | Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle | 100.0 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 99.97 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 99.97 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 99.97 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 99.97 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 99.97 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 99.97 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 99.97 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 99.96 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 99.96 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 99.96 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 99.96 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 99.96 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 99.96 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 99.96 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 99.95 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 99.95 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 99.95 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 99.89 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 99.89 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 99.83 | |
| 4hlc_A | 205 | DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri | 99.82 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 99.82 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 99.81 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 99.81 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 99.81 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 99.8 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 99.8 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 99.8 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 99.8 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 99.79 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 99.79 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 99.79 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 99.79 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 99.78 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 99.78 | |
| 3hjn_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 99.78 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 99.77 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 99.77 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 99.77 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 99.77 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 99.76 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 99.76 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 99.76 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 99.75 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 99.75 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 99.75 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 99.75 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 99.74 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 99.73 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 99.73 | |
| 4i1u_A | 210 | Dephospho-COA kinase; structural genomics, niaid, | 99.72 | |
| 3tmk_A | 216 | Thymidylate kinase; phosphotransferase; HET: T5A; | 99.72 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 99.72 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 99.72 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 99.72 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 99.71 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 99.71 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 99.69 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 99.69 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 99.69 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 99.69 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 99.69 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 99.68 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 99.68 | |
| 3fdi_A | 201 | Uncharacterized protein; cytidylate kinase like pr | 99.68 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 99.67 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 99.67 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 99.66 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 99.66 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 99.65 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 99.64 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 99.63 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 99.63 | |
| 3hdt_A | 223 | Putative kinase; structura genomics, PSI-2, protei | 99.63 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 99.62 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 99.61 | |
| 2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 99.6 | |
| 1p5z_B | 263 | DCK, deoxycytidine kinase; nucleoside kinase, P-lo | 99.59 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 99.58 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 99.58 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 99.56 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 99.54 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 99.5 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 99.5 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 99.48 | |
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 99.45 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 99.44 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 99.44 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 99.42 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 99.4 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 99.4 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 99.37 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 99.35 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 99.31 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 99.3 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 99.26 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 99.26 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 99.23 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 99.23 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 99.23 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 99.17 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 99.17 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 99.16 | |
| 3ch4_B | 202 | Pmkase, phosphomevalonate kinase; parallel beta-sh | 99.16 | |
| 1p6x_A | 334 | Thymidine kinase; P-loop, LID, transferase; HET: T | 99.15 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 99.14 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 99.1 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 99.04 | |
| 1osn_A | 341 | Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, tra | 99.03 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 99.02 | |
| 1e2k_A | 331 | Thymidine kinase; transferase, antiviral drug, enz | 99.0 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 98.98 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 98.98 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 98.96 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 98.96 | |
| 1of1_A | 376 | Thymidine kinase; transferase, antiviral drug, enz | 98.96 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 98.95 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 98.94 | |
| 3czq_A | 304 | Putative polyphosphate kinase 2; structural genomi | 98.87 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 98.85 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 98.82 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 98.59 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 98.55 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 98.49 | |
| 3czp_A | 500 | Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2 | 98.48 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 98.47 | |
| 1kjw_A | 295 | Postsynaptic density protein 95; protein-protein i | 98.47 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 98.47 | |
| 3czp_A | 500 | Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2 | 98.42 | |
| 3tvt_A | 292 | Disks large 1 tumor suppressor protein; DLG, SRC-h | 98.32 | |
| 1dek_A | 241 | Deoxynucleoside monophosphate kinase; transferase, | 98.3 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 98.26 | |
| 3rhf_A | 289 | Putative polyphosphate kinase 2 family protein; PS | 98.24 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 98.2 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 98.19 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 98.17 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 98.16 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 98.14 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 98.1 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 98.07 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 98.07 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 98.04 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 98.04 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 98.02 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 98.0 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 97.99 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 97.99 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 97.97 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 97.97 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 97.97 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 97.97 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 97.96 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 97.95 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 97.94 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 97.93 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 97.92 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 97.9 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 97.89 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 97.89 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 97.88 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 97.88 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 97.88 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 97.87 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 97.87 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 97.86 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 97.85 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 97.85 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 97.84 | |
| 3kfv_A | 308 | Tight junction protein ZO-3; structural genomics c | 97.84 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 97.83 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 97.83 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.81 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 97.81 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 97.8 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 97.79 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 97.78 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 97.78 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 97.78 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 97.77 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 97.77 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 97.76 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 97.75 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 97.75 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 97.74 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 97.73 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 97.73 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 97.72 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 97.72 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 97.72 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 97.72 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 97.71 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 97.69 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 97.67 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 97.67 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 97.67 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 97.67 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 97.66 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 97.66 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 97.64 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 97.64 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 97.64 | |
| 3shw_A | 468 | Tight junction protein ZO-1; PDZ-SH3-GUK supramodu | 97.63 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 97.63 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 97.63 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 97.62 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 97.62 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 97.6 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 97.6 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 97.6 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 97.6 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 97.59 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 97.59 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 97.59 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 97.59 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 97.58 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 97.58 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 97.58 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 97.58 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 97.58 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 97.58 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 97.57 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 97.57 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 97.57 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 97.57 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.57 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 97.56 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 97.56 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 97.56 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 97.56 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 97.55 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 97.55 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 97.55 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 97.55 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 97.55 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 97.55 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 97.55 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 97.55 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 97.54 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 97.54 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 97.54 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 97.54 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 97.53 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 97.53 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 97.53 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 97.52 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 97.52 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 97.51 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 97.5 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 97.5 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 97.5 | |
| 2h17_A | 181 | ADP-ribosylation factor-like protein 5A; GDP, GTPa | 97.5 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 97.48 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 97.48 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 97.48 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 97.47 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 97.47 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 97.46 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 97.46 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 97.46 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 97.46 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 97.45 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 97.45 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 97.45 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 97.45 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 97.45 | |
| 3tsz_A | 391 | Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol | 97.44 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 97.44 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 97.43 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 97.42 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 97.42 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 97.42 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 97.42 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 97.42 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 97.41 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 97.4 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 97.4 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 97.4 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 97.4 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 97.4 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 97.4 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 97.39 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 97.39 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 97.39 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 97.39 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 97.39 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 97.39 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 97.38 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 97.38 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 97.38 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 97.38 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 97.37 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 97.37 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 97.37 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 97.36 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 97.36 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 97.36 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 97.35 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 97.35 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 97.35 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 97.35 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 97.35 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 97.34 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 97.34 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 97.34 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 97.34 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 97.34 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 97.34 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 97.33 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 97.33 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 97.32 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 97.32 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 97.32 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 97.31 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 97.31 | |
| 2h57_A | 190 | ADP-ribosylation factor-like protein 6; GTP, GTPas | 97.3 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 97.3 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 97.3 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 97.3 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 97.3 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 97.3 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 97.3 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 97.3 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 97.29 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 97.29 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 97.29 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 97.28 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 97.28 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 97.27 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 97.27 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 97.26 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 97.26 | |
| 1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 97.25 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 97.25 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 97.25 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 97.24 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 97.24 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 97.24 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 97.24 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 97.24 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 97.24 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 97.24 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 97.23 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 97.23 | |
| 4bas_A | 199 | ADP-ribosylation factor, putative (small GTPase, p | 97.22 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 97.22 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 97.22 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 97.21 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 97.21 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 97.21 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 97.2 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 97.2 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 97.19 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 97.19 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 97.19 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 97.18 | |
| 3lxw_A | 247 | GTPase IMAP family member 1; immunity, structural | 97.18 | |
| 2q3h_A | 201 | RAS homolog gene family, member U; GTPase, structu | 97.18 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 97.17 | |
| 2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 97.17 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 97.17 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 97.16 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 97.16 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 97.16 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 97.16 | |
| 4dey_A | 337 | Voltage-dependent L-type calcium channel subunit; | 97.15 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 97.15 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 97.15 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 97.15 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 97.14 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 97.14 | |
| 2gco_A | 201 | H9, RHO-related GTP-binding protein RHOC; GTPase,s | 97.13 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 97.13 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 97.11 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 97.11 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 97.11 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 97.11 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 97.09 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 97.09 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 97.08 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 97.08 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 97.08 | |
| 2fv8_A | 207 | H6, RHO-related GTP-binding protein RHOB; GDP/GTP | 97.08 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 97.08 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 97.07 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 97.07 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 97.07 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 97.07 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 97.07 | |
| 2o52_A | 200 | RAS-related protein RAB-4B; G-protein, GDP, struct | 97.06 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 97.06 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 97.06 | |
| 3llu_A | 196 | RAS-related GTP-binding protein C; structural geno | 97.05 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 97.05 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 97.04 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 97.04 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 97.04 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 97.04 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 97.04 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 97.04 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 97.03 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 97.03 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 97.03 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 97.02 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 97.02 | |
| 2j0v_A | 212 | RAC-like GTP-binding protein ARAC7; nucleotide-bin | 97.02 | |
| 3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 97.02 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 97.01 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 97.01 | |
| 2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 97.0 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 97.0 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 97.0 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 97.0 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 96.99 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 96.99 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 96.98 | |
| 2fh5_B | 214 | SR-beta, signal recognition particle receptor beta | 96.98 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 96.97 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 96.97 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 96.96 | |
| 2xtp_A | 260 | GTPase IMAP family member 2; immune system, G prot | 96.95 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 96.95 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 96.95 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 96.94 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 96.94 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 96.94 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 96.93 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 96.93 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 96.93 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 96.92 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 96.92 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 96.92 | |
| 4dhe_A | 223 | Probable GTP-binding protein ENGB; melioidosis, RA | 96.91 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 96.91 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 96.91 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 96.91 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 96.91 | |
| 4gzl_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 96.91 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 96.91 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 96.9 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 96.9 | |
| 3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 96.89 | |
| 2j1l_A | 214 | RHO-related GTP-binding protein RHOD; GTPase, memb | 96.89 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 96.88 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 96.88 | |
| 2atx_A | 194 | Small GTP binding protein TC10; GTPase, P-loop, al | 96.88 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 96.88 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 96.88 | |
| 2f7s_A | 217 | C25KG, RAS-related protein RAB-27B; G-protein, str | 96.87 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 96.87 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 96.87 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 96.86 | |
| 3cph_A | 213 | RAS-related protein SEC4; RAB GTPase, prenylation, | 96.86 | |
| 3q3j_B | 214 | RHO-related GTP-binding protein RHO6; RAS-binding | 96.86 | |
| 3iev_A | 308 | GTP-binding protein ERA; ERA, GTPase, KH domain, a | 96.85 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 96.84 | |
| 2bcg_Y | 206 | Protein YP2, GTP-binding protein YPT1; RABGTPase, | 96.84 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 96.84 | |
| 1ni3_A | 392 | YCHF GTPase, YCHF GTP-binding protein; structural | 96.84 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 96.84 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 96.83 | |
| 3b1v_A | 272 | Ferrous iron uptake transporter protein B; G prote | 96.83 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 96.83 | |
| 1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 96.82 | |
| 1ko7_A | 314 | HPR kinase/phosphatase; protein kinase, phosphotra | 96.82 | |
| 3a1s_A | 258 | Iron(II) transport protein B; FEOB, iron transport | 96.82 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 96.81 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 96.8 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 96.8 | |
| 2cjw_A | 192 | GTP-binding protein GEM; nucleotide-binding, small | 96.79 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 96.77 | |
| 3gj0_A | 221 | GTP-binding nuclear protein RAN; G protein, GDP, a | 96.76 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 96.75 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 96.75 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 96.75 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 96.74 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 96.73 | |
| 1zcb_A | 362 | G alpha I/13; GTP-binding, lipoprotein, membrane, | 96.73 | |
| 2x77_A | 189 | ADP-ribosylation factor; GTP-binding protein, smal | 96.72 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 96.72 | |
| 3qks_A | 203 | DNA double-strand break repair RAD50 ATPase; RECA- | 96.72 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 96.72 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 96.71 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 96.7 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 96.7 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 96.7 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 96.69 | |
| 2fu5_C | 183 | RAS-related protein RAB-8A; MSS4:RAB8 protein comp | 96.69 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 96.68 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 96.68 | |
| 3i8s_A | 274 | Ferrous iron transport protein B; GTPase, GPCR, ir | 96.66 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 96.65 | |
| 3iby_A | 256 | Ferrous iron transport protein B; G protein, G dom | 96.65 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 96.65 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 96.63 | |
| 2g3y_A | 211 | GTP-binding protein GEM; small GTPase, GDP, inacti | 96.63 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 96.62 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 96.62 |
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
Probab=100.00 E-value=4.8e-37 Score=224.42 Aligned_cols=189 Identities=46% Similarity=0.737 Sum_probs=170.9
Q ss_pred cccCCCCCeEEEEEcCCCCChHHHHHHHHHHhCCeEeeHHHHHHHHHHcCCCcHHHHHHHHHcCCCCCHHHHHHHHHHHH
Q 027995 14 ATVTVKKPTVVFVLGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIKSGSENGTMIQNMIKEGKIVPSEVTIKLLQKAM 93 (215)
Q Consensus 14 ~~~~~~~~~~I~i~G~~gsGKsTla~~La~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 93 (215)
..-...++++|+|.|||||||+|+|+.|++++|+.+++++|++|+.+..+++.+..+..++..|..+|++.+..++.+++
T Consensus 22 ~~~~~~k~kiI~llGpPGsGKgTqa~~L~~~~g~~hIstGdllR~~i~~~t~lg~~~~~~~~~G~lVpde~~~~lv~~~l 101 (217)
T 3umf_A 22 TDQKLAKAKVIFVLGGPGSGKGTQCEKLVQKFHFNHLSSGDLLRAEVQSGSPKGKELKAMMERGELVPLEVVLALLKEAM 101 (217)
T ss_dssp --CCTTSCEEEEEECCTTCCHHHHHHHHHHHHCCEEECHHHHHHHHHTTCCHHHHHHHHHHHHTCCCCHHHHHHHHHHHH
T ss_pred cchhccCCcEEEEECCCCCCHHHHHHHHHHHHCCceEcHHHHHHHHHHcCCchHHHHHHHHhcCCCCCHHHHHHHHHHHH
Confidence 33345678999999999999999999999999999999999999999999999999999999999999999999999988
Q ss_pred HccC--CCeEEEeCCCCCHHHHHHHHHhcCCCCcEEEEEecCHHHHHHHHhhc--cCCCCCCcHHHHHHHHHHHhhcchh
Q 027995 94 EESG--NDKFLIDGFPRNEENRAAFEAVTKIEPEFVLFFDCSEEEMERRILNR--NQGREDDNVETIRKRFKVFLESSLP 169 (215)
Q Consensus 94 ~~~~--~~~~iidg~~~~~~~~~~~~~~~~~~~~~~i~L~~~~e~~~~R~~~r--~~~~~~~~~~~~~~~~~~~~~~~~~ 169 (215)
.+.. ..++|+||||++..+...|.. ....++.+|+|++|.+++.+|+..| ..+|.++..+.+.+|+..|++...+
T Consensus 102 ~~~~~~~~g~ilDGfPRt~~Qa~~l~~-~~~~~~~vi~l~v~~e~~~~Rl~~R~~~~~R~DD~~e~i~~Rl~~Y~~~t~p 180 (217)
T 3umf_A 102 IKLVDKNCHFLIDGYPRELDQGIKFEK-EVCPCLCVINFDVSEEVMRKRLLKRAETSNRVDDNEETIVKRFRTFNELTKP 180 (217)
T ss_dssp HHHTTTCSEEEEETBCSSHHHHHHHHH-HTCCCSEEEEEECCHHHHHHHHSCC------CHHHHHHHHHHHHHHHHHTHH
T ss_pred hhccccccCcccccCCCcHHHHHHHHH-hCCccCEEEeccCCHHHHHHHHhcccccCCCCCCCHHHHHHHHHHHHHHHHH
Confidence 7643 678999999999999999998 7888999999999999999999998 4567888899999999999999999
Q ss_pred HHHHHHhcCcEEEEcCCCCHHHHHHHHHHhhCCC
Q 027995 170 VVQYYEAKGKVRKIDAAKPVAEVFDAVKAVFTPK 203 (215)
Q Consensus 170 ~~~~~~~~~~~~~id~~~~~~e~~~~i~~~l~~~ 203 (215)
+.++|.+.+.++.||++.+++++++.|.+.|+..
T Consensus 181 l~~~Y~~~~~l~~Idg~~~~eeV~~~I~~~l~k~ 214 (217)
T 3umf_A 181 VIEHYKQQNKVITIDASGTVDAIFDKVNHELQKF 214 (217)
T ss_dssp HHHHHHTTTCEEEEETTSCHHHHHHHHHHHHHTT
T ss_pred HHHHHHhcCCEEEEECCCCHHHHHHHHHHHHHHc
Confidence 9999999989999999999999999999988653
|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* | Back alignment and structure |
|---|
| >3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >1p6x_A Thymidine kinase; P-loop, LID, transferase; HET: THM; 2.00A {Equid herpesvirus 4} SCOP: c.37.1.1 PDB: 1p72_A* 1p73_A* 1p75_A* | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1osn_A Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, transferase; HET: BVP ADP; 3.20A {Human herpesvirus 3} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >1e2k_A Thymidine kinase; transferase, antiviral drug, enzyme-prodrug gene therapy, sugar ring pucker; HET: TMC; 1.7A {Herpes simplex virus} SCOP: c.37.1.1 PDB: 1e2i_A* 1e2h_A* 1e2m_A* 1e2n_A* 1e2p_A* 1ki2_A* 1ki3_A* 1ki4_A* 1ki6_B* 1ki7_A* 1ki8_A* 3rdp_A* 2ki5_A* 1kim_A* 1qhi_A* 1p7c_A* 1vtk_A* 2vtk_A* 3vtk_A* 3f0t_A* ... | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >3czq_A Putative polyphosphate kinase 2; structural genomics, APC6299, PSI-2, structure initiative; HET: MSE GOL; 2.23A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >3czp_A Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2, structural protein structure initiative, midwest center for structural genomics; HET: MSE; 2.00A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3czp_A Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2, structural protein structure initiative, midwest center for structural genomics; HET: MSE; 2.00A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* | Back alignment and structure |
|---|
| >1dek_A Deoxynucleoside monophosphate kinase; transferase, phosphotransferase; HET: DGP; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 PDB: 1del_A* | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >3rhf_A Putative polyphosphate kinase 2 family protein; PSI-biology, MCSG, structural genomics, midwest center for S genomics; HET: PGE FLC PG4; 2.45A {Arthrobacter aurescens} | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
| >3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
|---|
| >2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* | Back alignment and structure |
|---|
| >3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* | Back alignment and structure |
|---|
| >2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* | Back alignment and structure |
|---|
| >2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 215 | ||||
| d1teva_ | 194 | c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) | 2e-39 | |
| d1qf9a_ | 194 | c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoi | 2e-39 | |
| d1s3ga1 | 182 | c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bac | 3e-39 | |
| d3adka_ | 194 | c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [ | 1e-38 | |
| d1zina1 | 182 | c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bac | 2e-37 | |
| d1ak2a1 | 190 | c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Co | 5e-36 | |
| d1ukza_ | 196 | c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Sac | 1e-35 | |
| d2cdna1 | 181 | c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium | 2e-35 | |
| d2ak3a1 | 189 | c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow | 5e-33 | |
| d1zaka1 | 189 | c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Mai | 1e-32 | |
| d1e4va1 | 179 | c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Esc | 2e-32 | |
| d1akya1 | 180 | c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Bak | 3e-29 | |
| d1ly1a_ | 152 | c.37.1.1 (A:) Polynucleotide kinase, kinase domain | 1e-14 | |
| d1nksa_ | 194 | c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobu | 8e-13 | |
| d1knqa_ | 171 | c.37.1.17 (A:) Gluconate kinase {Escherichia coli | 1e-12 | |
| d2bdta1 | 176 | c.37.1.25 (A:1-176) Hypothetical protein BH3686 {B | 2e-11 | |
| d1ckea_ | 225 | c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: | 3e-11 | |
| d1khta_ | 190 | c.37.1.1 (A:) Adenylate kinase {Archaeon Methanoco | 4e-11 | |
| d1q3ta_ | 223 | c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae | 1e-10 | |
| d1rkba_ | 173 | c.37.1.1 (A:) Adenylate kinase {Human (Homo sapien | 4e-10 | |
| d1y63a_ | 174 | c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishma | 1e-08 | |
| d1zp6a1 | 176 | c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { | 2e-07 | |
| d1bifa1 | 213 | c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fruct | 1e-05 | |
| d1qhxa_ | 178 | c.37.1.3 (A:) Chloramphenicol phosphotransferase { | 1e-05 | |
| d1gvnb_ | 273 | c.37.1.21 (B:) Plasmid maintenance system epsilon/ | 1e-05 | |
| d1yj5a2 | 172 | c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' p | 4e-05 | |
| d1nn5a_ | 209 | c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapi | 1e-04 | |
| d1e6ca_ | 170 | c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chr | 2e-04 | |
| d4tmka_ | 210 | c.37.1.1 (A:) Thymidylate kinase {Escherichia coli | 2e-04 | |
| d1rz3a_ | 198 | c.37.1.6 (A:) Hypothetical protein rbstp0775 {Baci | 6e-04 | |
| d1uf9a_ | 191 | c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermo | 0.002 | |
| d2vp4a1 | 197 | c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fr | 0.003 | |
| d1deka_ | 241 | c.37.1.1 (A:) Deoxynucleoside monophosphate kinase | 0.003 | |
| d1lw7a2 | 192 | c.37.1.1 (A:220-411) Transcriptional regulator Nad | 0.003 |
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 194 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Nucleotide and nucleoside kinases domain: UMP/CMP kinase species: Human (Homo sapiens) [TaxId: 9606]
Score = 132 bits (332), Expect = 2e-39
Identities = 99/190 (52%), Positives = 129/190 (67%), Gaps = 10/190 (5%)
Query: 21 PTVVFVLGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIKSGSENGT-MIQNMIKEGKI 79
P VVFVLGGPG+GKGTQCA IVE +GYTHLSAG+LLR E K+ +I+ IKEGKI
Sbjct: 1 PLVVFVLGGPGAGKGTQCARIVEKYGYTHLSAGELLRDERKNPDSQYGELIEKYIKEGKI 60
Query: 80 VPSEVTIKLLQKAMEES-----GNDKFLIDGFPRNEENRAAFEA--VTKIEPEFVLFFDC 132
VP E+TI LL++ M+++ +KFLIDGFPRN++N + K + FVLFFDC
Sbjct: 61 VPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDC 120
Query: 133 SEEEMERRILNR--NQGREDDNVETIRKRFKVFLESSLPVVQYYEAKGKVRKIDAAKPVA 190
+ E R L R + GR DDN E++ KR + +L+S+ P++ YE GKV+KIDA+K V
Sbjct: 121 NNEICIERCLERGKSSGRSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKKIDASKSVD 180
Query: 191 EVFDAVKAVF 200
EVFD V +F
Sbjct: 181 EVFDEVVQIF 190
|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Length = 194 | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Length = 182 | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Length = 194 | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Length = 182 | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Length = 190 | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 196 | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Length = 189 | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Length = 189 | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Length = 179 | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 180 | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Length = 152 | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 194 | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Length = 171 | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Length = 176 | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Length = 225 | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Length = 190 | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Length = 223 | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Length = 173 | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Length = 174 | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 213 | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Length = 178 | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 172 | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 209 | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Length = 170 | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Length = 210 | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Length = 198 | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Length = 191 | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 197 | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Length = 241 | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Length = 192 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 215 | |||
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 100.0 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 100.0 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 100.0 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 100.0 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 99.98 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 99.98 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 99.98 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 99.98 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 99.97 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 99.97 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 99.97 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 99.97 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 99.86 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 99.83 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 99.81 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 99.81 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 99.8 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 99.8 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 99.79 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 99.78 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 99.76 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 99.76 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 99.75 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 99.75 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 99.74 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 99.73 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 99.72 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 99.71 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 99.7 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 99.68 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 99.68 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 99.68 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 99.66 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 99.65 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 99.64 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 99.63 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 99.6 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 99.59 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 99.58 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 99.57 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 99.53 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 99.44 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 99.44 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 99.43 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 99.43 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 99.41 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 99.39 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 99.36 | |
| d1e2ka_ | 329 | Thymidine kinase {Herpes simplex virus type 1, dif | 99.28 | |
| d1p6xa_ | 333 | Thymidine kinase {Equine herpesvirus type 4 [TaxId | 99.26 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 99.26 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 99.21 | |
| d1osna_ | 331 | Thymidine kinase {Varicella-zoster virus [TaxId: 1 | 99.21 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 99.04 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 98.93 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 98.91 | |
| d2axpa1 | 164 | Hypothetical protein YorR {Bacillus subtilis [TaxI | 98.64 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 98.63 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 98.56 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 98.47 | |
| d1kjwa2 | 199 | Guanylate kinase-like domain of Psd-95 {Rat (Rattu | 98.42 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 98.37 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 98.35 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 98.35 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 98.33 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 98.3 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 98.29 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 98.27 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 98.26 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 98.24 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 98.22 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 98.16 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 98.16 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 98.16 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 98.12 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 98.11 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 98.11 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 98.09 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 98.06 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 98.0 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 97.99 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 97.98 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 97.98 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 97.95 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 97.91 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 97.91 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 97.9 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 97.87 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 97.87 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 97.83 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 97.82 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 97.82 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 97.78 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 97.69 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 97.68 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 97.67 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 97.66 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 97.65 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 97.64 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 97.64 | |
| d1g8fa3 | 122 | ATP sulfurylase C-terminal domain {Baker's yeast ( | 97.64 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 97.63 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 97.61 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 97.61 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 97.6 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 97.59 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 97.57 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 97.56 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 97.56 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 97.56 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 97.55 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 97.54 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 97.53 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 97.52 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 97.52 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 97.51 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 97.49 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 97.48 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 97.46 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 97.46 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 97.45 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 97.44 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 97.43 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 97.42 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 97.4 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 97.4 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 97.4 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 97.39 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 97.39 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 97.37 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 97.36 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 97.36 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 97.35 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 97.34 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 97.33 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 97.31 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 97.3 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 97.3 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 97.27 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 97.26 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 97.25 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 97.25 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 97.24 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 97.23 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 97.22 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 97.21 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 97.21 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 97.18 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 97.16 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 97.16 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 97.15 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 97.12 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 97.12 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 97.12 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 97.12 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 97.11 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 97.1 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 97.09 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 97.09 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 97.08 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 97.07 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 97.07 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 97.07 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 97.07 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 97.06 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 97.06 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 97.06 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 97.06 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 97.05 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 97.02 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 97.01 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 97.0 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 96.99 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 96.99 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 96.99 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 96.98 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 96.97 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 96.97 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 96.96 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 96.95 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 96.95 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 96.94 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 96.93 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 96.93 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 96.92 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 96.92 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 96.92 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 96.91 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 96.91 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 96.91 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 96.89 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 96.87 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 96.86 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 96.86 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 96.85 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 96.81 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 96.81 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 96.81 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 96.8 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 96.79 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 96.75 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 96.74 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 96.73 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 96.72 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 96.71 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 96.69 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 96.68 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 96.67 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 96.64 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 96.64 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 96.62 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 96.6 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 96.6 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 96.58 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 96.54 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 96.51 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 96.5 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 96.46 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 96.41 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 96.4 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 96.38 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 96.37 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 96.36 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 96.36 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 96.36 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 96.34 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 96.31 | |
| d1ni3a1 | 296 | YchF GTP-binding protein N-terminal domain {Fissio | 96.19 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 96.11 | |
| d2qn6a3 | 205 | Initiation factor eIF2 gamma subunit, N-terminal ( | 96.11 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 96.1 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 96.09 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 96.08 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 96.07 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 96.03 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 96.01 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 96.01 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 95.95 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 95.89 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 95.78 | |
| d1c9ka_ | 180 | Adenosylcobinamide kinase/adenosylcobinamide phosp | 95.77 | |
| d1jala1 | 278 | YchF GTP-binding protein N-terminal domain {Haemop | 95.69 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 95.67 | |
| d1d2ea3 | 196 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 95.58 | |
| d1puja_ | 273 | Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 | 95.41 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 95.35 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 95.23 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 95.11 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 95.08 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 94.96 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 94.89 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 94.72 | |
| d1kk1a3 | 195 | Initiation factor eIF2 gamma subunit, N-terminal ( | 94.71 | |
| d1wxqa1 | 319 | GTP-binding protein PH0525 {Pyrococcus horikoshii | 94.69 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 94.6 | |
| d1f5na2 | 277 | Interferon-induced guanylate-binding protein 1 (GB | 94.43 | |
| d1jnya3 | 224 | Elongation factor eEF-1alpha, N-terminal (G) domai | 94.39 | |
| d1zunb3 | 222 | Sulfate adenylate transferase subunit cysN/C, EF-T | 94.38 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 94.29 | |
| d1xx6a1 | 141 | Thymidine kinase, TK1, N-terminal domain {Clostrid | 94.27 | |
| d1r5ba3 | 245 | Eukaryotic peptide chain release factor ERF2, G do | 94.13 | |
| d1xbta1 | 133 | Thymidine kinase, TK1, N-terminal domain {Human (H | 93.76 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 93.72 | |
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 93.52 | |
| d1f60a3 | 239 | Elongation factor eEF-1alpha, N-terminal (G) domai | 93.48 | |
| d1jwyb_ | 306 | Dynamin G domain {Dictyostelium discoideum [TaxId: | 93.18 | |
| d2olra1 | 313 | Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo | 93.1 | |
| d1lkxa_ | 684 | Myosin S1, motor domain {Dictyostelium discoideum, | 93.09 | |
| d1br2a2 | 710 | Myosin S1, motor domain {Chicken (Gallus gallus), | 93.07 | |
| d1ii2a1 | 323 | Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo | 92.94 | |
| d1d0xa2 | 712 | Myosin S1, motor domain {Dictyostelium discoideum | 92.9 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 92.9 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 92.88 | |
| d1w7ja2 | 730 | Myosin S1, motor domain {Chicken (Gallus gallus), | 92.75 | |
| d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 92.68 | |
| d2mysa2 | 794 | Myosin S1, motor domain {Chicken (Gallus gallus), | 92.66 | |
| d1j3ba1 | 318 | Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo | 92.5 | |
| d2akab1 | 299 | Dynamin G domain {Rat (Rattus norvegicus) [TaxId: | 92.33 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 92.22 | |
| d1kk8a2 | 789 | Myosin S1, motor domain {Bay scallop (Aequipecten | 92.07 | |
| d1n0ua2 | 341 | Elongation factor 2 (eEF-2), N-terminal (G) domain | 91.91 | |
| d1fx0a3 | 276 | Central domain of alpha subunit of F1 ATP synthase | 91.25 | |
| d2b8ta1 | 139 | Thymidine kinase, TK1, N-terminal domain {Ureaplas | 91.2 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 91.18 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 91.0 | |
| d1p3da1 | 96 | UDP-N-acetylmuramate-alanine ligase MurC {Haemophi | 89.98 | |
| d1e8ca3 | 234 | UDP-N-acetylmuramyl tripeptide synthetase MurE {Es | 85.93 | |
| d1w36b1 | 485 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 84.44 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 83.77 | |
| d1t5la1 | 413 | Nucleotide excision repair enzyme UvrB {Bacillus c | 80.4 |
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Nucleotide and nucleoside kinases domain: UMP/CMP kinase species: Dictyostelium discoideum [TaxId: 44689]
Probab=100.00 E-value=2.5e-33 Score=201.61 Aligned_cols=187 Identities=54% Similarity=0.924 Sum_probs=168.1
Q ss_pred cCCCCCeEEEEEcCCCCChHHHHHHHHHHhCCeEeeHHHHHHHHHHcCCCcHHHHHHHHHcCCCCCHHHHHHHHHHHHHc
Q 027995 16 VTVKKPTVVFVLGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIKSGSENGTMIQNMIKEGKIVPSEVTIKLLQKAMEE 95 (215)
Q Consensus 16 ~~~~~~~~I~i~G~~gsGKsTla~~La~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 95 (215)
+..++|.+|+|.|||||||||+|+.||+++|+.+++.|++++.........+.........+...+.......+......
T Consensus 1 ~~~~kp~iI~i~G~pGSGKsT~a~~La~~~g~~~i~~g~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 80 (194)
T d1qf9a_ 1 MEKSKPNVVFVLGGPGSGKGTQCANIVRDFGWVHLSAGDLLRQEQQSGSKDGEMIATMIKNGEIVPSIVTVKLLKNAIDA 80 (194)
T ss_dssp CCCCCCEEEEEEESTTSSHHHHHHHHHHHHCCEEEEHHHHHHHHHHTTCTTHHHHHHHHHTTCCCCHHHHHHHHHHHHHT
T ss_pred CCCCCCcEEEEECCCCCCHHHHHHHHHHHHCCceEchhhHHHHHhhhhhhhhhhhhhHhhhccccchHHHHHHHHHHhhh
Confidence 35678999999999999999999999999999999999999999988889999999999999999998888888887776
Q ss_pred cCCCeEEEeCCCCCHHHHHHHHHh--cCCCCcEEEEEecCHHHHHHHHhhc--cCCCCCCcHHHHHHHHHHHhhcchhHH
Q 027995 96 SGNDKFLIDGFPRNEENRAAFEAV--TKIEPEFVLFFDCSEEEMERRILNR--NQGREDDNVETIRKRFKVFLESSLPVV 171 (215)
Q Consensus 96 ~~~~~~iidg~~~~~~~~~~~~~~--~~~~~~~~i~L~~~~e~~~~R~~~r--~~~~~~~~~~~~~~~~~~~~~~~~~~~ 171 (215)
....++++||+|.+..+...+... ....|+++|+|++|++++.+|+.+| ...+..+..+.+.+|+..|+....++.
T Consensus 81 ~~~~~~i~dg~p~~~~~~~~l~~~~~~~~~~~~vi~l~~~~~~~~~R~~~~~~~~~~~~d~~e~~~~Rl~~y~~~~~~~~ 160 (194)
T d1qf9a_ 81 NQGKNFLVDGFPRNEENNNSWEENMKDFVDTKFVLFFDCPEEVMTQRLLKRGESSGRSDDNIESIKKRFNTFNVQTKLVI 160 (194)
T ss_dssp STTCCEEEETCCCSHHHHHHHHHHHTTTCEEEEEEEEECCHHHHHHHHHHHHTTSCCTTCSHHHHHHHHHHHHHTHHHHH
T ss_pred hhcCCeEEEecchhhhhHHHHHhhhhhcccccEEEEeecchHHHHHHHHhhccccccccccHHHHHHHHHHHHHHHHHHH
Confidence 667899999999999988877664 4567899999999999999999887 445677789999999999999999999
Q ss_pred HHHHhcCcEEEEcCCCCHHHHHHHHHHhhCC
Q 027995 172 QYYEAKGKVRKIDAAKPVAEVFDAVKAVFTP 202 (215)
Q Consensus 172 ~~~~~~~~~~~id~~~~~~e~~~~i~~~l~~ 202 (215)
++|...+.+.+||++.+++++++.|.+.|+.
T Consensus 161 ~~y~~~~~~~~Id~~~~ieeV~~~I~~ii~~ 191 (194)
T d1qf9a_ 161 DHYNKFDKVKIIPANRDVNEVYNDVENLFKS 191 (194)
T ss_dssp HHHHHTTCEEEEECSSCHHHHHHHHHHHHHH
T ss_pred HHHHhCCCEEEEECCCCHHHHHHHHHHHHHH
Confidence 9999888899999999999999999998864
|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} | Back information, alignment and structure |
|---|
| >d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2axpa1 c.37.1.1 (A:2-165) Hypothetical protein YorR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1e8ca3 c.72.2.1 (A:104-337) UDP-N-acetylmuramyl tripeptide synthetase MurE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|