BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 028120
         (213 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|B3QQ73|F16PA_CHLP8 Fructose-1,6-bisphosphatase class 1 OS=Chlorobaculum parvum (strain
           NCIB 8327) GN=fbp PE=3 SV=1
          Length = 333

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 1/42 (2%)

Query: 89  SVTSPEKEDRYYTTRGSLG-LDDSSKLFIDHLKEEKKPPVWP 129
           ++T+PE    Y    GS     D +KLF+D+LKEE K    P
Sbjct: 196 NITTPEHGKYYSVNEGSWNEFHDGTKLFLDYLKEEDKATGRP 237


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.310    0.126    0.361 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 79,947,295
Number of Sequences: 539616
Number of extensions: 3339116
Number of successful extensions: 8492
Number of sequences better than 100.0: 50
Number of HSP's better than 100.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 49
Number of HSP's that attempted gapping in prelim test: 8436
Number of HSP's gapped (non-prelim): 98
length of query: 213
length of database: 191,569,459
effective HSP length: 113
effective length of query: 100
effective length of database: 130,592,851
effective search space: 13059285100
effective search space used: 13059285100
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 59 (27.3 bits)