Query         028089
Match_columns 214
No_of_seqs    17 out of 19
Neff          2.1 
Searched_HMMs 46136
Date          Fri Mar 29 06:04:07 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/028089.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/028089hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02326 YMF19:  Plant ATP synt  71.5     2.9 6.3E-05   31.6   1.9   26  137-162     1-26  (86)
  2 PHA00736 hypothetical protein   70.3     3.5 7.6E-05   31.8   2.1   20  145-164    54-73  (79)
  3 PF04971 Lysis_S:  Lysis protei  63.4     5.2 0.00011   30.2   1.8   26  132-163    26-51  (68)
  4 MTH00169 ATP8 ATP synthase F0   53.7      18 0.00039   26.5   3.2   23  137-159     2-24  (67)
  5 PF13572 DUF4134:  Domain of un  49.0     4.9 0.00011   31.4  -0.3   35  144-178    42-76  (98)
  6 PF11770 GAPT:  GRB2-binding ad  45.0      23  0.0005   30.5   3.0   36  154-189    18-80  (158)
  7 PF06645 SPC12:  Microsomal sig  44.8      22 0.00048   26.2   2.6   32  148-179    39-70  (76)
  8 PRK14749 hypothetical protein;  39.7      19 0.00041   23.7   1.4   13  148-160     4-16  (30)
  9 TIGR02106 cyd_oper_ybgT cyd op  38.7      20 0.00044   23.4   1.3   11  148-158     4-14  (30)
 10 PF08173 YbgT_YccB:  Membrane b  37.8      21 0.00046   22.9   1.3   11  148-158     4-14  (28)
 11 PF06679 DUF1180:  Protein of u  37.8     9.5 0.00021   32.3  -0.3   51  151-205   100-159 (163)
 12 PF12270 Cyt_c_ox_IV:  Cytochro  36.9      28 0.00061   29.0   2.3   28  145-172   107-134 (137)
 13 PF11373 DUF3175:  Protein of u  30.0      11 0.00024   29.7  -1.1   27  187-213     3-32  (86)
 14 PF10463 Peptidase_U49:  Peptid  28.2      42  0.0009   29.3   2.0   13  145-157     7-19  (206)
 15 PRK06569 F0F1 ATP synthase sub  25.9      61  0.0013   27.3   2.5   25  137-161     2-29  (155)
 16 COG3763 Uncharacterized protei  22.2      53  0.0011   25.1   1.3   17  148-164     4-20  (71)
 17 MTH00025 ATP8 ATP synthase F0   22.0 1.1E+02  0.0025   22.8   3.1   22  137-158     2-23  (70)
 18 PRK09697 protein secretion pro  20.2 2.2E+02  0.0047   24.1   4.7   53  130-186    16-78  (139)
 19 PF06783 UPF0239:  Uncharacteri  20.2 2.2E+02  0.0048   22.4   4.4   27  141-168    17-43  (85)
 20 COG5035 CDC50 Cell cycle contr  20.1 1.1E+02  0.0023   29.6   3.2   24  144-167    44-67  (372)

No 1  
>PF02326 YMF19:  Plant ATP synthase F0;  InterPro: IPR003319 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   F-ATPases (also known as F1F0-ATPase, or H(+)-transporting two-sector ATPase) (3.6.3.14 from EC) are composed of two linked complexes: the F1 ATPase complex is the catalytic core and is composed of 5 subunits (alpha, beta, gamma, delta, epsilon), while the F0 ATPase complex is the membrane-embedded proton channel that is composed of at least 3 subunits (A-C), nine in mitochondria (A-G, F6, F8). Both the F1 and F0 complexes are rotary motors that are coupled back-to-back. In the F1 complex, the central gamma subunit forms the rotor inside the cylinder made of the alpha(3)beta(3) subunits, while in the F0 complex, the ring-shaped C subunits forms the rotor. The two rotors rotate in opposite directions, but the F0 rotor is usually stronger, using the force from the proton gradient to push the F1 rotor in reverse in order to drive ATP synthesis []. These ATPases can also work in reverse to hydrolyse ATP to create a proton gradient. This entry represents subunit 8 (or ymf19) found in the F0 complex of mitochondrial F-ATPases from plants and algae. This subunit is sometimes found in association and N-terminal to IPR009455 from INTERPRO, in higher plants. Subunit 8 differs in sequence between plants, Metazoa (IPR001421 from INTERPRO) and fungi (IPR009230 from INTERPRO) [, ]. More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0015078 hydrogen ion transmembrane transporter activity, 0015986 ATP synthesis coupled proton transport, 0000276 mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)
Probab=71.54  E-value=2.9  Score=31.59  Aligned_cols=26  Identities=31%  Similarity=0.558  Sum_probs=22.1

Q ss_pred             CCcchhHHHHHHHHHHHHHHHHhhce
Q 028089          137 PQWGAFGFFLQYLWAFGIVFALVACG  162 (214)
Q Consensus       137 pQWd~lGffvqylwafGV~faliacg  162 (214)
                      ||-|.+=||-||.|.+.+++.+....
T Consensus         1 PQLD~~tf~sQ~fW~~i~f~~~y~~~   26 (86)
T PF02326_consen    1 PQLDIVTFFSQYFWLLIFFFFFYIFL   26 (86)
T ss_pred             CCCceeeHHHHHHHHHHHHHHHHHHH
Confidence            79999999999999999888865433


No 2  
>PHA00736 hypothetical protein
Probab=70.27  E-value=3.5  Score=31.79  Aligned_cols=20  Identities=30%  Similarity=0.768  Sum_probs=17.6

Q ss_pred             HHHHHHHHHHHHHHhhceeE
Q 028089          145 FLQYLWAFGIVFALVACGIA  164 (214)
Q Consensus       145 fvqylwafGV~faliacg~a  164 (214)
                      |+...|.++|.|+|||+.+.
T Consensus        54 flplfwgi~vifgliag~vl   73 (79)
T PHA00736         54 FLPLFWGITVIFGLIAGLVL   73 (79)
T ss_pred             HHHHHHHHHHHHHHHHHHhc
Confidence            77888999999999998764


No 3  
>PF04971 Lysis_S:  Lysis protein S ;  InterPro: IPR007054 The lysis S protein is a cytotoxic protein forming holes in membranes causing cell lysis. The action of Lysis S is independent of the proportion of acidic phospholipids in the membrane [].
Probab=63.45  E-value=5.2  Score=30.18  Aligned_cols=26  Identities=35%  Similarity=0.604  Sum_probs=20.0

Q ss_pred             CCCCCCCcchhHHHHHHHHHHHHHHHHhhcee
Q 028089          132 DFWEGPQWGAFGFFLQYLWAFGIVFALVACGI  163 (214)
Q Consensus       132 DFWEGpQWd~lGffvqylwafGV~faliacg~  163 (214)
                      |..-..||.++|++      .||+|+|+.|++
T Consensus        26 d~~sp~qW~aIGvi------~gi~~~~lt~lt   51 (68)
T PF04971_consen   26 DQFSPSQWAAIGVI------GGIFFGLLTYLT   51 (68)
T ss_pred             hccCcccchhHHHH------HHHHHHHHHHHh
Confidence            55677899999974      578888887765


No 4  
>MTH00169 ATP8 ATP synthase F0 subunit 8; Provisional
Probab=53.75  E-value=18  Score=26.54  Aligned_cols=23  Identities=35%  Similarity=0.808  Sum_probs=19.8

Q ss_pred             CCcchhHHHHHHHHHHHHHHHHh
Q 028089          137 PQWGAFGFFLQYLWAFGIVFALV  159 (214)
Q Consensus       137 pQWd~lGffvqylwafGV~fali  159 (214)
                      ||-|..-|+-||.|.+.+++.+.
T Consensus         2 PQLd~~~f~sQ~~Wl~i~f~~ly   24 (67)
T MTH00169          2 PQLDSVTYLTQYIWTLIILFFLF   24 (67)
T ss_pred             CCCchHHHHHHHHHHHHHHHHHH
Confidence            78899999999999988877763


No 5  
>PF13572 DUF4134:  Domain of unknown function (DUF4134)
Probab=49.02  E-value=4.9  Score=31.37  Aligned_cols=35  Identities=23%  Similarity=0.400  Sum_probs=30.6

Q ss_pred             HHHHHHHHHHHHHHHhhceeEEEeecCCccCCCCC
Q 028089          144 FFLQYLWAFGIVFALVACGIAVATYNEGATDFKET  178 (214)
Q Consensus       144 ffvqylwafGV~faliacg~a~~TYnegatdFret  178 (214)
                      .+..+++++|-+++||+.+=...-+|.|..|.++.
T Consensus        42 ~~~~l~yaI~aVvglIGai~VY~k~~~Gd~dv~k~   76 (98)
T PF13572_consen   42 PVTKLMYAIGAVVGLIGAIRVYIKWNNGDQDVKKS   76 (98)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhccCCCcHHHH
Confidence            36788999999999999999999999999887654


No 6  
>PF11770 GAPT:  GRB2-binding adapter (GAPT);  InterPro: IPR021082  This entry represents a family of transmembrane proteins which bind the growth factor receptor-bound protein 2 (GRB2) in B cells []. In contrast to other transmembrane adaptor proteins, GAPT, which this entry represents, is not phosphorylated upon BCR ligation. It associates with GRB2 constitutively through its proline-rich region []. 
Probab=44.96  E-value=23  Score=30.50  Aligned_cols=36  Identities=33%  Similarity=0.581  Sum_probs=24.9

Q ss_pred             HHHHHhhceeEEEee-cC-----------------CccCCCCCh---------hhhhhhhhcc
Q 028089          154 IVFALVACGIAVATY-NE-----------------GATDFKETP---------AYKESVQSRD  189 (214)
Q Consensus       154 V~faliacg~a~~TY-ne-----------------gatdFretp---------~~kesvqsqe  189 (214)
                      .+|-|+.||+.|+-| |-                 ..+|+.+|+         .+|.|||+|+
T Consensus        18 Ll~lLl~cgiGcvwhwkhr~~~~ftLPkflqRRssk~kDytkt~~~~~~~i~~r~k~svq~~d   80 (158)
T PF11770_consen   18 LLLLLLLCGIGCVWHWKHRDSTRFTLPKFLQRRSSKRKDYTKTPSLSPEVIGPRHKISVQTKD   80 (158)
T ss_pred             HHHHHHHHhcceEEEeeccCccccchHHHHHhhhhhccccccCcCCCcccccccccccccccc
Confidence            345567888888777 22                 346777777         6788888774


No 7  
>PF06645 SPC12:  Microsomal signal peptidase 12 kDa subunit (SPC12);  InterPro: IPR009542  This family consists of several microsomal signal peptidase 12 kDa subunit proteins. Translocation of polypeptide chains across the endoplasmic reticulum (ER) membrane is triggered by signal sequences. Subsequently, signal recognition particle interacts with its membrane receptor and the ribosome-bound nascent chain is targeted to the ER where it is transferred into a protein-conducting channel. At some point, a second signal sequence recognition event takes place in the membrane and translocation of the nascent chain through the membrane occurs. The signal sequence of most secretory and membrane proteins is cleaved off at this stage. Cleavage occurs by the signal peptidase complex (SPC) as soon as the lumenal domain of the translocating polypeptide is large enough to expose its cleavage site to the enzyme. The signal peptidase complex is possibly also involved in proteolytic events in the ER membrane other than the processing of the signal sequence, for example the further digestion of the cleaved signal peptide or the degradation of membrane proteins. Mammalian signal peptidase is as a complex of five different polypeptide chains. This family represents the 12 kDa subunit (SPC12).; GO: 0008233 peptidase activity, 0006465 signal peptide processing, 0005787 signal peptidase complex, 0016021 integral to membrane
Probab=44.79  E-value=22  Score=26.22  Aligned_cols=32  Identities=19%  Similarity=0.366  Sum_probs=21.4

Q ss_pred             HHHHHHHHHHHhhceeEEEeecCCccCCCCCh
Q 028089          148 YLWAFGIVFALVACGIAVATYNEGATDFKETP  179 (214)
Q Consensus       148 ylwafGV~faliacg~a~~TYnegatdFretp  179 (214)
                      |.+++|++++++.|+=.-.-||..+-.+.+..
T Consensus        39 ~~~~~g~~~~~lv~vP~Wp~y~r~p~~W~~~~   70 (76)
T PF06645_consen   39 YIYGAGVVLTLLVVVPPWPFYNRHPLKWLPPK   70 (76)
T ss_pred             HHHHHHHHHHHhheeCCcHhhcCCcccCCCCC
Confidence            55677777777777666677887766655443


No 8  
>PRK14749 hypothetical protein; Provisional
Probab=39.66  E-value=19  Score=23.69  Aligned_cols=13  Identities=31%  Similarity=0.667  Sum_probs=10.1

Q ss_pred             HHHHHHHHHHHhh
Q 028089          148 YLWAFGIVFALVA  160 (214)
Q Consensus       148 ylwafGV~falia  160 (214)
                      +.|++|+.+|...
T Consensus         4 faWiLG~~lAc~f   16 (30)
T PRK14749          4 LLWFVGILLMCSL   16 (30)
T ss_pred             HHHHHHHHHHHHH
Confidence            6899999988543


No 9  
>TIGR02106 cyd_oper_ybgT cyd operon protein YbgT. This model describes a very small (as short as 33 amino acids) protein of unknown function, essentially always found in an operon with CydAB, subunits of the cytochrome d terminal oxidase. It begins with an aromatic motif MWYFXW and appears to contain a membrane-spanning helix. This protein appears to be restricted to the Proteobacteria and exist in a single copy only. We suggest it may be a membrane subunit of the terminal oxidase. The family is named after the E. coli member YbgT. This model excludes the apparently related protein YccB.
Probab=38.69  E-value=20  Score=23.40  Aligned_cols=11  Identities=27%  Similarity=0.908  Sum_probs=9.5

Q ss_pred             HHHHHHHHHHH
Q 028089          148 YLWAFGIVFAL  158 (214)
Q Consensus       148 ylwafGV~fal  158 (214)
                      +.|++|+.+|+
T Consensus         4 faWilG~~lA~   14 (30)
T TIGR02106         4 FAWILGTLLAC   14 (30)
T ss_pred             HHHHHHHHHHH
Confidence            57999999985


No 10 
>PF08173 YbgT_YccB:  Membrane bound YbgT-like protein;  InterPro: IPR012994 This family contains a set of membrane proteins, typically 33 amino acids long. The family has no known function, but the protein is found in the operon CydAB in Escherichia coli. Members have a consensus motif (MWYFXW), which is rich in aromatic residues. The protein forms a single membrane-spanning helix. This family seems to be restricted to proteobacteria [].
Probab=37.80  E-value=21  Score=22.90  Aligned_cols=11  Identities=27%  Similarity=1.020  Sum_probs=9.4

Q ss_pred             HHHHHHHHHHH
Q 028089          148 YLWAFGIVFAL  158 (214)
Q Consensus       148 ylwafGV~fal  158 (214)
                      +.|++|+.+|+
T Consensus         4 faWilG~~lA~   14 (28)
T PF08173_consen    4 FAWILGVLLAC   14 (28)
T ss_pred             HHHHHHHHHHH
Confidence            57999999985


No 11 
>PF06679 DUF1180:  Protein of unknown function (DUF1180);  InterPro: IPR009565 This entry consists of several hypothetical eukaryotic proteins thought to be membrane proteins. Their function is unknown.
Probab=37.78  E-value=9.5  Score=32.26  Aligned_cols=51  Identities=22%  Similarity=0.248  Sum_probs=24.4

Q ss_pred             HHHHHHHH-hhceeEEEeecCCccCCCCChhhhhhhhh-----cc---ccCCCCCCCCCccCCC
Q 028089          151 AFGIVFAL-VACGIAVATYNEGATDFKETPAYKESVQS-----RD---LLEGPDASNSDVFESN  205 (214)
Q Consensus       151 afGV~fal-iacg~a~~TYnegatdFretp~~kesvqs-----qe---~~eepe~s~SdVFesN  205 (214)
                      +|+.+.++ |+|+ ++.+|-.+-   |+-..+||-|+.     +|   |.++.|..|+.|||.|
T Consensus       100 Vl~g~s~l~i~yf-vir~~R~r~---~~rktRkYgvl~~~~~~~Em~pL~~ddedeD~TvFd~~  159 (163)
T PF06679_consen  100 VLVGLSALAILYF-VIRTFRLRR---RNRKTRKYGVLTTRAENVEMAPLEEDDEDEDSTVFDAN  159 (163)
T ss_pred             HHHHHHHHHHHHH-HHHHHhhcc---ccccceeecccCCCcccceecccCCCccccccceeeec
Confidence            33333333 3444 345554443   223345665553     22   3333444555699976


No 12 
>PF12270 Cyt_c_ox_IV:  Cytochrome c oxidase subunit IV;  InterPro: IPR021050  This family of proteins is found in bacteria. Proteins in this family are approximately 140 amino acids in length. This family is the fourth subunit of the cytochrome c oxidase complex. This subunit does not have a catalytic capacity but instead, is required for assembly and/or stability of the complex []. ; GO: 0004129 cytochrome-c oxidase activity, 0055114 oxidation-reduction process, 0016021 integral to membrane
Probab=36.88  E-value=28  Score=28.97  Aligned_cols=28  Identities=32%  Similarity=0.333  Sum_probs=22.8

Q ss_pred             HHHHHHHHHHHHHHhhceeEEEeecCCc
Q 028089          145 FLQYLWAFGIVFALVACGIAVATYNEGA  172 (214)
Q Consensus       145 fvqylwafGV~faliacg~a~~TYnega  172 (214)
                      |..+|.++|+++.++++.-.+.-|..|.
T Consensus       107 ~g~Wl~~iG~~~~i~~~~G~vfEy~rg~  134 (137)
T PF12270_consen  107 FGWWLILIGAVLLIVAVVGWVFEYYRGP  134 (137)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhheeccCc
Confidence            5568888899999888888888888775


No 13 
>PF11373 DUF3175:  Protein of unknown function (DUF3175);  InterPro: IPR021513 This entry is represented by Ralstonia phage RSL1, Orf186. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.  This family of proteins with unknown function appears to be restricted to Proteobacteria. 
Probab=30.00  E-value=11  Score=29.71  Aligned_cols=27  Identities=37%  Similarity=0.604  Sum_probs=21.9

Q ss_pred             hccccCCCCC--CCCCccC-CCCcccCCCC
Q 028089          187 SRDLLEGPDA--SNSDVFE-SNPTEVAPSL  213 (214)
Q Consensus       187 sqe~~eepe~--s~SdVFe-sNPTEvAPsL  213 (214)
                      ||++-+.+++  -+.+||. ++|.++|-||
T Consensus         3 S~~Vt~~Sdaldle~~vF~~~dp~~IA~SL   32 (86)
T PF11373_consen    3 SQKVTEHSDALDLEPGVFKSDDPKKIAASL   32 (86)
T ss_pred             ccccCccCCcCCCCccccCCCCHHHHHHHH
Confidence            6778888887  5569999 7899998776


No 14 
>PF10463 Peptidase_U49:  Peptidase U49;  InterPro: IPR019504 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.   The peptidases families associated with clan U- have an unknown catalytic mechanism as the protein fold of the active site domain and the active site residues have not been reported.  This entry contains peptidases belonging to MEROPS peptidase family U49 (Lit peptidase, clan U-). The Lit peptidase from Escherichia coli functions in bacterial cell death in response to infection by Enterobacteria phage T4. Following binding of Gol peptide to domains II and III of elongation factor Tu, the Lit peptidase cleaves domain I of the elongation factor. This prevents binding of guanine nucleotides, shuts down translation and leads to cell death. 
Probab=28.17  E-value=42  Score=29.28  Aligned_cols=13  Identities=54%  Similarity=1.196  Sum_probs=11.0

Q ss_pred             HHHHHHHHHHHHH
Q 028089          145 FLQYLWAFGIVFA  157 (214)
Q Consensus       145 fvqylwafGV~fa  157 (214)
                      ++||||+||..+=
T Consensus         7 ~L~~lW~f~~~~~   19 (206)
T PF10463_consen    7 FLEYLWIFGFAAW   19 (206)
T ss_pred             HHHHHHHHHHHHH
Confidence            7899999998764


No 15 
>PRK06569 F0F1 ATP synthase subunit B'; Validated
Probab=25.90  E-value=61  Score=27.25  Aligned_cols=25  Identities=28%  Similarity=0.794  Sum_probs=17.5

Q ss_pred             CCcchhHHHHHHHH---HHHHHHHHhhc
Q 028089          137 PQWGAFGFFLQYLW---AFGIVFALVAC  161 (214)
Q Consensus       137 pQWd~lGffvqylw---afGV~faliac  161 (214)
                      ||-|..-|+.|++|   .|+|++.|+..
T Consensus         2 PQfd~~~~~sqifw~iI~FlILy~ll~k   29 (155)
T PRK06569          2 PQFDIATYYSQIFWLIVTFGLLYIFVYK   29 (155)
T ss_pred             CCCchhhhhHHHHHHHHHHHHHHHHHHH
Confidence            78888888889888   45555555444


No 16 
>COG3763 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.18  E-value=53  Score=25.15  Aligned_cols=17  Identities=41%  Similarity=0.382  Sum_probs=11.4

Q ss_pred             HHHHHHHHHHHhhceeE
Q 028089          148 YLWAFGIVFALVACGIA  164 (214)
Q Consensus       148 ylwafGV~faliacg~a  164 (214)
                      +||+++|+++|+++.+.
T Consensus         4 ~lail~ivl~ll~G~~~   20 (71)
T COG3763           4 WLAILLIVLALLAGLIG   20 (71)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            46777777777665543


No 17 
>MTH00025 ATP8 ATP synthase F0 subunit 8; Validated
Probab=22.00  E-value=1.1e+02  Score=22.83  Aligned_cols=22  Identities=32%  Similarity=0.729  Sum_probs=18.2

Q ss_pred             CCcchhHHHHHHHHHHHHHHHH
Q 028089          137 PQWGAFGFFLQYLWAFGIVFAL  158 (214)
Q Consensus       137 pQWd~lGffvqylwafGV~fal  158 (214)
                      ||=|..=|.-||.|.+-+++.+
T Consensus         2 PQLd~~~f~nQi~W~~i~f~il   23 (70)
T MTH00025          2 PQLDTTTYLTQYRWTLIVLFLL   23 (70)
T ss_pred             CCcchhHhHHHHHHHHHHHHHH
Confidence            6788888999999988777665


No 18 
>PRK09697 protein secretion protein GspB; Provisional
Probab=20.17  E-value=2.2e+02  Score=24.11  Aligned_cols=53  Identities=26%  Similarity=0.380  Sum_probs=33.8

Q ss_pred             CCCCCCCCCcchhHHHHHHHHHHHHHHHHhhceeEEEee----------cCCccCCCCChhhhhhhh
Q 028089          130 EPDFWEGPQWGAFGFFLQYLWAFGIVFALVACGIAVATY----------NEGATDFKETPAYKESVQ  186 (214)
Q Consensus       130 ePDFWEGpQWd~lGffvqylwafGV~faliacg~a~~TY----------negatdFretp~~kesvq  186 (214)
                      +|..|..-.=..+||.+|++-+. ..|   |+.+.+.-|          .+..+.--++|+||.+.|
T Consensus        16 ~~~~~~~~~~~TI~~Vi~L~~~~-L~~---AG~~~~GGYA~Qlwvlw~~k~~~T~~~~tP~~~Qs~q   78 (139)
T PRK09697         16 HPGIFSRQKHSTIIYVICLLLIC-LWF---AGMVLVGGYARQLWVLWIVKAEVTVEAETPAFKQSTQ   78 (139)
T ss_pred             CcchhhhhhccchHHHHHHHHHH-HHH---hcceeechhHHHHHHHHHHhhhheecCCCcchhhhhh
Confidence            46678777788999999975221 111   112222222          456677889999999866


No 19 
>PF06783 UPF0239:  Uncharacterised protein family (UPF0239);  InterPro: IPR009621 This is a group of transmembrane proteins of unknown function.; GO: 0016021 integral to membrane
Probab=20.16  E-value=2.2e+02  Score=22.38  Aligned_cols=27  Identities=30%  Similarity=0.515  Sum_probs=20.2

Q ss_pred             hhHHHHHHHHHHHHHHHHhhceeEEEee
Q 028089          141 AFGFFLQYLWAFGIVFALVACGIAVATY  168 (214)
Q Consensus       141 ~lGffvqylwafGV~faliacg~a~~TY  168 (214)
                      ++.-++.|---+|-+|=|| |+.||+.+
T Consensus        17 ~~e~llRYGLf~GAIFQli-CilAiI~~   43 (85)
T PF06783_consen   17 FFENLLRYGLFVGAIFQLI-CILAIILP   43 (85)
T ss_pred             HHHHHHHHHHHHHHHHHHH-HHHheeee
Confidence            4567899988999988865 66666655


No 20 
>COG5035 CDC50 Cell cycle control protein [Cell division and chromosome partitioning / Transcription / Signal transduction mechanisms]
Probab=20.14  E-value=1.1e+02  Score=29.56  Aligned_cols=24  Identities=42%  Similarity=0.639  Sum_probs=19.9

Q ss_pred             HHHHHHHHHHHHHHHhhceeEEEe
Q 028089          144 FFLQYLWAFGIVFALVACGIAVAT  167 (214)
Q Consensus       144 ffvqylwafGV~faliacg~a~~T  167 (214)
                      -++.++.++|++|+.++.|+.+++
T Consensus        44 ~vLpL~flig~vf~plG~gl~~~~   67 (372)
T COG5035          44 TVLPLLFLIGIVFAPLGGGLLVAS   67 (372)
T ss_pred             HHHHHHHHHHHHHhhccceEEEEe
Confidence            367888999999999998887654


Done!