Citrus Sinensis ID: 028014


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-----
MSLFGLGRNQRTFRPKKSAPSGSKGAQLRKHIDATLGSGNLREAVRLPPGEDLNEWLAVNTVDFFNQVNLLYGTLTEFCTAENCPTMTAGPKYEYRWADGVQIKKPIEVSAPKYVEYLMDWIESQLDDESIFPQKLGAPFPSNFKEVVKTIFKRLFRVYAHIYHSHFQKIVSLKEEAHLNTCFKHFILFTCEFGLIDKKELGPLQELIDSIIVPY
cccccccccccccccccccccccccHHHHHHHHHccccccHHHHcccccccccccHHHHcHHHHHHHHHHHHHHHccccccccccccccccccEEEEcccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHccccc
******************************HIDATLGSGNLREAVRLPPGEDLNEWLAVNTVDFFNQVNLLYGTLTEFCTAENCPTMTAGPKYEYRWADGVQIKKPIEVSAPKYVEYLMDWIESQLDDESIFPQKLGAPFPSNFKEVVKTIFKRLFRVYAHIYHSHFQKIVSLKEEAHLNTCFKHFILFTCEFGLIDKKELGPLQELIDSIIVPY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLFGLGRNQRTFRPKKSAPSGSKGAQLRKHIDATLGSGNLREAVRLPPGEDLNEWLAVNTVDFFNQVNLLYGTLTEFCTAENCPTMTAGPKYEYRWADGVQIKKPIEVSAPKYVEYLMDWIESQLDDESIFPQKLGAPFPSNFKEVVKTIFKRLFRVYAHIYHSHFQKIVSLKEEAHLNTCFKHFILFTCEFGLIDKKELGPLQELIDSIIVPY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
MOB kinase activator 1A Activator of LATS1/2 in the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. Stimulates the kinase activity of STK38 and STK38L. Acts cooperatively with STK3/MST2 to activate STK38.probableQ921Y0
MOB kinase activator 1B Activator of LATS1/2 in the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. Stimulates the kinase activity of STK38L.probableQ7L9L4
MOB kinase activator 1A Activator of LATS1/2 in the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. Stimulates the kinase activity of STK38 and STK38L. Acts cooperatively with STK3/MST2 to activate STK38.probableQ9H8S9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PI1, chain A
Confidence level:very confident
Coverage over the Query: 33-214
View the alignment between query and template
View the model in PyMOL
Template: 2HJN, chain A
Confidence level:very confident
Coverage over the Query: 8-14,27-213
View the alignment between query and template
View the model in PyMOL