Citrus Sinensis ID: 028068


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210----
MRTTFPEYVVALATIVGSVLFSIFGGVGIACLPLGLIFSFIRRPKAVITRSQYIKEATELGKKARELKKAADTLHQEERSGSKGRKWRKNVKSVEKELLQLEEDVKLLEEMYPQGEKAETSWALTVLGYLAKLVLGILGFIVSVAWVAHIVIYLLINPPLHPFLNEVFIKLDDLWGLLGTAAFAFFCFYLLLAVIAGAMMLGLRLVFITIHPMK
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEccccc
*RTTFPEYVVALATIVGSVLFSIFGGVGIACLPLGLIFSFIRRPKAVITRSQYIK***ELGK*********************************KELLQLEEDVKLLEEMYPQGEKAETSWALTVLGYLAKLVLGILGFIVSVAWVAHIVIYLLINPPLHPFLNEVFIKLDDLWGLLGTAAFAFFCFYLLLAVIAGAMMLGLRLVFITIHPMK
xxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRTTFPEYVVALATIVGSVLFSIFGGVGIACLPLGLIFSFIRRPKAVITRSQYIKExxxxxxxxxxxxxxxxxxxxxERSGSKxxxxxxxxxxxxxxxxxxxxxxxxxxxxYPQGEKAETSWALTVLGYLAKLVLGILGFIVSVAWVAHIVIYLLINPPLHPFLNEVFIKLDDLWGLLGTAAFAFFCFYLLLAVIAGAMMLGLRLVFITIHPMK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
LIMR family protein At5g01460 probableQ9M028
LIMR family protein At3g08930 probableQ9SR93
LIMR family protein Os06g0128200 probableQ658I5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YY0, chain A
Confidence level:probable
Coverage over the Query: 44-77
View the alignment between query and template
View the model in PyMOL
Template: 3S9G, chain A
Confidence level:probable
Coverage over the Query: 48-110
View the alignment between query and template
View the model in PyMOL