BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 028129
         (213 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1VDH|A Chain A, Structure-Based Functional Identification Of A Novel Heme-
           Binding Protein From Thermus Thermophilus Hb8
 pdb|1VDH|B Chain B, Structure-Based Functional Identification Of A Novel Heme-
           Binding Protein From Thermus Thermophilus Hb8
 pdb|1VDH|C Chain C, Structure-Based Functional Identification Of A Novel Heme-
           Binding Protein From Thermus Thermophilus Hb8
 pdb|1VDH|D Chain D, Structure-Based Functional Identification Of A Novel Heme-
           Binding Protein From Thermus Thermophilus Hb8
 pdb|1VDH|E Chain E, Structure-Based Functional Identification Of A Novel Heme-
           Binding Protein From Thermus Thermophilus Hb8
          Length = 249

 Score = 26.9 bits (58), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%)

Query: 144 WHLSEGGFQEFRLLERLGEGSSKPTAIIGDVADELNLDL 182
           W   +G  +E+R LE  G+GS     ++G  AD L L+L
Sbjct: 41  WEELKGLVREWRELEEAGQGSYGIYQVVGHKADLLFLNL 79


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.136    0.387 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,010,074
Number of Sequences: 62578
Number of extensions: 169512
Number of successful extensions: 380
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 379
Number of HSP's gapped (non-prelim): 3
length of query: 213
length of database: 14,973,337
effective HSP length: 95
effective length of query: 118
effective length of database: 9,028,427
effective search space: 1065354386
effective search space used: 1065354386
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)