BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 028128
(213 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1TI2|A Chain A, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici
pdb|1TI2|C Chain C, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici
pdb|1TI2|E Chain E, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici
pdb|1TI2|G Chain G, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici
pdb|1TI2|I Chain I, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici
pdb|1TI2|K Chain K, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici
pdb|1TI4|A Chain A, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici Complexed
With Pyrogallol
pdb|1TI4|C Chain C, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici Complexed
With Pyrogallol
pdb|1TI4|E Chain E, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici Complexed
With Pyrogallol
pdb|1TI4|G Chain G, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici Complexed
With Pyrogallol
pdb|1TI4|I Chain I, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici Complexed
With Pyrogallol
pdb|1TI4|K Chain K, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici Complexed
With Pyrogallol
pdb|1TI6|A Chain A, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici Complexed
With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene
pdb|1TI6|C Chain C, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici Complexed
With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene
pdb|1TI6|E Chain E, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici Complexed
With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene
pdb|1TI6|G Chain G, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici Complexed
With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene
pdb|1TI6|I Chain I, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici Complexed
With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene
pdb|1TI6|K Chain K, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici Complexed
With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene
pdb|1VLD|M Chain M, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici
pdb|1VLD|O Chain O, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici
pdb|1VLD|Q Chain Q, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici
pdb|1VLD|S Chain S, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici
pdb|1VLD|U Chain U, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici
pdb|1VLD|W Chain W, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici
pdb|1VLE|M Chain M, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici Complexed
With Pyrogallol
pdb|1VLE|O Chain O, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici Complexed
With Pyrogallol
pdb|1VLE|Q Chain Q, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici Complexed
With Pyrogallol
pdb|1VLE|S Chain S, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici Complexed
With Pyrogallol
pdb|1VLE|U Chain U, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici Complexed
With Pyrogallol
pdb|1VLE|W Chain W, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici Complexed
With Pyrogallol
pdb|1VLF|M Chain M, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici Complexed
With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene
pdb|1VLF|O Chain O, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici Complexed
With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene
pdb|1VLF|Q Chain Q, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici Complexed
With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene
pdb|1VLF|S Chain S, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici Complexed
With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene
pdb|1VLF|U Chain U, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici Complexed
With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene
pdb|1VLF|W Chain W, Crystal Structure Of Pyrogallol-Phloroglucinol
Transhydroxylase From Pelobacter Acidigallici Complexed
With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene
Length = 875
Score = 28.9 bits (63), Expect = 2.3, Method: Composition-based stats.
Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 2/44 (4%)
Query: 37 EPAAQSSVKADIYRLFGRERPVHQVFGGGKPADVFLWRNKKISA 80
EP +S +IYRLF ++ + ++F GK D W + +A
Sbjct: 581 EPVGESMSDYEIYRLFAKKLNIEEMFSEGK--DELAWCEQYFNA 622
>pdb|1NED|A Chain A, Crystal Structure Of Hslv (Clpq) At 3.8 Angstroms
Resolution
pdb|1NED|B Chain B, Crystal Structure Of Hslv (Clpq) At 3.8 Angstroms
Resolution
pdb|1NED|C Chain C, Crystal Structure Of Hslv (Clpq) At 3.8 Angstroms
Resolution
Length = 183
Score = 28.5 bits (62), Expect = 3.2, Method: Compositional matrix adjust.
Identities = 13/26 (50%), Positives = 15/26 (57%)
Query: 75 NKKISAGVLGGATAIWVLFELFEYHL 100
N K+ AG GG + LFELFE L
Sbjct: 39 NDKVIAGFAGGTADAFTLFELFERKL 64
>pdb|1E94|A Chain A, Hslv-Hslu From E.Coli
pdb|1E94|B Chain B, Hslv-Hslu From E.Coli
pdb|1E94|C Chain C, Hslv-Hslu From E.Coli
pdb|1E94|D Chain D, Hslv-Hslu From E.Coli
pdb|1G4A|B Chain B, Crystal Structures Of The Hslvu Peptidase-Atpase Complex
Reveal An Atp-Dependent Proteolysis Mechanism
pdb|1G4A|A Chain A, Crystal Structures Of The Hslvu Peptidase-Atpase Complex
Reveal An Atp-Dependent Proteolysis Mechanism
pdb|1G4A|D Chain D, Crystal Structures Of The Hslvu Peptidase-Atpase Complex
Reveal An Atp-Dependent Proteolysis Mechanism
pdb|1G4A|C Chain C, Crystal Structures Of The Hslvu Peptidase-Atpase Complex
Reveal An Atp-Dependent Proteolysis Mechanism
pdb|1G4B|M Chain M, Crystal Structures Of The Hslvu Peptidase-Atpase Complex
Reveal An Atp-Dependent Proteolysis Mechanism
pdb|1G4B|N Chain N, Crystal Structures Of The Hslvu Peptidase-Atpase Complex
Reveal An Atp-Dependent Proteolysis Mechanism
pdb|1G4B|O Chain O, Crystal Structures Of The Hslvu Peptidase-Atpase Complex
Reveal An Atp-Dependent Proteolysis Mechanism
pdb|1G4B|P Chain P, Crystal Structures Of The Hslvu Peptidase-Atpase Complex
Reveal An Atp-Dependent Proteolysis Mechanism
pdb|1HT2|A Chain A, Nucleotide-dependent Conformational Changes In A
Protease-associated Atpase Hslu
pdb|1HT2|B Chain B, Nucleotide-dependent Conformational Changes In A
Protease-associated Atpase Hslu
pdb|1HT2|C Chain C, Nucleotide-dependent Conformational Changes In A
Protease-associated Atpase Hslu
pdb|1HT2|D Chain D, Nucleotide-dependent Conformational Changes In A
Protease-associated Atpase Hslu
pdb|1HT2|I Chain I, Nucleotide-dependent Conformational Changes In A
Protease-associated Atpase Hslu
pdb|1HT2|J Chain J, Nucleotide-dependent Conformational Changes In A
Protease-associated Atpase Hslu
pdb|1HT2|K Chain K, Nucleotide-dependent Conformational Changes In A
Protease-associated Atpase Hslu
pdb|1HT2|L Chain L, Nucleotide-dependent Conformational Changes In A
Protease-associated Atpase Hslu
pdb|1HT1|C Chain C, Nucleotide-Dependent Conformational Changes In A
Protease-Associated Atpase Hslu
pdb|1HT1|D Chain D, Nucleotide-Dependent Conformational Changes In A
Protease-Associated Atpase Hslu
pdb|1HT1|V Chain V, Nucleotide-Dependent Conformational Changes In A
Protease-Associated Atpase Hslu
pdb|1HT1|X Chain X, Nucleotide-Dependent Conformational Changes In A
Protease-Associated Atpase Hslu
pdb|1HT1|A Chain A, Nucleotide-Dependent Conformational Changes In A
Protease-Associated Atpase Hslu
pdb|1HT1|B Chain B, Nucleotide-Dependent Conformational Changes In A
Protease-Associated Atpase Hslu
pdb|1HT1|Z Chain Z, Nucleotide-Dependent Conformational Changes In A
Protease-Associated Atpase Hslu
pdb|1HT1|Y Chain Y, Nucleotide-Dependent Conformational Changes In A
Protease-Associated Atpase Hslu
pdb|1HQY|A Chain A, Nucleotide-Dependent Conformational Changes In A
Protease-Associated Atpase Hslu
pdb|1HQY|B Chain B, Nucleotide-Dependent Conformational Changes In A
Protease-Associated Atpase Hslu
pdb|1HQY|C Chain C, Nucleotide-Dependent Conformational Changes In A
Protease-Associated Atpase Hslu
pdb|1HQY|D Chain D, Nucleotide-Dependent Conformational Changes In A
Protease-Associated Atpase Hslu
Length = 175
Score = 28.1 bits (61), Expect = 3.3, Method: Compositional matrix adjust.
Identities = 13/26 (50%), Positives = 15/26 (57%)
Query: 75 NKKISAGVLGGATAIWVLFELFEYHL 100
N K+ AG GG + LFELFE L
Sbjct: 39 NDKVIAGFAGGTADAFTLFELFERKL 64
>pdb|1G3I|G Chain G, Crystal Structure Of The Hsluv Protease-Chaperone Complex
pdb|1G3I|H Chain H, Crystal Structure Of The Hsluv Protease-Chaperone Complex
pdb|1G3I|I Chain I, Crystal Structure Of The Hsluv Protease-Chaperone Complex
pdb|1G3I|J Chain J, Crystal Structure Of The Hsluv Protease-Chaperone Complex
pdb|1G3I|K Chain K, Crystal Structure Of The Hsluv Protease-Chaperone Complex
pdb|1G3I|L Chain L, Crystal Structure Of The Hsluv Protease-Chaperone Complex
pdb|1G3I|M Chain M, Crystal Structure Of The Hsluv Protease-Chaperone Complex
pdb|1G3I|N Chain N, Crystal Structure Of The Hsluv Protease-Chaperone Complex
pdb|1G3I|O Chain O, Crystal Structure Of The Hsluv Protease-Chaperone Complex
pdb|1G3I|P Chain P, Crystal Structure Of The Hsluv Protease-Chaperone Complex
pdb|1G3I|Q Chain Q, Crystal Structure Of The Hsluv Protease-Chaperone Complex
pdb|1G3I|R Chain R, Crystal Structure Of The Hsluv Protease-Chaperone Complex
pdb|1G3K|A Chain A, Crystal Structure Of The H. Influenzae Protease Hslv At
1.9 A Resolution
pdb|1G3K|B Chain B, Crystal Structure Of The H. Influenzae Protease Hslv At
1.9 A Resolution
pdb|1G3K|C Chain C, Crystal Structure Of The H. Influenzae Protease Hslv At
1.9 A Resolution
pdb|1JJW|A Chain A, Structure Of Haemophilus Influenzae Hslv Protein At 1.9 A
Resolution
pdb|1JJW|B Chain B, Structure Of Haemophilus Influenzae Hslv Protein At 1.9 A
Resolution
pdb|1JJW|C Chain C, Structure Of Haemophilus Influenzae Hslv Protein At 1.9 A
Resolution
pdb|1KYI|G Chain G, Hsluv (h. Influenzae)-nlvs Vinyl Sulfone Inhibitor Complex
pdb|1KYI|H Chain H, Hsluv (h. Influenzae)-nlvs Vinyl Sulfone Inhibitor Complex
pdb|1KYI|I Chain I, Hsluv (h. Influenzae)-nlvs Vinyl Sulfone Inhibitor Complex
pdb|1KYI|J Chain J, Hsluv (h. Influenzae)-nlvs Vinyl Sulfone Inhibitor Complex
pdb|1KYI|K Chain K, Hsluv (h. Influenzae)-nlvs Vinyl Sulfone Inhibitor Complex
pdb|1KYI|L Chain L, Hsluv (h. Influenzae)-nlvs Vinyl Sulfone Inhibitor Complex
pdb|1KYI|M Chain M, Hsluv (h. Influenzae)-nlvs Vinyl Sulfone Inhibitor Complex
pdb|1KYI|N Chain N, Hsluv (h. Influenzae)-nlvs Vinyl Sulfone Inhibitor Complex
pdb|1KYI|O Chain O, Hsluv (h. Influenzae)-nlvs Vinyl Sulfone Inhibitor Complex
pdb|1KYI|P Chain P, Hsluv (h. Influenzae)-nlvs Vinyl Sulfone Inhibitor Complex
pdb|1KYI|Q Chain Q, Hsluv (h. Influenzae)-nlvs Vinyl Sulfone Inhibitor Complex
pdb|1KYI|R Chain R, Hsluv (h. Influenzae)-nlvs Vinyl Sulfone Inhibitor Complex
pdb|1OFH|G Chain G, Asymmetric Complex Between Hslv And I-domain Deleted Hslu
(h. Influenzae)
pdb|1OFH|H Chain H, Asymmetric Complex Between Hslv And I-domain Deleted Hslu
(h. Influenzae)
pdb|1OFH|I Chain I, Asymmetric Complex Between Hslv And I-domain Deleted Hslu
(h. Influenzae)
pdb|1OFH|L Chain L, Asymmetric Complex Between Hslv And I-domain Deleted Hslu
(h. Influenzae)
pdb|1OFH|M Chain M, Asymmetric Complex Between Hslv And I-domain Deleted Hslu
(h. Influenzae)
pdb|1OFH|N Chain N, Asymmetric Complex Between Hslv And I-domain Deleted Hslu
(h. Influenzae)
pdb|1OFI|G Chain G, Asymmetric Complex Between Hslv And I-Domain Deleted Hslu
(H. Influenzae)
pdb|1OFI|H Chain H, Asymmetric Complex Between Hslv And I-Domain Deleted Hslu
(H. Influenzae)
pdb|1OFI|I Chain I, Asymmetric Complex Between Hslv And I-Domain Deleted Hslu
(H. Influenzae)
pdb|1OFI|L Chain L, Asymmetric Complex Between Hslv And I-Domain Deleted Hslu
(H. Influenzae)
pdb|1OFI|M Chain M, Asymmetric Complex Between Hslv And I-Domain Deleted Hslu
(H. Influenzae)
pdb|1OFI|N Chain N, Asymmetric Complex Between Hslv And I-Domain Deleted Hslu
(H. Influenzae)
Length = 174
Score = 28.1 bits (61), Expect = 4.2, Method: Compositional matrix adjust.
Identities = 15/36 (41%), Positives = 17/36 (47%)
Query: 65 GKPADVFLWRNKKISAGVLGGATAIWVLFELFEYHL 100
G V N K+ AG GG + LFELFE L
Sbjct: 29 GNARKVRRLYNGKVLAGFAGGTADAFTLFELFERKL 64
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.326 0.139 0.451
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,636,857
Number of Sequences: 62578
Number of extensions: 191331
Number of successful extensions: 380
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 375
Number of HSP's gapped (non-prelim): 5
length of query: 213
length of database: 14,973,337
effective HSP length: 95
effective length of query: 118
effective length of database: 9,028,427
effective search space: 1065354386
effective search space used: 1065354386
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 49 (23.5 bits)