Query         028069
Match_columns 214
No_of_seqs    17 out of 19
Neff          2.1 
Searched_HMMs 29240
Date          Mon Mar 25 08:59:30 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/028069.a3m -d /work/01045/syshi/HHdatabase/pdb70.hhm -o /work/01045/syshi/hhsearch_pdb/028069hhsearch_pdb -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 1iqo_A Hypothetical protein MT  19.0      88   0.003   23.7   3.1   36  159-194     3-38  (88)
  2 2yuf_A NGFI-A-binding protein   16.0      43  0.0015   27.3   0.8   17   60-76     70-86  (142)
  3 1bts_A BAND 3 anion transport   14.7      79  0.0027   18.9   1.6   13  150-162    11-23  (26)
  4 2aby_A Hypothetical protein TA  12.4      34  0.0012   27.9  -0.7   15  129-143   131-145 (146)
  5 3hxi_C Eukaryotic translation   12.2      77  0.0026   18.6   1.0    8   13-20      2-9   (21)
  6 2f95_B Sensory rhodopsin II tr  10.3 1.3E+02  0.0043   20.8   1.7   17  148-164    60-76  (163)
  7 4ase_A Vascular endothelial gr   8.7   2E+02  0.0069   24.2   2.7   42  149-196   270-312 (353)
  8 4f9c_A Cell division cycle 7-r   8.3 1.5E+02  0.0051   24.8   1.7   15  149-163   230-244 (361)
  9 3arc_T Photosystem II reaction   7.4 4.8E+02   0.016   16.5   3.4    6  175-180    23-28  (32)
 10 3owq_A LIN1025 protein; struct   6.5 1.1E+02  0.0037   26.6   0.0   15  148-162    16-30  (321)

No 1  
>1iqo_A Hypothetical protein MTH1880; beta-alpha, anti-parallel, calcium binding, structural genomics, metal binding protein; NMR {Methanothermobacter} SCOP: d.214.1.1 PDB: 1iqs_A
Probab=19.05  E-value=88  Score=23.66  Aligned_cols=36  Identities=17%  Similarity=0.292  Sum_probs=31.5

Q ss_pred             hhceeEEEeecCCccCCCCChhhhhhhhhccccCCC
Q 028069          159 VACGIAVATYNEGATDFKETPAYKESVQSRDLLEGP  194 (214)
Q Consensus       159 iacg~a~~TYnegatdFretp~~kesvqsqe~~eep  194 (214)
                      ||.++-+++|++=+.++...-.||-+++-++|-+.+
T Consensus         3 vAtL~gI~~~keL~ee~~~fv~~kA~~ekreLkddd   38 (88)
T 1iqo_A            3 IATLKGIFTLKDLPEEFRPFVDYKAGLEKKKLSDDD   38 (88)
T ss_dssp             CCCEEEEECSTTCSTTTCCSTHHHHTTTTCCCSSCC
T ss_pred             eEEEEEEEEhhhcchhHhhHhhhhhhhhcccCCCCC
Confidence            678888999999999999999999999988875443


No 2  
>2yuf_A NGFI-A-binding protein 1; transcriptional repressor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=16.01  E-value=43  Score=27.34  Aligned_cols=17  Identities=53%  Similarity=0.798  Sum_probs=12.9

Q ss_pred             cccccccccCcCCcCCC
Q 028069           60 KLSSRTGRFDSKNRRGN   76 (214)
Q Consensus        60 k~ssrtgRfdsK~RR~~   76 (214)
                      |-|.=-||||+|+|-+.
T Consensus        70 KYSaIYGRFDsKRr~~K   86 (142)
T 2yuf_A           70 KYSAIYGRFDSKRKDGK   86 (142)
T ss_dssp             HHCCSSSCSCCCTTCCC
T ss_pred             HHHHHHcccccccCCCC
Confidence            44556799999988766


No 3  
>1bts_A BAND 3 anion transport protein; transmembrane protein; NMR {Homo sapiens} SCOP: j.35.1.1 PDB: 1btt_A
Probab=14.69  E-value=79  Score=18.85  Aligned_cols=13  Identities=38%  Similarity=0.557  Sum_probs=9.9

Q ss_pred             HHHHHHHHHhhce
Q 028069          150 WAFGIVFALVACG  162 (214)
Q Consensus       150 wafGV~faliacg  162 (214)
                      .+-|++|+|+++.
T Consensus        11 ai~Gi~f~lf~gQ   23 (26)
T 1bts_A           11 AVQGILFALLGAX   23 (26)
T ss_dssp             HHHHHHHHHTTC-
T ss_pred             HHHHHHHHHHhcc
Confidence            5679999988763


No 4  
>2aby_A Hypothetical protein TA0743; helix-turn-helix, unknown function; NMR {Thermoplasma acidophilum}
Probab=12.41  E-value=34  Score=27.89  Aligned_cols=15  Identities=47%  Similarity=1.035  Sum_probs=12.4

Q ss_pred             CCCCCCCCCCcchhH
Q 028069          129 LEPDFWEGPQWGAFG  143 (214)
Q Consensus       129 ~ePDFWEGpQWd~lG  143 (214)
                      .|-|.||.|-|+..|
T Consensus       131 EEYDLWeDPiW~YI~  145 (146)
T 2aby_A          131 EEYDLWEDPIWQYIG  145 (146)
T ss_dssp             SSSCSCCSHHHHCC-
T ss_pred             hhhhhhhhhHHHhcc
Confidence            468999999999877


No 5  
>3hxi_C Eukaryotic translation initiation factor 4E- binding protein 1; protein-mRNA CAP complex, acetylation, phosphoprotein, protein synthesis inhibitor; HET: GTG; 1.80A {Homo sapiens} PDB: 3hxg_C*
Probab=12.25  E-value=77  Score=18.63  Aligned_cols=8  Identities=38%  Similarity=0.854  Sum_probs=6.7

Q ss_pred             CcceEEec
Q 028069           13 SGSRILYT   20 (214)
Q Consensus        13 gG~ri~~t   20 (214)
                      ||.||+|.
T Consensus         2 GGTrIiYd    9 (21)
T 3hxi_C            2 GSGRIIYD    9 (26)
T ss_pred             CceEEEEe
Confidence            78899985


No 6  
>2f95_B Sensory rhodopsin II transducer; membrane protein complex, signal transduction, photocycle ST membrane protein; HET: BOG RET; 2.20A {Natronomonas pharaonis} SCOP: f.17.4.1
Probab=10.30  E-value=1.3e+02  Score=20.80  Aligned_cols=17  Identities=12%  Similarity=0.094  Sum_probs=7.1

Q ss_pred             HHHHHHHHHHHhhceeE
Q 028069          148 YLWAFGIVFALVACGIA  164 (214)
Q Consensus       148 ylwafGV~faliacg~a  164 (214)
                      +++++++++.+++++++
T Consensus        60 ~~~~~~~~~~~~~~~~~   76 (163)
T 2f95_B           60 AILGLIILLGINLGLVA   76 (163)
T ss_dssp             HHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            33444444444444443


No 7  
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A*
Probab=8.71  E-value=2e+02  Score=24.18  Aligned_cols=42  Identities=17%  Similarity=0.449  Sum_probs=24.2

Q ss_pred             HHHHHHHHH-HhhceeEEEeecCCccCCCCChhhhhhhhhccccCCCCC
Q 028069          149 LWAFGIVFA-LVACGIAVATYNEGATDFKETPAYKESVQSRDLLEGPDA  196 (214)
Q Consensus       149 lwafGV~fa-liacg~a~~TYnegatdFretp~~kesvqsqe~~eepe~  196 (214)
                      .|+|||++- ++++|-.      +-.+......+...|+...-++-|+.
T Consensus       270 VwS~Gv~l~El~t~G~~------Pf~~~~~~~~~~~~i~~g~~~~~p~~  312 (353)
T 4ase_A          270 VWSFGVLLWEIFSLGAS------PYPGVKIDEEFCRRLKEGTRMRAPDY  312 (353)
T ss_dssp             HHHHHHHHHHHTTTSCC------SSTTCCCSHHHHHHHHHTCCCCCCTT
T ss_pred             EeehHHHHHHHHhCCCC------CCCCCCHHHHHHHHHHcCCCCCCCcc
Confidence            799999887 4454421      11233334556666666655655554


No 8  
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A*
Probab=8.26  E-value=1.5e+02  Score=24.79  Aligned_cols=15  Identities=27%  Similarity=0.826  Sum_probs=12.7

Q ss_pred             HHHHHHHHHHhhcee
Q 028069          149 LWAFGIVFALVACGI  163 (214)
Q Consensus       149 lwafGV~faliacg~  163 (214)
                      +|++||++.-+.+|-
T Consensus       230 iWSlG~il~ell~G~  244 (361)
T 4f9c_A          230 MWSAGVIFLSLLSGR  244 (361)
T ss_dssp             HHHHHHHHHHHHHTC
T ss_pred             hhhhHHHHHHHHHCC
Confidence            799999999877764


No 9  
>3arc_T Photosystem II reaction center protein T; PSII, membrane-protein complex, transmembrane alpha-helix, E transport, photosynthesis; HET: OEX CLA PHO BCR PL9 SQD LMG UNL LMT HTG DGD LHG HEM; 1.90A {Thermosynechococcus vulcanus} PDB: 1s5l_T* 2axt_T* 3bz1_T* 3bz2_T* 3kzi_T* 3prq_T* 3prr_T* 3a0b_T* 3a0h_T*
Probab=7.41  E-value=4.8e+02  Score=16.47  Aligned_cols=6  Identities=50%  Similarity=1.132  Sum_probs=4.4

Q ss_pred             CCCChh
Q 028069          175 FKETPA  180 (214)
Q Consensus       175 Fretp~  180 (214)
                      |||+|.
T Consensus        23 FRePPr   28 (32)
T 3arc_T           23 FREPPR   28 (32)
T ss_dssp             TSCCCC
T ss_pred             hcCCCC
Confidence            777775


No 10 
>3owq_A LIN1025 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, unknown FUN; 2.61A {Listeria innocua} PDB: 3nro_A
Probab=6.53  E-value=1.1e+02  Score=26.64  Aligned_cols=15  Identities=7%  Similarity=-0.106  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHhhce
Q 028069          148 YLWAFGIVFALVACG  162 (214)
Q Consensus       148 ylwafGV~faliacg  162 (214)
                      ++|++|+++.++.|+
T Consensus        16 ~~~~~~~~~~~~~~~   30 (321)
T 3owq_A           16 FTKVMKIASVTLLGI   30 (321)
T ss_dssp             ---------------
T ss_pred             HHHHHHHHHHHHHHH
Confidence            467777766644444


Done!