Citrus Sinensis ID: 028016


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-----
MVEHLQHYGVITSKKVSEVMETIDRACFVPDGTPPYVDSPMAIGYNATISAPHMHATCLQLLEENLKPGMHALDIGSGTGYLTACFALMVGPQGRAVGVEHIPELVVSSIQNIEKSAAAPLLKEGSLSVHVGDGRKGWPEFAPYDAIHVGAAAPEIPQALIDQLKPGGRMVIPVGNIFQDLKVVDKNQDGSLSIWSETSVRYVPLTSRDAQLRGW
cHHHHHHccccccHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccEEEEcccHHHHHHHHHHHHcccccEEEEECcHHHHHHHHHHHHHHccccccccccEEEEEccccccccccccccEEEEccccccccHHHHHccccccEEEEEEccccEEEEEEEEcccccEEEEECccEEEEcccccccccccc
MVEHLQHYGVITSKKVSEVMETIDRACFVPDGTPPYVDSPMAIGYNATISAPHMHATCLQLLEENLKPGMHALDIGSGTGYLTACFALMVGPQGRAVGVEHIPELVVSSIQNIEKSAAAPLLKEGSLSVHVGDGRKGWPEFAPYDAIHVGAAAPEIPQALIDQLKPGGRMVIPVGNIFQDLKVVDKNQDGSLSIWSETSVRYVPLTSR*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVEHLQHYGVITSKKVSEVMETIDRACFVPDGTPPYVDSPMAIGYNATISAPHMHATCLQLLEENLKPGMHALDIGSGTGYLTACFALMVGPQGRAVGVEHIPELVVSSIQNIEKSAAAPLLKEGSLSVHVGDGRKGWPEFAPYDAIHVGAAAPEIPQALIDQLKPGGRMVIPVGNIFQDLKVVDKNQDGSLSIWSETSVRYVPLTSRDAQLRGW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein-L-isoaspartate O-methyltransferase Catalyzes the methyl esterification of L-isoaspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins. This enzyme does not act on D-aspartyl residues.confidentQ42539
Protein-L-isoaspartate(D-aspartate) O-methyltransferase Catalyzes the methyl esterification of L-isoaspartyl and D-aspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins. Acts on microtubule-associated protein 2, calreticulin, clathrin light chains a and b, Ubiquitin carboxyl-terminal hydrolase isozyme L1, phosphatidylethanolamine-binding protein 1, stathmin, beta-synuclein and alpha-synuclein.probableQ5RA89
Protein-L-isoaspartate O-methyltransferase Catalyzes the methyl esterification of L-isoaspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins. This enzyme does not act on D-aspartyl residues.probableQ43209

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.1.-.-Transferring one-carbon groups.probable
2.1.1.-15-hydroxyprostaglandin-I dehydrogenase (NADP(+)).probable
2.1.1.77Transferred entry: 2.1.1.77, 2.1.1.80 and 2.1.1.100.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I1N, chain A
Confidence level:very confident
Coverage over the Query: 1-215
View the alignment between query and template
View the model in PyMOL