Citrus Sinensis ID: 028116

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210---
MDDLEFEDPNLFQSIPKFIAGAISGTLTGLFALAGAFTGAITGALAGRASDCGVLRGAGLGAIAGAVLSVELLEASRAYWCLERTGSRGSSSMADFVEDLLRGRFIEEQFTPAILGAYHWQVRIASMSYDVNDTDCRALSRGLTGESLKKLPCHVILDEIKPTQSSCCSICLQDIIVGELARSLPHCHHTFHLACVDKWLIRHGSCPVCRRDV
cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccccccccccccccccccccHHHHHcccEEEEEcccccccccccHHHHccccccccccccccccccccccHHHHHHccccccccccccc
*********NLFQSIPKFIAGAISGTLTGLFALAGAFTGAITGALAGRASDCGVLRGAGLGAIAGAVLSVELLEASRAYWCLERTG****SSMADFVEDLLRGRFIEEQFTPAILGAYHWQVRIASMSYDVNDTDCRALSRGLTGESLKKLPCHVILDEIKPTQSSCCSICLQDIIVGELARSLPHCHHTFHLACVDKWLIRHGSCPVCRRD*
xxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDDLEFEDPNLFQSIPKFIAGAISGTLTGLFALAGAFTGAITGALAGRASDCGVLRGAGLGAIAGAVLSVELLEASRAYWCLERTGSRGSSSMADFVEDLLRGRFIEEQFTPAILGAYHWQVRIASMSYDVNDTDCRALSRGLTGESLKKLPCHVILDEIKPTQSSCCSICLQDIIVGELARSLPHCHHTFHLACVDKWLIRHGSCPVCRRDV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NEP1-interacting protein-like 2 May be involved in the early steps of the plant defense signaling pathway. Does not display E3 catalytic activity.probableQ8LBA0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2L0B, chain A
Confidence level:very confident
Coverage over the Query: 135-213
View the alignment between query and template
View the model in PyMOL