Query         028109
Match_columns 213
No_of_seqs    142 out of 187
Neff          4.1 
Searched_HMMs 46136
Date          Fri Mar 29 06:22:55 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/028109.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/028109hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF04640 PLATZ:  PLATZ transcri 100.0   2E-39 4.3E-44  240.0   5.7   71   66-136     1-71  (72)
  2 PF00643 zf-B_box:  B-box zinc   96.7  0.0006 1.3E-08   44.1   0.7   37   25-65      5-42  (42)
  3 cd00021 BBOX B-Box-type zinc f  95.4   0.011 2.4E-07   37.0   1.9   36   25-64      2-38  (39)
  4 smart00336 BBOX B-Box-type zin  94.4   0.034 7.4E-07   35.2   2.3   35   25-63      5-40  (42)
  5 PRK01343 zinc-binding protein;  84.2    0.45 9.8E-06   34.3   0.8   26  114-139     9-35  (57)
  6 COG3024 Uncharacterized protei  83.1    0.65 1.4E-05   34.4   1.3   27  114-140     7-38  (65)
  7 PF12855 Ecl1:  Life-span regul  81.9    0.33 7.1E-06   33.0  -0.6   24  114-137     6-32  (43)
  8 PF03884 DUF329:  Domain of unk  80.3    0.29 6.3E-06   35.2  -1.4   25  114-138     2-31  (57)
  9 PRK00418 DNA gyrase inhibitor;  80.1    0.71 1.5E-05   33.8   0.6   26  114-139     6-36  (62)
 10 PF10013 DUF2256:  Uncharacteri  77.6    0.74 1.6E-05   31.5   0.0   23  114-136     8-39  (42)
 11 PF09889 DUF2116:  Uncharacteri  70.8     1.3 2.7E-05   32.1  -0.2   22  115-136     4-25  (59)
 12 KOG4367 Predicted Zn-finger pr  66.0     2.1 4.6E-05   42.4   0.2   36   23-62    223-260 (699)
 13 PF13240 zinc_ribbon_2:  zinc-r  64.9       3 6.5E-05   24.6   0.7   16  117-132     2-17  (23)
 14 PF02207 zf-UBR:  Putative zinc  64.2     3.3 7.2E-05   29.9   0.9   34   35-68     10-48  (71)
 15 COG4338 Uncharacterized protei  60.2    0.72 1.6E-05   32.7  -3.0   24  113-136    11-43  (54)
 16 PF06467 zf-FCS:  MYM-type Zinc  55.5     2.8 6.2E-05   26.8  -0.6   24  113-136     5-40  (43)
 17 cd02340 ZZ_NBR1_like Zinc fing  53.7     7.9 0.00017   25.8   1.3   27   39-65     15-43  (43)
 18 PF13248 zf-ribbon_3:  zinc-rib  52.5     7.2 0.00016   23.3   0.9   18  115-132     3-20  (26)
 19 KOG2177 Predicted E3 ubiquitin  45.8      10 0.00023   30.6   1.1   39   25-68     88-128 (386)
 20 PF01412 ArfGap:  Putative GTPa  41.4     8.5 0.00018   30.2  -0.1   52   35-86     10-73  (116)
 21 COG4068 Uncharacterized protei  39.8       9  0.0002   28.2  -0.2   23  114-136     8-30  (64)
 22 PF04438 zf-HIT:  HIT zinc fing  37.8     9.3  0.0002   23.9  -0.3   21  116-136     4-29  (30)
 23 cd02341 ZZ_ZZZ3 Zinc finger, Z  36.2      22 0.00047   24.4   1.3   27   39-65     16-48  (48)
 24 smart00396 ZnF_UBR1 Putative z  30.5      51  0.0011   24.0   2.5   29   33-61      8-41  (71)
 25 PF04570 DUF581:  Protein of un  28.1      18 0.00038   26.1  -0.2   24  113-136    15-47  (58)
 26 smart00105 ArfGap Putative GTP  25.7      20 0.00044   27.9  -0.3   43   37-80      2-57  (112)
 27 TIGR00412 redox_disulf_2 small  24.4 1.2E+02  0.0025   21.6   3.5   32   73-105    33-66  (76)
 28 KOG4582 Uncharacterized conser  24.3      70  0.0015   29.1   2.8   56    9-67    132-199 (278)
 29 PF06156 DUF972:  Protein of un  22.6      53  0.0011   26.1   1.5   30   13-43     77-107 (107)
 30 smart00746 TRASH metallochaper  22.5      49  0.0011   18.2   1.0   10  127-136    23-32  (39)
 31 cd02337 ZZ_CBP Zinc finger, ZZ  21.4      31 0.00068   22.8   0.0   29   37-65     12-41  (41)
 32 PF12773 DZR:  Double zinc ribb  20.9      43 0.00093   22.0   0.6   12  114-125    12-23  (50)
 33 cd02344 ZZ_HERC2 Zinc finger,   20.3      60  0.0013   22.1   1.2   27   38-64     15-44  (45)

No 1  
>PF04640 PLATZ:  PLATZ transcription factor;  InterPro: IPR006734 This family includes a conserved region in several uncharacterised plant proteins.
Probab=100.00  E-value=2e-39  Score=239.97  Aligned_cols=71  Identities=73%  Similarity=1.226  Sum_probs=70.3

Q ss_pred             EeccccceeeechhhhhhcccceeeEEEcCeEEEEeeCCCCCCCCCCCCCcccccccccCCCCeeeecccc
Q 028109           66 RRSSYHDVIRVSEIQKVLDISGVQTYVINSARVVFLNERPQPRPGKGVTNTCEVCDRSLLDSFRFCSLGCK  136 (213)
Q Consensus        66 RRssY~dVVRv~dIqkl~D~S~IQtYvINsakVVFLn~RPq~r~~kg~~~~C~~C~R~L~d~~rFCSL~CK  136 (213)
                      |||||||||||+|||||||||+||||+||+++|||||+|||++++++.++.|++|+|+|+|+|+||||+||
T Consensus         1 Rr~sY~dVVrv~di~kl~D~s~IQtY~iNs~kVVfLn~Rpq~~~~~~~~~~C~~C~R~L~d~~~fCSl~CK   71 (72)
T PF04640_consen    1 RRYSYHDVVRVSDIQKLLDCSGIQTYVINSAKVVFLNPRPQSRPSKGSGNICETCHRSLQDPYRFCSLSCK   71 (72)
T ss_pred             CcccccceEEHHHhHhhccccccEEEEeCCceEEEEccCCcCCCCCCCCCccCCCCCCCCCCCeEEeeeEE
Confidence            79999999999999999999999999999999999999999999999999999999999999999999999


No 2  
>PF00643 zf-B_box:  B-box zinc finger;  InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents B-box-type zinc finger domains, which are around 40 residues in length. B-box zinc fingers can be divided into two groups, where types 1 and 2 B-box domains differ in their consensus sequence and in the spacing of the 7-8 zinc-binding residues. Several proteins contain both types 1 and 2 B-boxes, suggesting some level of cooperativity between these two domains. B-box domains are found in over 1500 proteins from a variety of organisms. They are found in TRIM (tripartite motif) proteins that consist of an N-terminal RING finger (originally called an A-box), followed by 1-2 B-box domains and a coiled-coil domain (also called RBCC for Ring, B-box, Coiled-Coil). TRIM proteins contain a type 2 B-box domain, and may also contain a type 1 B-box. In proteins that do not contain RING or coiled-coil domains, the B-box domain is primarily type 2. Many type 2 B-box proteins are involved in ubiquitinylation. Proteins containing a B-box zinc finger domain include transcription factors, ribonucleoproteins and proto-oncoproteins; for example, MID1, MID2, TRIM9, TNL, TRIM36, TRIM63, TRIFIC, NCL1 and CONSTANS-like proteins []. The microtubule-associated E3 ligase MID1 (6.3.2 from EC) contains a type 1 B-box zinc finger domain. MID1 specifically binds Alpha-4, which in turn recruits the catalytic subunit of phosphatase 2A (PP2Ac). This complex is required for targeting of PP2Ac for proteasome-mediated degradation. The MID1 B-box coordinates two zinc ions and adopts a beta/beta/alpha cross-brace structure similar to that of ZZ, PHD, RING and FYVE zinc fingers [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 3DDT_B 2D8U_A 3Q1D_A 2EGM_A 2YVR_B 2DJA_A 2DQ5_A 2JUN_A 2YRG_A 2DID_A ....
Probab=96.69  E-value=0.0006  Score=44.14  Aligned_cols=37  Identities=35%  Similarity=0.859  Sum_probs=29.8

Q ss_pred             cCCCCCCCCCCCcceecccCCCCcCCccccc-ccCCCceeEE
Q 028109           25 QCKLHPDSHKSECNMYCLDCMNGAFCSLCLD-YHKDHRAIQI   65 (213)
Q Consensus        25 ~C~~H~~~~knE~N~FCldC~~~~lC~~Cl~-~H~~Hr~lQI   65 (213)
                      .|..|..   .+.++||.+|. ..+|..|.. .|++|.++.|
T Consensus         5 ~C~~H~~---~~~~~~C~~C~-~~~C~~C~~~~H~~H~~~~i   42 (42)
T PF00643_consen    5 KCPEHPE---EPLSLFCEDCN-EPLCSECTVSGHKGHKIVPI   42 (42)
T ss_dssp             B-SSTTT---SBEEEEETTTT-EEEEHHHHHTSTTTSEEEEC
T ss_pred             cCccCCc---cceEEEecCCC-CccCccCCCCCCCCCEEeEC
Confidence            5888875   34899999998 899999977 4999987754


No 3  
>cd00021 BBOX B-Box-type zinc finger; zinc binding domain (CHC3H2); often present in combination with other motifs, like RING zinc finger, NHL motif, coiled-coil or RFP domain in functionally unrelated proteins, most likely mediating protein-protein interaction.
Probab=95.37  E-value=0.011  Score=37.00  Aligned_cols=36  Identities=22%  Similarity=0.509  Sum_probs=28.0

Q ss_pred             cCCCCCCCCCCCcceecccCCCCcCCccccc-ccCCCceeE
Q 028109           25 QCKLHPDSHKSECNMYCLDCMNGAFCSLCLD-YHKDHRAIQ   64 (213)
Q Consensus        25 ~C~~H~~~~knE~N~FCldC~~~~lC~~Cl~-~H~~Hr~lQ   64 (213)
                      .|..|..   +...+||.+|. ..+|..|.. .|++|.++-
T Consensus         2 ~C~~H~~---~~~~~fC~~~~-~~iC~~C~~~~H~~H~~~~   38 (39)
T cd00021           2 LCDEHGE---EPLSLFCETDR-ALLCVDCDLSVHSGHRRVP   38 (39)
T ss_pred             CCCccCC---cceEEEeCccC-hhhhhhcChhhcCCCCEee
Confidence            4778853   24689999998 899999965 688887654


No 4  
>smart00336 BBOX B-Box-type zinc finger.
Probab=94.40  E-value=0.034  Score=35.20  Aligned_cols=35  Identities=26%  Similarity=0.803  Sum_probs=27.8

Q ss_pred             cCCCCCCCCCCCcceecccCCCCcCCccccc-ccCCCcee
Q 028109           25 QCKLHPDSHKSECNMYCLDCMNGAFCSLCLD-YHKDHRAI   63 (213)
Q Consensus        25 ~C~~H~~~~knE~N~FCldC~~~~lC~~Cl~-~H~~Hr~l   63 (213)
                      .|..|..   ....+||.+|. ..+|..|.. .|++|.++
T Consensus         5 ~C~~h~~---~~~~~~C~~c~-~~iC~~C~~~~H~~H~~~   40 (42)
T smart00336        5 KCDSHGD---EPAEFFCEECG-ALLCRTCDEAEHRGHTVV   40 (42)
T ss_pred             cCCCCCC---CceEEECCCCC-cccccccChhhcCCCcee
Confidence            4778864   24689999998 899999976 58888765


No 5  
>PRK01343 zinc-binding protein; Provisional
Probab=84.16  E-value=0.45  Score=34.29  Aligned_cols=26  Identities=27%  Similarity=0.708  Sum_probs=20.5

Q ss_pred             CCcccccccccCCCC-eeeeccccccc
Q 028109          114 TNTCEVCDRSLLDSF-RFCSLGCKNFQ  139 (213)
Q Consensus       114 ~~~C~~C~R~L~d~~-rFCSL~CK~~~  139 (213)
                      ...|-+|++.....+ -|||-.|+...
T Consensus         9 ~~~CP~C~k~~~~~~rPFCS~RC~~iD   35 (57)
T PRK01343          9 TRPCPECGKPSTREAYPFCSERCRDID   35 (57)
T ss_pred             CCcCCCCCCcCcCCCCcccCHHHhhhh
Confidence            456999999887655 59999999443


No 6  
>COG3024 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=83.08  E-value=0.65  Score=34.39  Aligned_cols=27  Identities=37%  Similarity=0.811  Sum_probs=20.8

Q ss_pred             CCcccccccccCC----CCe-eeeccccccch
Q 028109          114 TNTCEVCDRSLLD----SFR-FCSLGCKNFQK  140 (213)
Q Consensus       114 ~~~C~~C~R~L~d----~~r-FCSL~CK~~~~  140 (213)
                      +-.|-+|++...-    +|| |||-.||.+..
T Consensus         7 ~v~CP~Cgkpv~w~~~s~frPFCSkRCklIDL   38 (65)
T COG3024           7 TVPCPTCGKPVVWGEESPFRPFCSKRCKLIDL   38 (65)
T ss_pred             cccCCCCCCcccccccCCcCcchhHhhhhcch
Confidence            3459999998864    666 99999995543


No 7  
>PF12855 Ecl1:  Life-span regulatory factor;  InterPro: IPR024368  The fungal proteins in this entry are involved in the regulation of chronological life-span [, ]. Overexpression of these proteins has been shown to extend the chronological life-span of wild-type strains. The mechanism by which this happens is not known, but microarray data suggests that they may function as pleiptropic stress regulators.
Probab=81.92  E-value=0.33  Score=33.04  Aligned_cols=24  Identities=33%  Similarity=0.797  Sum_probs=21.1

Q ss_pred             CCccccccccc---CCCCeeeeccccc
Q 028109          114 TNTCEVCDRSL---LDSFRFCSLGCKN  137 (213)
Q Consensus       114 ~~~C~~C~R~L---~d~~rFCSL~CK~  137 (213)
                      .+.|.+|+|-+   .+...|||-.|+.
T Consensus         6 ~~yC~~Cdk~~~~~~~~~lYCSe~Cr~   32 (43)
T PF12855_consen    6 NDYCIVCDKQIDPPDDGSLYCSEECRL   32 (43)
T ss_pred             hhHHHHhhccccCCCCCccccCHHHHh
Confidence            46799999999   6789999999993


No 8  
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=80.30  E-value=0.29  Score=35.17  Aligned_cols=25  Identities=40%  Similarity=0.862  Sum_probs=15.2

Q ss_pred             CCcccccccccCC----CCe-eeecccccc
Q 028109          114 TNTCEVCDRSLLD----SFR-FCSLGCKNF  138 (213)
Q Consensus       114 ~~~C~~C~R~L~d----~~r-FCSL~CK~~  138 (213)
                      +..|-+|++...-    +|+ |||-.||.+
T Consensus         2 ~v~CP~C~k~~~~~~~n~~rPFCS~RCk~i   31 (57)
T PF03884_consen    2 TVKCPICGKPVEWSPENPFRPFCSERCKLI   31 (57)
T ss_dssp             EEE-TTT--EEE-SSSSS--SSSSHHHHHH
T ss_pred             cccCCCCCCeecccCCCCcCCcccHhhccc
Confidence            3469999998875    676 999999933


No 9  
>PRK00418 DNA gyrase inhibitor; Reviewed
Probab=80.06  E-value=0.71  Score=33.81  Aligned_cols=26  Identities=35%  Similarity=0.811  Sum_probs=19.9

Q ss_pred             CCcccccccccC---C-CCe-eeeccccccc
Q 028109          114 TNTCEVCDRSLL---D-SFR-FCSLGCKNFQ  139 (213)
Q Consensus       114 ~~~C~~C~R~L~---d-~~r-FCSL~CK~~~  139 (213)
                      .-.|-+|++.+.   + +|+ |||-.||.+.
T Consensus         6 ~v~CP~C~k~~~w~~~~~~rPFCS~RCk~ID   36 (62)
T PRK00418          6 TVNCPTCGKPVEWGEISPFRPFCSKRCQLID   36 (62)
T ss_pred             cccCCCCCCcccccCCCCcCCcccHHHHhhh
Confidence            457999999874   3 565 9999999443


No 10 
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=77.56  E-value=0.74  Score=31.45  Aligned_cols=23  Identities=35%  Similarity=1.002  Sum_probs=19.7

Q ss_pred             CCcccccccccC---------CCCeeeecccc
Q 028109          114 TNTCEVCDRSLL---------DSFRFCSLGCK  136 (213)
Q Consensus       114 ~~~C~~C~R~L~---------d~~rFCSL~CK  136 (213)
                      ..+|.+|+|...         |..+|||-.|.
T Consensus         8 ~K~C~~C~rpf~WRKKW~~~Wd~VkYCS~rCR   39 (42)
T PF10013_consen    8 SKICPVCGRPFTWRKKWARCWDEVKYCSDRCR   39 (42)
T ss_pred             CCcCcccCCcchHHHHHHHhchhhccHHHHhc
Confidence            457999999996         57899999996


No 11 
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=70.81  E-value=1.3  Score=32.08  Aligned_cols=22  Identities=32%  Similarity=0.868  Sum_probs=20.6

Q ss_pred             CcccccccccCCCCeeeecccc
Q 028109          115 NTCEVCDRSLLDSFRFCSLGCK  136 (213)
Q Consensus       115 ~~C~~C~R~L~d~~rFCSL~CK  136 (213)
                      ..|..||..+..+-.|||-.|+
T Consensus         4 kHC~~CG~~Ip~~~~fCS~~C~   25 (59)
T PF09889_consen    4 KHCPVCGKPIPPDESFCSPKCR   25 (59)
T ss_pred             CcCCcCCCcCCcchhhhCHHHH
Confidence            4799999999999999999999


No 12 
>KOG4367 consensus Predicted Zn-finger protein [Function unknown]
Probab=65.97  E-value=2.1  Score=42.39  Aligned_cols=36  Identities=31%  Similarity=0.738  Sum_probs=29.2

Q ss_pred             cccCCCCCCCCCCCcceecccCCCCcCCccccc--ccCCCce
Q 028109           23 FVQCKLHPDSHKSECNMYCLDCMNGAFCSLCLD--YHKDHRA   62 (213)
Q Consensus        23 F~~C~~H~~~~knE~N~FCldC~~~~lC~~Cl~--~H~~Hr~   62 (213)
                      -..|..|....   ..|||+.|. .++|..||.  .|..|.|
T Consensus       223 ~~~ct~h~~e~---~smyc~~ck-~pvc~~clee~khs~hev  260 (699)
T KOG4367|consen  223 VSTCTDHELEN---HSMYCVQCK-MPVCYQCLEEGKHSSHEV  260 (699)
T ss_pred             hhhccCCCCCC---ceEEEEecC-ChHHHHHHHhhcccchhh
Confidence            45799998743   679999998 899999998  6777763


No 13 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=64.90  E-value=3  Score=24.60  Aligned_cols=16  Identities=31%  Similarity=0.926  Sum_probs=14.3

Q ss_pred             ccccccccCCCCeeee
Q 028109          117 CEVCDRSLLDSFRFCS  132 (213)
Q Consensus       117 C~~C~R~L~d~~rFCS  132 (213)
                      |..|+..|.|...||+
T Consensus         2 Cp~CG~~~~~~~~fC~   17 (23)
T PF13240_consen    2 CPNCGAEIEDDAKFCP   17 (23)
T ss_pred             CcccCCCCCCcCcchh
Confidence            8889999999889986


No 14 
>PF02207 zf-UBR:  Putative zinc finger in N-recognin (UBR box);  InterPro: IPR003126 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The N-end rule-based degradation signal, which targets a protein for ubiquitin-dependent proteolysis, comprises a destabilising amino-terminal residue and a specific internal lysine residue. This entry describes a putative zinc finger in N-recognin, a recognition component of the N-end rule pathway []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0004842 ubiquitin-protein ligase activity, 0008270 zinc ion binding; PDB: 3NY1_B 3NIS_F 3NIM_A 3NIK_A 3NII_A 3NIH_A 3NIL_D 3NIN_B 3NIJ_A 3NIT_A ....
Probab=64.18  E-value=3.3  Score=29.94  Aligned_cols=34  Identities=29%  Similarity=0.655  Sum_probs=24.1

Q ss_pred             CCcceecccCCC---CcCCccc-cc-ccCCCceeEEEec
Q 028109           35 SECNMYCLDCMN---GAFCSLC-LD-YHKDHRAIQIRRS   68 (213)
Q Consensus        35 nE~N~FCldC~~---~~lC~~C-l~-~H~~Hr~lQIRRs   68 (213)
                      ++--..|++|..   .++|..| .. .|.+|+++.++-.
T Consensus        10 ~q~~y~C~tC~~~~~~~iC~~CF~~~~H~gH~~~~~~~~   48 (71)
T PF02207_consen   10 GQIFYRCLTCSLDESSGICEECFANSCHEGHRVVYYRSS   48 (71)
T ss_dssp             T-EEEEETTTBSSTT-BBEHHHHCTSGGGGSSEEEEE--
T ss_pred             CCEEEECccCCCCCCEEEchhhCCCCCcCCCcEEEEEeC
Confidence            366678999974   5799999 44 8999998877655


No 15 
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=60.24  E-value=0.72  Score=32.74  Aligned_cols=24  Identities=33%  Similarity=0.931  Sum_probs=20.9

Q ss_pred             CCCcccccccccC---------CCCeeeecccc
Q 028109          113 VTNTCEVCDRSLL---------DSFRFCSLGCK  136 (213)
Q Consensus       113 ~~~~C~~C~R~L~---------d~~rFCSL~CK  136 (213)
                      ...+|++|+|.+.         |...|||-.|+
T Consensus        11 p~KICpvCqRPFsWRkKW~~cWDeVKyCSeRCr   43 (54)
T COG4338          11 PDKICPVCQRPFSWRKKWARCWDEVKYCSERCR   43 (54)
T ss_pred             chhhhhhhcCchHHHHHHHHHHHHHHHHHHHHH
Confidence            4678999999985         57899999999


No 16 
>PF06467 zf-FCS:  MYM-type Zinc finger with FCS sequence motif;  InterPro: IPR010507 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  MYM-type zinc fingers were identified in MYM family proteins []. Human protein Q14202 from SWISSPROT is involved in a chromosomal translocation and may be responsible for X-linked retardation in XQ13.1 []. Q9UBW7 from SWISSPROT is also involved in disease. In myeloproliferative disorders it is fused to FGF receptor 1 []; in atypical myeloproliferative disorders it is rearranged []. Members of the family generally are involved in development. This Zn-finger domain functions as a transcriptional trans-activator of late vaccinia viral genes, and orthologues are also found in all nucleocytoplasmic large DNA viruses, NCLDV. This domain is also found fused to the C termini of recombinases from certain prokaryotic transposons []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2L8E_A 2DAS_A.
Probab=55.49  E-value=2.8  Score=26.83  Aligned_cols=24  Identities=29%  Similarity=0.758  Sum_probs=15.2

Q ss_pred             CCCcccccccccCC-C-----------Ceeeecccc
Q 028109          113 VTNTCEVCDRSLLD-S-----------FRFCSLGCK  136 (213)
Q Consensus       113 ~~~~C~~C~R~L~d-~-----------~rFCSL~CK  136 (213)
                      ....|..|++.+.. +           ..|||..|-
T Consensus         5 ~~~~C~~C~~~~~~~~~~~~~~~~g~~~~FCS~~C~   40 (43)
T PF06467_consen    5 KMKTCSYCKKYIPNKPTMIEVQYDGKMKQFCSQSCL   40 (43)
T ss_dssp             SCEE-TTT--EEECCC----EE-TTTTSCCSSHHHH
T ss_pred             cCCcCcccCCcccCCCccccccccCcccChhCHHHH
Confidence            46789999987743 2           379999985


No 17 
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger present in Drosophila ref(2)P, NBR1, Human sequestosome 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Drosophila ref(2)P appears to control the multiplication of sigma rhabdovirus. NBR1 (Next to BRCA1 gene 1 protein) interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB), and may function in cell signalling pathways. Sequestosome 1 is a phosphotyrosine independent ligand for the Lck SH2 domain and binds noncovalently to ubiquitin via its UBA domain.
Probab=53.70  E-value=7.9  Score=25.82  Aligned_cols=27  Identities=30%  Similarity=0.707  Sum_probs=20.4

Q ss_pred             eecccCCCCcCCccccc--ccCCCceeEE
Q 028109           39 MYCLDCMNGAFCSLCLD--YHKDHRAIQI   65 (213)
Q Consensus        39 ~FCldC~~~~lC~~Cl~--~H~~Hr~lQI   65 (213)
                      .-|+.|.+--||..|..  .|..|..++|
T Consensus        15 y~C~~C~d~dLC~~C~~~~~H~~H~f~~~   43 (43)
T cd02340          15 YKCLVCPDYDLCESCEAKGVHPEHAMLKI   43 (43)
T ss_pred             EECCCCCCccchHHhhCcCCCCCCCEEeC
Confidence            56888887889999955  5777776653


No 18 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=52.55  E-value=7.2  Score=23.26  Aligned_cols=18  Identities=22%  Similarity=0.621  Sum_probs=15.4

Q ss_pred             CcccccccccCCCCeeee
Q 028109          115 NTCEVCDRSLLDSFRFCS  132 (213)
Q Consensus       115 ~~C~~C~R~L~d~~rFCS  132 (213)
                      ..|..|+..+.+..+||+
T Consensus         3 ~~Cp~Cg~~~~~~~~fC~   20 (26)
T PF13248_consen    3 MFCPNCGAEIDPDAKFCP   20 (26)
T ss_pred             CCCcccCCcCCcccccCh
Confidence            468999998888899996


No 19 
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=45.76  E-value=10  Score=30.63  Aligned_cols=39  Identities=21%  Similarity=0.618  Sum_probs=30.1

Q ss_pred             cCCCCCCCCCCCcceecccCCCCcCCcccc-c-ccCCCceeEEEec
Q 028109           25 QCKLHPDSHKSECNMYCLDCMNGAFCSLCL-D-YHKDHRAIQIRRS   68 (213)
Q Consensus        25 ~C~~H~~~~knE~N~FCldC~~~~lC~~Cl-~-~H~~Hr~lQIRRs   68 (213)
                      .|..|...    ..+||..|. ..+|..|. . .|.+|.++.+...
T Consensus        88 ~c~~~~~~----~~~~c~~~~-~~~c~~c~~~~~h~~h~~~~~~~~  128 (386)
T KOG2177|consen   88 LCEKHGEE----LKLFCEEDE-KLLCVLCRESGEHRGHPVLPLEEA  128 (386)
T ss_pred             hhhhcCCc----ceEEecccc-cccCCCCCCcccccCCccccHHHH
Confidence            67777652    779999998 78999996 3 8999987766543


No 20 
>PF01412 ArfGap:  Putative GTPase activating protein for Arf;  InterPro: IPR001164  This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins []. The GTP-bound form of ARF is essential for the maintenance of normal Golgi morphology, it participates in recruitment of coat proteins which are required for budding and fission of membranes. Before the fusion with an acceptor compartment the membrane must be uncoated. This step required the hydrolysis of GTP associated to ARF. These proteins contain a characteristic zinc finger motif (Cys-x2-Cys-x(16,17)-x2-Cys) which displays some similarity to the C4-type GATA zinc finger. The ARFGAP domain display no obvious similarity to other GAP proteins.  The 3D structure of the ARFGAP domain of the PYK2-associated protein beta has been solved []. It consists of a three-stranded beta-sheet surrounded by 5 alpha helices. The domain is organised around a central zinc atom which is coordinated by 4 cysteines. The ARFGAP domain is clearly unrelated to the other GAP proteins structures which are exclusively helical. Classical GAP proteins accelerate GTPase activity by supplying an arginine finger to the active site. The crystal structure of ARFGAP bound to ARF revealed that the ARFGAP domain does not supply an arginine to the active site which suggests a more indirect role of the ARFGAP domain in the GTPase hydrolysis []. The Rev protein of human immunodeficiency virus type 1 (HIV-1) facilitates nuclear export of unspliced and partly-spliced viral RNAs []. Rev contains an RNA-binding domain and an effector domain; the latter is believed to interact with a cellular cofactor required for the Rev response and hence HIV-1 replication. Human Rev interacting protein (hRIP) specifically interacts with the Rev effector. The amino acid sequence of hRIP is characterised by an N-terminal, C-4 class zinc finger motif.; GO: 0008060 ARF GTPase activator activity, 0008270 zinc ion binding, 0032312 regulation of ARF GTPase activity; PDB: 2P57_A 2CRR_A 2OWA_B 3O47_B 3DWD_A 1DCQ_A 2CRW_A 3MDB_D 3FEH_A 3LJU_X ....
Probab=41.44  E-value=8.5  Score=30.17  Aligned_cols=52  Identities=23%  Similarity=0.305  Sum_probs=30.6

Q ss_pred             CCcceecccCCC-----------CcCCcccccccCCCc-eeEEEeccccceeeechhhhhhccc
Q 028109           35 SECNMYCLDCMN-----------GAFCSLCLDYHKDHR-AIQIRRSSYHDVIRVSEIQKVLDIS   86 (213)
Q Consensus        35 nE~N~FCldC~~-----------~~lC~~Cl~~H~~Hr-~lQIRRssY~dVVRv~dIqkl~D~S   86 (213)
                      ..-|..|.||..           .-+|..|...|+.-. .+-.-|+.-.|-....||+.+....
T Consensus        10 ~~~N~~CaDCg~~~p~w~s~~~GiflC~~Cag~HR~lg~~is~VkSi~~d~w~~~ev~~~~~~G   73 (116)
T PF01412_consen   10 KPGNKVCADCGAPNPTWASLNYGIFLCLECAGIHRSLGVHISRVKSITMDNWSPEEVQRMREGG   73 (116)
T ss_dssp             STTCTB-TTT-SBS--EEETTTTEEE-HHHHHHHHHHTTTT--EEETTTS---HHHHHHHHHSH
T ss_pred             CcCcCcCCCCCCCCCCEEEeecChhhhHHHHHHHHHhcccchhccccccCCCCHHHHHHHHHHC
Confidence            457899999962           248999988887322 2223377888888888888876553


No 21 
>COG4068 Uncharacterized protein containing a Zn-ribbon [Function unknown]
Probab=39.77  E-value=9  Score=28.23  Aligned_cols=23  Identities=26%  Similarity=0.676  Sum_probs=21.1

Q ss_pred             CCcccccccccCCCCeeeecccc
Q 028109          114 TNTCEVCDRSLLDSFRFCSLGCK  136 (213)
Q Consensus       114 ~~~C~~C~R~L~d~~rFCSL~CK  136 (213)
                      ...|.+|+..+...-+|||-.|.
T Consensus         8 H~HC~VCg~aIp~de~~CSe~C~   30 (64)
T COG4068           8 HRHCVVCGKAIPPDEQVCSEECG   30 (64)
T ss_pred             CccccccCCcCCCccchHHHHHH
Confidence            35799999999998999999999


No 22 
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=37.85  E-value=9.3  Score=23.89  Aligned_cols=21  Identities=38%  Similarity=0.880  Sum_probs=12.6

Q ss_pred             cccccccccCC-----CCeeeecccc
Q 028109          116 TCEVCDRSLLD-----SFRFCSLGCK  136 (213)
Q Consensus       116 ~C~~C~R~L~d-----~~rFCSL~CK  136 (213)
                      .|.+|+..-.-     ..+||||.|.
T Consensus         4 ~C~vC~~~~kY~Cp~C~~~~CSl~C~   29 (30)
T PF04438_consen    4 LCSVCGNPAKYRCPRCGARYCSLACY   29 (30)
T ss_dssp             EETSSSSEESEE-TTT--EESSHHHH
T ss_pred             CCccCcCCCEEECCCcCCceeCcEeE
Confidence            47777762211     3689999984


No 23 
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present in ZZZ3 (ZZ finger containing 3) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=36.21  E-value=22  Score=24.45  Aligned_cols=27  Identities=30%  Similarity=0.705  Sum_probs=19.2

Q ss_pred             eecccCC--CCcCCccccc---ccC-CCceeEE
Q 028109           39 MYCLDCM--NGAFCSLCLD---YHK-DHRAIQI   65 (213)
Q Consensus        39 ~FCldC~--~~~lC~~Cl~---~H~-~Hr~lQI   65 (213)
                      .-|++|.  +--||..|..   .|+ +|+.+.|
T Consensus        16 ~~C~~C~~~d~DlC~~C~~~~~~H~~~H~~~~i   48 (48)
T cd02341          16 YHCSECDDGDFDLCQDCVVKGESHQEDHWLVKI   48 (48)
T ss_pred             EECCCCCCCCCccCHHHHhCcCCCCCCCceeeC
Confidence            5688888  7789999955   343 6766654


No 24 
>smart00396 ZnF_UBR1 Putative zinc finger in N-recognin, a recognition component of the N-end rule pathway. Domain is involved in recognition of N-end rule substrates in yeast Ubr1p
Probab=30.46  E-value=51  Score=24.00  Aligned_cols=29  Identities=31%  Similarity=0.572  Sum_probs=21.5

Q ss_pred             CCCCcceecccCCC---CcCCccccc--ccCCCc
Q 028109           33 HKSECNMYCLDCMN---GAFCSLCLD--YHKDHR   61 (213)
Q Consensus        33 ~knE~N~FCldC~~---~~lC~~Cl~--~H~~Hr   61 (213)
                      .++|.-..|++|..   ..+|..|..  .|.+|+
T Consensus         8 ~~~~~~y~C~tC~~~~~~~iC~~Cf~~~~H~gH~   41 (71)
T smart00396        8 TGGEVIYRCKTCGLDPTCVLCSDCFRSNCHKGHD   41 (71)
T ss_pred             CCCCEEEECcCCCCCCCEeEChHHCCCCCCCCCC
Confidence            34577788999973   358888844  799998


No 25 
>PF04570 DUF581:  Protein of unknown function (DUF581);  InterPro: IPR007650 This is a family of uncharacterised proteins.
Probab=28.11  E-value=18  Score=26.13  Aligned_cols=24  Identities=38%  Similarity=0.928  Sum_probs=18.9

Q ss_pred             CCCcccccccccC---CC--Ce----eeecccc
Q 028109          113 VTNTCEVCDRSLL---DS--FR----FCSLGCK  136 (213)
Q Consensus       113 ~~~~C~~C~R~L~---d~--~r----FCSL~CK  136 (213)
                      .-..|-.|.|.|.   |-  |+    |||..|-
T Consensus        15 FL~~C~~C~k~L~~~~DiymYrGd~aFCS~ECR   47 (58)
T PF04570_consen   15 FLSFCYLCKKKLDPGKDIYMYRGDKAFCSEECR   47 (58)
T ss_pred             HHHHHHccCCCCCCCCCeeeeccccccccHHHH
Confidence            4568999999998   32  33    9999996


No 26 
>smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF. Putative zinc fingers with GTPase activating proteins (GAPs) towards the small GTPase, Arf. The GAP of ARD1 stimulates GTPase hydrolysis for ARD1 but not ARFs.
Probab=25.67  E-value=20  Score=27.90  Aligned_cols=43  Identities=26%  Similarity=0.384  Sum_probs=27.1

Q ss_pred             cceecccCCC-----------CcCCcccccccCCCc--eeEEEeccccceeeechhh
Q 028109           37 CNMYCLDCMN-----------GAFCSLCLDYHKDHR--AIQIRRSSYHDVIRVSEIQ   80 (213)
Q Consensus        37 ~N~FCldC~~-----------~~lC~~Cl~~H~~Hr--~lQIRRssY~dVVRv~dIq   80 (213)
                      -|..|.||..           .-+|..|..-|+...  +-. .|+.-.|...-.||+
T Consensus         2 ~N~~CaDC~~~~p~w~s~~~GifvC~~CsgiHR~lg~his~-VkSl~md~w~~~~i~   57 (112)
T smart00105        2 GNKKCFDCGAPNPTWASVNLGVFLCIECSGIHRSLGVHISK-VRSLTLDTWTEEELR   57 (112)
T ss_pred             CCCcccCCCCCCCCcEEeccceeEhHHhHHHHHhcCCCcCe-eeecccCCCCHHHHH
Confidence            4889999962           137888888888642  222 445555655555554


No 27 
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2. This small protein is found in three archaeal species so far (Methanococcus jannaschii, Archeoglobus fulgidus, and Methanobacterium thermoautotrophicum) as well as in Anabaena PCC7120. It is homologous to thioredoxins, glutaredoxins, and protein disulfide isomerases, and shares with them a redox-active disulfide. The redox active disulfide region CXXC motif resembles neither thioredoxin nor glutaredoxin. A closely related protein found in the same three Archaea, described by redox_disulf_1, has a glutaredoxin-like CP[YH]C sequence; it has been characterized in functional assays as redox-active but unlikely to be a thioredoxin or glutaredoxin.
Probab=24.44  E-value=1.2e+02  Score=21.57  Aligned_cols=32  Identities=9%  Similarity=0.360  Sum_probs=22.4

Q ss_pred             eeeechhhhh--hcccceeeEEEcCeEEEEeeCCC
Q 028109           73 VIRVSEIQKV--LDISGVQTYVINSARVVFLNERP  105 (213)
Q Consensus        73 VVRv~dIqkl--~D~S~IQtYvINsakVVFLn~RP  105 (213)
                      +++++|+...  +++.+|-|.++||..+ +....|
T Consensus        33 ~~~v~~~~~a~~~~v~~vPti~i~G~~~-~~G~~~   66 (76)
T TIGR00412        33 FEKVTDMNEILEAGVTATPGVAVDGELV-IMGKIP   66 (76)
T ss_pred             EEEeCCHHHHHHcCCCcCCEEEECCEEE-EEeccC
Confidence            5666655554  7899999999988665 554433


No 28 
>KOG4582 consensus Uncharacterized conserved protein, contains ZZ-type Zn-finger [General function prediction only]
Probab=24.33  E-value=70  Score=29.12  Aligned_cols=56  Identities=18%  Similarity=0.287  Sum_probs=35.4

Q ss_pred             CCCCcHHHHhcc-ccc--------ccCCCCCCCCCCCcceecccCCCCcCCccccc---ccCCCceeEEEe
Q 028109            9 RWPPWLKPLLRE-SFF--------VQCKLHPDSHKSECNMYCLDCMNGAFCSLCLD---YHKDHRAIQIRR   67 (213)
Q Consensus         9 ~~P~WL~~LL~~-~FF--------~~C~~H~~~~knE~N~FCldC~~~~lC~~Cl~---~H~~Hr~lQIRR   67 (213)
                      ..+.||.+-+.+ -++        +.|..|.-..   --.-|+.|.+.-||..|-.   .|..|..|||.+
T Consensus       132 ~~~~~~~~~~~~~H~~~~~~~v~CD~C~~~~IvG---~RyKC~~C~dYDLCe~Ce~~~~~h~~H~~lR~~t  199 (278)
T KOG4582|consen  132 SLVITLNPVVGEMHPNISKLSVPCDNCGKPGIVG---ARYKCTVCPDYDLCERCEAGNEHHAAHAMLRLHT  199 (278)
T ss_pred             hhhhhcCCCccccCCCcccccccCCCccCCcccc---ceeeecCCCccchhHHhhcCCCCCcccceeeccc
Confidence            345566665542 233        2445554432   2266999998889999944   456788898887


No 29 
>PF06156 DUF972:  Protein of unknown function (DUF972);  InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication. SUBUNIT: Interacts with both DnaA and DnaN, acting as a bridge between these two proteins. SIMILARITY: Belongs to the YabA family.
Probab=22.60  E-value=53  Score=26.06  Aligned_cols=30  Identities=33%  Similarity=0.637  Sum_probs=23.9

Q ss_pred             cHHHHhcccccccCCCCCCCCC-CCcceeccc
Q 028109           13 WLKPLLRESFFVQCKLHPDSHK-SECNMYCLD   43 (213)
Q Consensus        13 WL~~LL~~~FF~~C~~H~~~~k-nE~N~FCld   43 (213)
                      =|..|..+- |=.|..|.+.++ +|-.+||++
T Consensus        77 NL~~LY~EG-FHICn~~yG~~R~~edClFCl~  107 (107)
T PF06156_consen   77 NLARLYQEG-FHICNVHYGSRRNDEDCLFCLS  107 (107)
T ss_pred             HHHHHHhcC-eeeCcHHhCCcCCCCCCcccCC
Confidence            466777777 788999999887 577799985


No 30 
>smart00746 TRASH metallochaperone-like domain.
Probab=22.48  E-value=49  Score=18.23  Aligned_cols=10  Identities=50%  Similarity=1.035  Sum_probs=8.1

Q ss_pred             CCeeeecccc
Q 028109          127 SFRFCSLGCK  136 (213)
Q Consensus       127 ~~rFCSL~CK  136 (213)
                      .+.|||..|.
T Consensus        23 ~~~FCs~~c~   32 (39)
T smart00746       23 VFYFCSSKCL   32 (39)
T ss_pred             EEEEeCHHHH
Confidence            3689999887


No 31 
>cd02337 ZZ_CBP Zinc finger, ZZ type. Zinc finger present in CBP/p300 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. CREB-binding protein (CBP) is a large multidomain protein that provides binding sites for transcriptional coactivators, the role of the ZZ domain in CBP/p300 is unclear.
Probab=21.37  E-value=31  Score=22.82  Aligned_cols=29  Identities=17%  Similarity=0.507  Sum_probs=21.6

Q ss_pred             cceecccCCCCcCCccccc-ccCCCceeEE
Q 028109           37 CNMYCLDCMNGAFCSLCLD-YHKDHRAIQI   65 (213)
Q Consensus        37 ~N~FCldC~~~~lC~~Cl~-~H~~Hr~lQI   65 (213)
                      .-.-|..|.+--+|..|.. ..+.|...||
T Consensus        12 ~r~~C~~C~dfDLC~~C~~~~~H~H~~~~~   41 (41)
T cd02337          12 TRWHCTVCEDYDLCITCYNTKNHPHKMEKL   41 (41)
T ss_pred             CceECCCCcchhhHHHHhCCCCCCcccccC
Confidence            4477999987789999976 4447777664


No 32 
>PF12773 DZR:  Double zinc ribbon
Probab=20.93  E-value=43  Score=22.00  Aligned_cols=12  Identities=25%  Similarity=0.603  Sum_probs=5.9

Q ss_pred             CCcccccccccC
Q 028109          114 TNTCEVCDRSLL  125 (213)
Q Consensus       114 ~~~C~~C~R~L~  125 (213)
                      ...|..|+..|.
T Consensus        12 ~~fC~~CG~~l~   23 (50)
T PF12773_consen   12 AKFCPHCGTPLP   23 (50)
T ss_pred             ccCChhhcCChh
Confidence            344555555554


No 33 
>cd02344 ZZ_HERC2 Zinc finger, ZZ type. Zinc finger present in HERC2 and related proteins. HERC2 is a potential E3 ubiquitin protein ligase and/or guanine nucleotide exchange factor. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=20.26  E-value=60  Score=22.13  Aligned_cols=27  Identities=26%  Similarity=0.631  Sum_probs=19.4

Q ss_pred             ceecccCCCCcCCccccc--ccC-CCceeE
Q 028109           38 NMYCLDCMNGAFCSLCLD--YHK-DHRAIQ   64 (213)
Q Consensus        38 N~FCldC~~~~lC~~Cl~--~H~-~Hr~lQ   64 (213)
                      -.-|+.|.+--||..|..  .|. .|.-+.
T Consensus        15 RykC~~C~dyDLC~~Cf~~~~H~~~H~F~r   44 (45)
T cd02344          15 RFKCRNCDDFDFCENCFKTRKHNTRHTFGR   44 (45)
T ss_pred             eEECCCCCCccchHHhhCCCCcCCCCceee
Confidence            367999998899999966  453 565443


Done!