Query         028141
Match_columns 213
No_of_seqs    217 out of 575
Neff          4.5 
Searched_HMMs 46136
Date          Fri Mar 29 06:52:30 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/028141.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/028141hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02309 AUX_IAA:  AUX/IAA fami 100.0   5E-58 1.1E-62  392.9   0.4  188    2-213     1-191 (215)
  2 PF00564 PB1:  PB1 domain;  Int  97.3 0.00069 1.5E-08   49.0   6.2   55  129-208     3-57  (84)
  3 cd06398 PB1_Joka2 The PB1 doma  97.3 0.00087 1.9E-08   51.5   6.5   57  129-208     2-61  (91)
  4 cd06407 PB1_NLP A PB1 domain i  97.2  0.0015 3.2E-08   49.2   6.6   54  129-207     2-55  (82)
  5 cd06396 PB1_NBR1 The PB1 domai  97.0  0.0023 5.1E-08   48.5   6.1   52  130-207     3-54  (81)
  6 smart00666 PB1 PB1 domain. Pho  96.9  0.0046   1E-07   44.6   6.8   54  130-209     4-57  (81)
  7 cd05992 PB1 The PB1 domain is   96.5   0.013 2.9E-07   41.9   6.8   55  129-209     2-57  (81)
  8 cd06403 PB1_Par6 The PB1 domai  96.3  0.0095 2.1E-07   45.3   5.4   53  130-206     3-55  (80)
  9 cd06409 PB1_MUG70 The MUG70 pr  96.2   0.011 2.3E-07   45.4   5.3   50  137-207     7-58  (86)
 10 cd06402 PB1_p62 The PB1 domain  95.8   0.045 9.7E-07   42.0   6.8   56  129-207     2-62  (87)
 11 cd06404 PB1_aPKC PB1 domain is  95.7    0.03 6.5E-07   42.8   5.6   53  130-207     3-55  (83)
 12 cd06397 PB1_UP1 Uncharacterize  95.2   0.066 1.4E-06   40.9   6.0   52  130-207     3-54  (82)
 13 cd06401 PB1_TFG The PB1 domain  95.1     0.1 2.2E-06   39.8   6.8   57  130-209     3-60  (81)
 14 cd06408 PB1_NoxR The PB1 domai  92.0    0.58 1.3E-05   35.9   6.1   54  128-209     3-56  (86)
 15 cd06399 PB1_P40 The PB1 domain  68.2     8.3 0.00018   30.1   3.8   38  144-207    23-60  (92)
 16 PF10411 DsbC_N:  Disulfide bon  57.9     8.2 0.00018   26.8   2.0   17  194-210    34-50  (57)
 17 cd06395 PB1_Map2k5 PB1 domain   47.0      37 0.00081   26.3   4.2   47  136-207    10-56  (91)
 18 COG0219 CspR Predicted rRNA me  31.6      21 0.00046   30.3   0.8   30  135-164    48-80  (155)
 19 PF07929 PRiA4_ORF3:  Plasmid p  25.9      79  0.0017   26.1   3.3   37  127-163     4-42  (179)
 20 PF09676 TraV:  Type IV conjuga  25.4      45 0.00097   25.8   1.6   19  192-210    92-110 (119)
 21 PF12426 DUF3674:  RNA dependen  24.1      45 0.00099   22.5   1.2   14  155-168     7-21  (41)
 22 PF02013 CBM_10:  Cellulose or   24.0      27 0.00058   22.8   0.1   11  194-204    16-26  (36)
 23 PF11576 DUF3236:  Protein of u  23.6      29 0.00063   29.4   0.2    9    9-17    100-108 (154)
 24 cd00771 ThrRS_core Threonyl-tR  22.1      28  0.0006   31.3  -0.2   54  127-203   209-262 (298)
 25 cd06406 PB1_P67 A PB1 domain i  21.9 2.7E+02  0.0059   21.1   5.2   33  129-164     4-36  (80)

No 1  
>PF02309 AUX_IAA:  AUX/IAA family;  InterPro: IPR003311 The Aux/IAA family of genes are key regulators of auxin-modified gene expression []. The plant hormone auxin (indole-3-acetic acid, IAA) regulates diverse cellular and developmental responses in plants, including cell division, expansion, differentiation and patterning of embryo responses []. Auxin can regulate the gene expression of several families, including GH3 and SAUR, as well as Aux/IAA itself. The Aux/IAA proteins act as repressors of auxin-induced gene expression, possibly through modulating the activity of DNA-binding auxin response factors (ARFs) (IPR010525 from INTERPRO). Aux/IAA and ARF are thought to interact through C-terminal protein-protein interaction domains found in both Aux/IAA and ARF. Recent evidence suggests that Aux/IAA proteins can also mediate light responses []. Some members of the AUX/IAA family are longer and contain an N-terminal DNA binding domain [] and may have an early function in the establishment of vascular and body patterns in embryonic and post-embryonic development in some plants.; GO: 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 2P1N_F 2P1Q_C 2P1O_C.
Probab=100.00  E-value=5e-58  Score=392.89  Aligned_cols=188  Identities=53%  Similarity=0.907  Sum_probs=6.0

Q ss_pred             CCccccccccCCCCCCCCCCCCCCCCCCCCccccCccCCCCCCCchhhhhhhccCCcCCCCC-ccccccccCCcCCC-CC
Q 028141            2 INFEATELRLGLPGGNGGSSEGGGGGGGGEKAKNNNINGMKRGFADTVVDLKLNLSTKESGG-IDVIEKTKGKSASA-TG   79 (213)
Q Consensus         2 lnl~~TELrLGLPG~~~~~~~~~~~~~~~~~~~~~~~~~~KR~fset~vdl~~~l~~~~~~~-~~~~~~~~~~~~~~-~~   79 (213)
                      ||||+|||||||||+.+  ++     ...........+++||+|+++ |+............ .............. ..
T Consensus         1 ln~~~TELrLGLPG~~~--~~-----~~~~~~~~~~~~~~kR~F~~a-id~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   72 (215)
T PF02309_consen    1 LNLKATELRLGLPGSES--PD-----ASSSSSSKKSSSGNKRGFSEA-IDSSSSNSQSSSSSSSDSSSSSSSSSTSSSSS   72 (215)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             CCchhhhhcccCCCCCC--CC-----cccccccccccCcccccchhh-hhhcccccccccccccccCccccccccccccc
Confidence            89999999999999874  11     000111112347889999998 77654111000000 00000000000000 00


Q ss_pred             C-CCCCCCCCCCCCCCCCCccchhhhhhhhcccCcccccccCCCCCCCcceEEEEecCccccceeecCCccCHHHHHHHH
Q 028141           80 A-TDLSKPPAKSQVVGWPPVRSFRKNIMAVQKDNEEGDNKASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDAL  158 (213)
Q Consensus        80 ~-~~~~~p~~k~qvVGWPPVrs~Rkn~~~~~~~~~~~~~~~~~~~~~~~~~VKV~MdG~pigRKVDL~~~~sY~eL~~aL  158 (213)
                      . .....|.+++|+|||||||+||||++...+            ....++||||+|||+||||||||++|+||++|+.+|
T Consensus        73 ~~~~~~~p~~~~~~vgwpp~~s~r~n~~~~~~------------~~~~~~~vKV~mdG~~igRkVDL~~~~sY~~L~~~L  140 (215)
T PF02309_consen   73 DSSSSSPPASKAQVVGWPPVRSFRKNSLSEKQ------------SSSSRSYVKVNMDGVPIGRKVDLSAYSSYEELSSAL  140 (215)
T ss_dssp             -------------BTTBS----S---------------------------------------------------------
T ss_pred             ccccCCCCcccccccCCCcccccccccccccc------------cccCCceeEEEecCcccceecCHHHhhCHHHHHHHH
Confidence            0 122235578999999999999999877211            122479999999999999999999999999999999


Q ss_pred             HHhhcccccCCcCCCCcccccchhhhhccCCCCCeeEEEeeCCCCeeecccCCCC
Q 028141          159 GKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWE  213 (213)
Q Consensus       159 e~MF~~~~~g~~~~~g~~~~~~e~~l~d~~~~seyvltYEDkdGDwMLVGDVPWe  213 (213)
                      ++||.+|.|++|++++    .++..+.++.++++|+|||||+||||||||||||+
T Consensus       141 ~~MF~~~~i~~~~~~~----~~~~~~~~~~~~~~~~l~Y~D~egd~mlvGD~PW~  191 (215)
T PF02309_consen  141 EKMFSCFSIEQCGSHG----LNESGLLDLLNGSEYVLVYEDKEGDWMLVGDVPWE  191 (215)
T ss_dssp             -------------------------------------------------------
T ss_pred             HHhcCCCCcccccccc----ccchhhccccCCcceeEEEECCCCCEEEecCCCHH
Confidence            9999988888887744    45667778888899999999999999999999996


No 2  
>PF00564 PB1:  PB1 domain;  InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins. The domain adopts a beta-grasp fold, similar to that found in ubiquitin and Ras-binding domains. A motif, variously termed OPR, PC and AID, represents the most conserved region of the majority of PB1 domains, and is necessary for PB1 domain function. This function is the formation of PB1 domain heterodimers, although not all PB1 domain pairs associate.; GO: 0005515 protein binding; PDB: 1IPG_A 1IP9_A 2KFK_A 1WMH_A 1VD2_A 1WI0_A 1OEY_C 1PQS_A 1Q1O_A 1TZ1_A ....
Probab=97.34  E-value=0.00069  Score=49.01  Aligned_cols=55  Identities=27%  Similarity=0.468  Sum_probs=45.6

Q ss_pred             eEEEEecCccccceeecCCccCHHHHHHHHHHhhcccccCCcCCCCcccccchhhhhccCCCCCeeEEEeeCCCCeeecc
Q 028141          129 FVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVG  208 (213)
Q Consensus       129 ~VKV~MdG~pigRKVDL~~~~sY~eL~~aLe~MF~~~~~g~~~~~g~~~~~~e~~l~d~~~~seyvltYEDkdGDwMLVG  208 (213)
                      -|||+..|. +=|.+.+..--+|.+|...+++.|...                        ...+.+.|.|.||||..+-
T Consensus         3 ~vK~~~~~~-~~~~~~~~~~~s~~~L~~~i~~~~~~~------------------------~~~~~l~Y~D~dgD~V~i~   57 (84)
T PF00564_consen    3 RVKVRYGGD-IRRIISLPSDVSFDDLRSKIREKFGLL------------------------DEDFQLKYKDEDGDLVTIS   57 (84)
T ss_dssp             EEEEEETTE-EEEEEEECSTSHHHHHHHHHHHHHTTS------------------------TSSEEEEEEETTSSEEEES
T ss_pred             EEEEEECCe-eEEEEEcCCCCCHHHHHHHHHHHhCCC------------------------CccEEEEeeCCCCCEEEeC
Confidence            489999997 434688888889999999999999861                        2468999999999998875


No 3  
>cd06398 PB1_Joka2 The PB1 domain is present in the Nicotiana plumbaginifolia Joka2 protein which interacts with sulfur stress inducible UP9 protein. The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module
Probab=97.29  E-value=0.00087  Score=51.48  Aligned_cols=57  Identities=26%  Similarity=0.317  Sum_probs=45.3

Q ss_pred             eEEEEecCccccceeecC---CccCHHHHHHHHHHhhcccccCCcCCCCcccccchhhhhccCCCCCeeEEEeeCCCCee
Q 028141          129 FVKVSMDGAPYLRKVDLK---LYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWM  205 (213)
Q Consensus       129 ~VKV~MdG~pigRKVDL~---~~~sY~eL~~aLe~MF~~~~~g~~~~~g~~~~~~e~~l~d~~~~seyvltYEDkdGDwM  205 (213)
                      -|||.-+|.-+=-++++.   .--+|++|.+.+.+.|...                       ...+|+|.|.|.||||.
T Consensus         2 ~vKv~y~~~~rRf~l~~~~~~~d~~~~~L~~kI~~~f~l~-----------------------~~~~~~l~Y~Dedgd~V   58 (91)
T cd06398           2 VVKVKYGGTLRRFTFPVAENQLDLNMDGLREKVEELFSLS-----------------------PDADLSLTYTDEDGDVV   58 (91)
T ss_pred             EEEEEeCCEEEEEEeccccccCCCCHHHHHHHHHHHhCCC-----------------------CCCcEEEEEECCCCCEE
Confidence            489999998555555553   4679999999999999851                       23589999999999998


Q ss_pred             ecc
Q 028141          206 LVG  208 (213)
Q Consensus       206 LVG  208 (213)
                      .+-
T Consensus        59 ~l~   61 (91)
T cd06398          59 TLV   61 (91)
T ss_pred             EEc
Confidence            763


No 4  
>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium). The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes like osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-inte
Probab=97.18  E-value=0.0015  Score=49.21  Aligned_cols=54  Identities=24%  Similarity=0.348  Sum_probs=43.1

Q ss_pred             eEEEEecCccccceeecCCccCHHHHHHHHHHhhcccccCCcCCCCcccccchhhhhccCCCCCeeEEEeeCCCCeeec
Q 028141          129 FVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLV  207 (213)
Q Consensus       129 ~VKV~MdG~pigRKVDL~~~~sY~eL~~aLe~MF~~~~~g~~~~~g~~~~~~e~~l~d~~~~seyvltYEDkdGDwMLV  207 (213)
                      =|||...|.  -+.+-|..--+|++|.+.+.++|..-                       +...|.|-|.|.||||.++
T Consensus         2 ~vK~~~~~d--~~r~~l~~~~~~~~L~~~i~~r~~~~-----------------------~~~~f~LkY~Ddegd~v~l   55 (82)
T cd06407           2 RVKATYGEE--KIRFRLPPSWGFTELKQEIAKRFKLD-----------------------DMSAFDLKYLDDDEEWVLL   55 (82)
T ss_pred             EEEEEeCCe--EEEEEcCCCCCHHHHHHHHHHHhCCC-----------------------CCCeeEEEEECCCCCeEEe
Confidence            389999887  44455555669999999999999851                       1257999999999999875


No 5  
>cd06396 PB1_NBR1 The PB1 domain is an essential part of NBR1 protein, next to BRCA1, a scaffold protein mediating specific protein-protein interaction with both titin protein kinase and with another scaffold protein p62. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. The NBR1 protein contains a type I PB1 domain.
Probab=96.99  E-value=0.0023  Score=48.55  Aligned_cols=52  Identities=19%  Similarity=0.228  Sum_probs=45.6

Q ss_pred             EEEEecCccccceeecCCccCHHHHHHHHHHhhcccccCCcCCCCcccccchhhhhccCCCCCeeEEEeeCCCCeeec
Q 028141          130 VKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLV  207 (213)
Q Consensus       130 VKV~MdG~pigRKVDL~~~~sY~eL~~aLe~MF~~~~~g~~~~~g~~~~~~e~~l~d~~~~seyvltYEDkdGDwMLV  207 (213)
                      |||.-.|.-+--+++-+..-+|++|.+.+.++|+.                        +  .|.|.|-|.||||.++
T Consensus         3 vKaty~~d~~rf~~~~~~~~~~~~L~~ev~~rf~l------------------------~--~f~lKYlDde~e~v~l   54 (81)
T cd06396           3 LKVTYNGESQSFLVSDSENTTWASVEAMVKVSFGL------------------------N--DIQIKYVDEENEEVSV   54 (81)
T ss_pred             EEEEECCeEEEEEecCCCCCCHHHHHHHHHHHhCC------------------------C--cceeEEEcCCCCEEEE
Confidence            79999999777788887788999999999999986                        1  4689999999999986


No 6  
>smart00666 PB1 PB1 domain. Phox and Bem1p domain, present in many eukaryotic cytoplasmic signalling proteins. The domain adopts a beta-grasp fold, similar to that found in ubiquitin and Ras-binding domains. A motif, variously termed OPR, PC and AID, represents the most conserved region of the majority of PB1 domains, and is necessary for PB1 domain function. This function is the formation of PB1 domain heterodimers, although not all PB1 domain pairs associate.
Probab=96.88  E-value=0.0046  Score=44.64  Aligned_cols=54  Identities=24%  Similarity=0.492  Sum_probs=43.3

Q ss_pred             EEEEecCccccceeecCCccCHHHHHHHHHHhhcccccCCcCCCCcccccchhhhhccCCCCCeeEEEeeCCCCeeeccc
Q 028141          130 VKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGD  209 (213)
Q Consensus       130 VKV~MdG~pigRKVDL~~~~sY~eL~~aLe~MF~~~~~g~~~~~g~~~~~~e~~l~d~~~~seyvltYEDkdGDwMLVGD  209 (213)
                      |||.-.|.  -|.+-+..--+|.+|...+.+.|..                        ....+.|.|+|.||||..+.+
T Consensus         4 vK~~~~~~--~~~~~~~~~~s~~dL~~~i~~~~~~------------------------~~~~~~l~Y~Dedgd~v~l~s   57 (81)
T smart00666        4 VKLRYGGE--TRRLSVPRDISFEDLRSKVAKRFGL------------------------DNQSFTLKYQDEDGDLVSLTS   57 (81)
T ss_pred             EEEEECCE--EEEEEECCCCCHHHHHHHHHHHhCC------------------------CCCCeEEEEECCCCCEEEecC
Confidence            68877543  5777788888999999999999985                        123689999999999987643


No 7  
>cd05992 PB1 The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. Interactions of PB1 domains with other protein domains have been described as a noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants.
Probab=96.50  E-value=0.013  Score=41.93  Aligned_cols=55  Identities=24%  Similarity=0.414  Sum_probs=42.7

Q ss_pred             eEEEEecCccccceeecC-CccCHHHHHHHHHHhhcccccCCcCCCCcccccchhhhhccCCCCCeeEEEeeCCCCeeec
Q 028141          129 FVKVSMDGAPYLRKVDLK-LYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLV  207 (213)
Q Consensus       129 ~VKV~MdG~pigRKVDL~-~~~sY~eL~~aLe~MF~~~~~g~~~~~g~~~~~~e~~l~d~~~~seyvltYEDkdGDwMLV  207 (213)
                      -|||+-.|.  -|.+=+. .--+|++|...|.+.|...                        ...+.+.|.|.||||..+
T Consensus         2 ~vK~~~~~~--~~~~~~~~~~~s~~~L~~~i~~~~~~~------------------------~~~~~l~y~D~e~d~v~l   55 (81)
T cd05992           2 RVKVKYGGE--IRRFVVVSRSISFEDLRSKIAEKFGLD------------------------AVSFKLKYPDEDGDLVTI   55 (81)
T ss_pred             cEEEEecCC--CEEEEEecCCCCHHHHHHHHHHHhCCC------------------------CCcEEEEeeCCCCCEEEe
Confidence            378888765  3444444 7889999999999999851                        136899999999999877


Q ss_pred             cc
Q 028141          208 GD  209 (213)
Q Consensus       208 GD  209 (213)
                      .+
T Consensus        56 ~s   57 (81)
T cd05992          56 SS   57 (81)
T ss_pred             CC
Confidence            54


No 8  
>cd06403 PB1_Par6 The PB1 domain is an essential part of Par6 protein which in complex with Par3 and aPKC proteins is crucial for establishment of apical-basal polarity of animal cells. The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants. The
Probab=96.33  E-value=0.0095  Score=45.26  Aligned_cols=53  Identities=19%  Similarity=0.276  Sum_probs=40.0

Q ss_pred             EEEEecCccccceeecCCccCHHHHHHHHHHhhcccccCCcCCCCcccccchhhhhccCCCCCeeEEEeeCCCCeee
Q 028141          130 VKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWML  206 (213)
Q Consensus       130 VKV~MdG~pigRKVDL~~~~sY~eL~~aLe~MF~~~~~g~~~~~g~~~~~~e~~l~d~~~~seyvltYEDkdGDwML  206 (213)
                      ||...|..=-=-.+|.....+|+++.+-|+.||.+                        .+..|+|-|.|.+||.+=
T Consensus         3 VKSkfdaEfRRFsl~r~~~~~f~ef~~ll~~lH~l------------------------~~~~f~i~Y~D~~gDLLP   55 (80)
T cd06403           3 VKSKFDAEFRRFSLDRNKPGKFEDFYKLLEHLHHI------------------------PNVDFLIGYTDPHGDLLP   55 (80)
T ss_pred             eecccCCeEEEEEeccccCcCHHHHHHHHHHHhCC------------------------CCCcEEEEEeCCCCCEec
Confidence            56666665222245555669999999999999986                        234799999999999874


No 9  
>cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain. The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domains depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic amino acid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is
Probab=96.23  E-value=0.011  Score=45.36  Aligned_cols=50  Identities=22%  Similarity=0.344  Sum_probs=38.0

Q ss_pred             ccccceeecC--CccCHHHHHHHHHHhhcccccCCcCCCCcccccchhhhhccCCCCCeeEEEeeCCCCeeec
Q 028141          137 APYLRKVDLK--LYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLV  207 (213)
Q Consensus       137 ~pigRKVDL~--~~~sY~eL~~aLe~MF~~~~~g~~~~~g~~~~~~e~~l~d~~~~seyvltYEDkdGDwMLV  207 (213)
                      .|-||-+=++  ...|+.+|..++.+-|+.-.                     .....|.|.|.|.||||.|.
T Consensus         7 ~~~GrvhRf~~~~s~~~~~L~~~I~~Rl~~d~---------------------~~~~~~~L~YlDDEgD~Vll   58 (86)
T cd06409           7 DPKGRVHRFRLRPSESLEELRTLISQRLGDDD---------------------FETHLYALSYVDDEGDIVLI   58 (86)
T ss_pred             CCCCCEEEEEecCCCCHHHHHHHHHHHhCCcc---------------------ccCCcccEEEEcCCCCEEEE
Confidence            4667765544  47899999999999997511                     01247899999999999986


No 10 
>cd06402 PB1_p62 The PB1 domain is an essential part of p62 scaffold protein (alias sequestosome 1,SQSTM) involved in cell signaling, receptor internalization, and protein turnover. The PB1 domain is a modular domain mediating specific protein-protein interaction which play roles in many critical cell processes. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants.
Probab=95.75  E-value=0.045  Score=42.03  Aligned_cols=56  Identities=23%  Similarity=0.485  Sum_probs=41.5

Q ss_pred             eEEEEecC---ccccceeec--CCccCHHHHHHHHHHhhcccccCCcCCCCcccccchhhhhccCCCCCeeEEEeeCCCC
Q 028141          129 FVKVSMDG---APYLRKVDL--KLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGD  203 (213)
Q Consensus       129 ~VKV~MdG---~pigRKVDL--~~~~sY~eL~~aLe~MF~~~~~g~~~~~g~~~~~~e~~l~d~~~~seyvltYEDkdGD  203 (213)
                      .||.+..|   .+==|++=|  ....+|++|...+.++|...                       .+..|++.|.|.|||
T Consensus         2 ~vkayl~~~~~~~EIRRf~l~~~~~~s~~~L~~~V~~~f~~l-----------------------~~~~ftlky~DeeGD   58 (87)
T cd06402           2 TVKAYLLGKDANAEIRRFAIDEDVSTSYEYLVEKVAAVFPSL-----------------------RGKNFQLFWKDEEGD   58 (87)
T ss_pred             eEEEeecCCCCccceEEEEecCCCCcCHHHHHHHHHHHcccc-----------------------CCCcEEEEEECCCCC
Confidence            57777766   233344444  66679999999999999741                       235799999999999


Q ss_pred             eeec
Q 028141          204 WMLV  207 (213)
Q Consensus       204 wMLV  207 (213)
                      ..-+
T Consensus        59 lvtI   62 (87)
T cd06402          59 LVAF   62 (87)
T ss_pred             EEee
Confidence            8654


No 11 
>cd06404 PB1_aPKC PB1 domain is an essential modular domain of the atypical protein kinase C (aPKC) which in complex with Par6 and Par3  proteins is crucial for establishment of apical-basal polarity of animal cells. PB1 domain is a modular domain mediating specific protein-protein interaction which play roles in many critical cell processes. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi,
Probab=95.70  E-value=0.03  Score=42.83  Aligned_cols=53  Identities=23%  Similarity=0.357  Sum_probs=42.0

Q ss_pred             EEEEecCccccceeecCCccCHHHHHHHHHHhhcccccCCcCCCCcccccchhhhhccCCCCCeeEEEeeCCCCeeec
Q 028141          130 VKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLV  207 (213)
Q Consensus       130 VKV~MdG~pigRKVDL~~~~sY~eL~~aLe~MF~~~~~g~~~~~g~~~~~~e~~l~d~~~~seyvltYEDkdGDwMLV  207 (213)
                      ||++-.|.-.--.+|.  .-+|++|.+.+.+||...                       .+..|++.|.|.|||---+
T Consensus         3 ~K~~y~gdi~it~~d~--~~s~e~L~~~v~~~c~~~-----------------------~~q~ft~kw~DEEGDp~ti   55 (83)
T cd06404           3 VKAAYNGDIMITSIDP--SISLEELCNEVRDMCRFH-----------------------NDQPFTLKWIDEEGDPCTI   55 (83)
T ss_pred             EEEEecCcEEEEEcCC--CcCHHHHHHHHHHHhCCC-----------------------CCCcEEEEEECCCCCceee
Confidence            7889999855555565  778999999999999851                       2347999999999996543


No 12 
>cd06397 PB1_UP1 Uncharacterized protein 1. The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions.
Probab=95.22  E-value=0.066  Score=40.90  Aligned_cols=52  Identities=21%  Similarity=0.280  Sum_probs=42.7

Q ss_pred             EEEEecCccccceeecCCccCHHHHHHHHHHhhcccccCCcCCCCcccccchhhhhccCCCCCeeEEEeeCCCCeeec
Q 028141          130 VKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLV  207 (213)
Q Consensus       130 VKV~MdG~pigRKVDL~~~~sY~eL~~aLe~MF~~~~~g~~~~~g~~~~~~e~~l~d~~~~seyvltYEDkdGDwMLV  207 (213)
                      -||+-.|.  .|++-...-=+|..|.+.|+.+|.+.                        .-.+.+||.|.|||..-+
T Consensus         3 fKv~~~g~--~RRf~~~~~pt~~~L~~kl~~Lf~lp------------------------~~~~~vtYiDeD~D~ITl   54 (82)
T cd06397           3 FKSSFLGD--TRRIVFPDIPTWEALASKLENLYNLP------------------------EIKVGVTYIDNDNDEITL   54 (82)
T ss_pred             EEEEeCCc--eEEEecCCCccHHHHHHHHHHHhCCC------------------------hhHeEEEEEcCCCCEEEe
Confidence            47888886  78888888899999999999999862                        112789999999998654


No 13 
>cd06401 PB1_TFG The PB1 domain found in TFG protein, an oncogenic gene product and fusion partner to nerve growth factor tyrosine kinase receptor TrkA and to the tyrosine kinase ALK. The PB1 domain is a modular domain mediating specific protein-protein interaction in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  The PB1 domains of TFG represent a type I/II PB1 domain. The physiological function of TFG remains unknown.
Probab=95.14  E-value=0.1  Score=39.81  Aligned_cols=57  Identities=25%  Similarity=0.469  Sum_probs=40.3

Q ss_pred             EEEEecCccccceeecCCcc-CHHHHHHHHHHhhcccccCCcCCCCcccccchhhhhccCCCCCeeEEEeeCCCCeeecc
Q 028141          130 VKVSMDGAPYLRKVDLKLYK-SYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVG  208 (213)
Q Consensus       130 VKV~MdG~pigRKVDL~~~~-sY~eL~~aLe~MF~~~~~g~~~~~g~~~~~~e~~l~d~~~~seyvltYEDkdGDwMLVG  208 (213)
                      +|+...|. | |++=+..-. +|.+|...+.+.|..-    .+                 ....+.+.|.|.|||+.-|-
T Consensus         3 iK~~~g~D-i-R~~~~~~~~~t~~~L~~~v~~~F~~~----~~-----------------~~~~flIKYkD~dGDlVTIt   59 (81)
T cd06401           3 LKAQLGDD-I-RRIPIHNEDITYDELLLMMQRVFRGK----LG-----------------SSDDVLIKYKDEDGDLITIF   59 (81)
T ss_pred             EEEEeCCe-E-EEEeccCccccHHHHHHHHHHHhccc----cC-----------------CcccEEEEEECCCCCEEEec
Confidence            67766655 4 444444323 9999999999999851    11                 23478999999999997664


Q ss_pred             c
Q 028141          209 D  209 (213)
Q Consensus       209 D  209 (213)
                      +
T Consensus        60 s   60 (81)
T cd06401          60 D   60 (81)
T ss_pred             c
Confidence            3


No 14 
>cd06408 PB1_NoxR The PB1 domain is present in the Epichloe festucae NoxR protein (NADPH oxidase regulator), a key regulator of NADPH oxidase isoform, NoxA.  NoxA is essential for growth control of the fungal endophyte in plant tissue in the process of symbiotic interaction between a fungi and its plant host.   The Epichloe festucae p67(phox)-like regulator, NoxR, dispensable in culture but essential in plants for the symbiotic interaction. Plants infected with a noxR deletion mutant show severe stunting and premature senescence, whereas hyphae in the meristematic tissues show increased branching leading to increased fungal colonization of pseudostem and leaf blade tissue.  The PB1 domain is a modular domain mediating specific protein-protein interactions which a play role in many critical cell processes such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is 
Probab=91.98  E-value=0.58  Score=35.94  Aligned_cols=54  Identities=20%  Similarity=0.302  Sum_probs=44.0

Q ss_pred             ceEEEEecCccccceeecCCccCHHHHHHHHHHhhcccccCCcCCCCcccccchhhhhccCCCCCeeEEEeeCCCCeeec
Q 028141          128 AFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLV  207 (213)
Q Consensus       128 ~~VKV~MdG~pigRKVDL~~~~sY~eL~~aLe~MF~~~~~g~~~~~g~~~~~~e~~l~d~~~~seyvltYEDkdGDwMLV  207 (213)
                      .=|||+-.|.  .|-|-+..--+|++|...+.++|+.                         ...+.+-|.|. ||..-+
T Consensus         3 ikVKv~~~~D--v~~i~v~~~i~f~dL~~kIrdkf~~-------------------------~~~~~iKykDE-GD~iti   54 (86)
T cd06408           3 IRVKVHAQDD--TRYIMIGPDTGFADFEDKIRDKFGF-------------------------KRRLKIKMKDD-GDMITM   54 (86)
T ss_pred             EEEEEEecCc--EEEEEcCCCCCHHHHHHHHHHHhCC-------------------------CCceEEEEEcC-CCCccc
Confidence            4589998888  5667777777899999999999985                         12678999999 998777


Q ss_pred             cc
Q 028141          208 GD  209 (213)
Q Consensus       208 GD  209 (213)
                      +|
T Consensus        55 ~s   56 (86)
T cd06408          55 GD   56 (86)
T ss_pred             cC
Confidence            65


No 15 
>cd06399 PB1_P40 The PB1 domain is essential part of the p40 adaptor protein which plays an important role in activating phagocyte NADPH oxidase during phagocytosis. The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes , such as osteoclastogenesis, angiogenesis, early cardiovascular development and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. The PB1 domain of p40 represents a type I PB1 domain which interacts with the PB1 domain of oxidase activator p67 w
Probab=68.24  E-value=8.3  Score=30.12  Aligned_cols=38  Identities=24%  Similarity=0.364  Sum_probs=30.4

Q ss_pred             ecCCccCHHHHHHHHHHhhcccccCCcCCCCcccccchhhhhccCCCCCeeEEEeeCCCCeeec
Q 028141          144 DLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLV  207 (213)
Q Consensus       144 DL~~~~sY~eL~~aLe~MF~~~~~g~~~~~g~~~~~~e~~l~d~~~~seyvltYEDkdGDwMLV  207 (213)
                      ||+.--+|.+|..-..+-|..+                          +-+|-|.|.|||..-+
T Consensus        23 ~l~~~P~~kdLl~lmr~~f~~~--------------------------dIaLNYrD~EGDLIRl   60 (92)
T cd06399          23 DLSSTPLLKDLLELTRREFQRE--------------------------DIALNYRDAEGDLIRL   60 (92)
T ss_pred             ccccCccHHHHHHHHHHHhchh--------------------------heeeeeecCCCCEEEE
Confidence            6788889999999888888752                          3468899999998643


No 16 
>PF10411 DsbC_N:  Disulfide bond isomerase protein N-terminus;  InterPro: IPR018950  This is the N-terminal domain of the disulphide bond isomerase DsbC. The whole molecule is V-shaped, where each arm is a DsbC monomer of two domains linked by a hinge; and the N-termini of each monomer join to form the dimer interface at the base of the V, so are vital for dimerisation []. DsbC is required for disulphide bond formation and functions as a disulphide bond isomerase during oxidative protein-folding in bacterial periplasm. It also has chaperone activity []. ; PDB: 1EEJ_B 2IYJ_A 1TJD_A 1JZD_B 1JZO_A 1G0T_B 1T3B_A.
Probab=57.86  E-value=8.2  Score=26.79  Aligned_cols=17  Identities=29%  Similarity=0.649  Sum_probs=14.4

Q ss_pred             eEEEeeCCCCeeecccC
Q 028141          194 VPTYEDKDGDWMLVGDV  210 (213)
Q Consensus       194 vltYEDkdGDwMLVGDV  210 (213)
                      -+.|.|.||+.+++|+.
T Consensus        34 ~i~Y~~~dg~yli~G~l   50 (57)
T PF10411_consen   34 GILYVDEDGRYLIQGQL   50 (57)
T ss_dssp             EEEEEETTSSEEEES-E
T ss_pred             eEEEEcCCCCEEEEeEE
Confidence            48899999999999974


No 17 
>cd06395 PB1_Map2k5 PB1 domain is essential part of the mitogen-activated protein kinase kinase 5 (Map2k5, alias MEK5) one of the key member of the signaling kinases cascade which involved in angiogenesis and early cardiovascular development. The PB1 domain of Map2k5 interacts with the PB1 domain of another members of kinase cascade MEKK2 (or MEKK3).  A canonical PB1-PB1 interaction, involving heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  The Map2k5 protein contains a type I PB1 domain.
Probab=47.00  E-value=37  Score=26.34  Aligned_cols=47  Identities=26%  Similarity=0.376  Sum_probs=33.4

Q ss_pred             CccccceeecCCccCHHHHHHHHHHhhcccccCCcCCCCcccccchhhhhccCCCCCeeEEEeeCCCCeeec
Q 028141          136 GAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLV  207 (213)
Q Consensus       136 G~pigRKVDL~~~~sY~eL~~aLe~MF~~~~~g~~~~~g~~~~~~e~~l~d~~~~seyvltYEDkdGDwMLV  207 (213)
                      |..+--.||...+=+|.+++.++.+....-|.                         -..-|||.|||..-|
T Consensus        10 gg~vDw~V~~~~~L~F~DvL~~I~~vlp~aT~-------------------------tAFeYEDE~gDRITV   56 (91)
T cd06395          10 GGAVDWTVQSGPQLLFRDVLDVIGQVLPEATT-------------------------TAFEYEDEDGDRITV   56 (91)
T ss_pred             CCcccccccCcccccHHHHHHHHHHhcccccc-------------------------cceeeccccCCeeEe
Confidence            34456667777777899999888876653221                         136699999999876


No 18 
>COG0219 CspR Predicted rRNA methylase (SpoU class) [Translation, ribosomal structure and biogenesis]
Probab=31.62  E-value=21  Score=30.30  Aligned_cols=30  Identities=27%  Similarity=0.427  Sum_probs=25.8

Q ss_pred             cCccccceeecCCccCHHHHHHHH---HHhhcc
Q 028141          135 DGAPYLRKVDLKLYKSYQELSDAL---GKMFSS  164 (213)
Q Consensus       135 dG~pigRKVDL~~~~sY~eL~~aL---e~MF~~  164 (213)
                      -|--|.-+++|..|++|++...+.   .++|-.
T Consensus        48 AGlDY~~~~~l~~h~s~e~fl~~~~~~~rl~~~   80 (155)
T COG0219          48 AGLDYHEKASLTEHDSLEAFLEAEPIGGRLFAL   80 (155)
T ss_pred             cccchHhhcceEEeCCHHHHHhhccCCceEEEE
Confidence            477799999999999999999998   467765


No 19 
>PF07929 PRiA4_ORF3:  Plasmid pRiA4b ORF-3-like protein;  InterPro: IPR012912 Members of this family are similar to the protein product of ORF-3 (Q44206 from SWISSPROT) found on plasmid pRiA4 in the bacterium Agrobacterium rhizogenes. This plasmid is responsible for tumourigenesis at wound sites of plants infected by this bacterium, but the ORF-3 product does not seem to be involved in the pathogenetic process []. Other proteins found in this family are annotated as being putative TnpR resolvases (Q9LCU7 from SWISSPROT, Q50439 from SWISSPROT), but no further evidence was found to back this. Moreover, another member of this family is described as a probable lexA repressor (Q7UEI4 from SWISSPROT) and in fact carries a LexA DNA binding domain (IPR006199 from INTERPRO), but no references were found to expand on this. ; PDB: 2I1S_A.
Probab=25.94  E-value=79  Score=26.11  Aligned_cols=37  Identities=24%  Similarity=0.482  Sum_probs=30.9

Q ss_pred             cceEEEEecCc--cccceeecCCccCHHHHHHHHHHhhc
Q 028141          127 VAFVKVSMDGA--PYLRKVDLKLYKSYQELSDALGKMFS  163 (213)
Q Consensus       127 ~~~VKV~MdG~--pigRKVDL~~~~sY~eL~~aLe~MF~  163 (213)
                      ..-+||...|.  +|=|.|-+..--+..+|..+|+..|+
T Consensus         4 ~y~lkV~L~~~~p~iwRri~Vp~~~tl~~Lh~~Iq~afg   42 (179)
T PF07929_consen    4 VYQLKVSLKGSKPPIWRRIEVPADITLADLHEVIQAAFG   42 (179)
T ss_dssp             EEEEEEEETT-SS-EEEEEEEETT-BHHHHHHHHHHHTT
T ss_pred             EEEEEEEEcCCCCCeEEEEEECCCCCHHHHHHHHHHHhC
Confidence            34579999885  89999999999999999999999997


No 20 
>PF09676 TraV:  Type IV conjugative transfer system lipoprotein (TraV);  InterPro: IPR014118 This entry represents TraV, a component of a conjugative type IV secretion system. TraV is an outer membrane lipoprotein that is believed to interact with the secretin TraK [, , ]. This protein contains three conserved cysteines in the N-terminal half.
Probab=25.37  E-value=45  Score=25.78  Aligned_cols=19  Identities=37%  Similarity=0.548  Sum_probs=15.8

Q ss_pred             CeeEEEeeCCCCeeecccC
Q 028141          192 DYVPTYEDKDGDWMLVGDV  210 (213)
Q Consensus       192 eyvltYEDkdGDwMLVGDV  210 (213)
                      =|+.-|+|.+||+..-|.|
T Consensus        92 iwiaP~~D~~g~l~~~~~V  110 (119)
T PF09676_consen   92 IWIAPWEDADGDLHDPGYV  110 (119)
T ss_pred             EEEeeeECCCCCEeccceE
Confidence            5889999999999876654


No 21 
>PF12426 DUF3674:  RNA dependent RNA polymerase;  InterPro: IPR024378 This domain is found in the RNA-directed RNA polymerase. It is located towards the N terminus and is approximately 40 amino acids in length. There is a conserved MFNLKF sequence motif. There are two completely conserved residues (E and P) that may be functionally important.
Probab=24.10  E-value=45  Score=22.51  Aligned_cols=14  Identities=50%  Similarity=0.783  Sum_probs=10.7

Q ss_pred             HHHHHHhhcc-cccC
Q 028141          155 SDALGKMFSS-FTIG  168 (213)
Q Consensus       155 ~~aLe~MF~~-~~~g  168 (213)
                      ..+||.||.. |.++
T Consensus         7 R~aLEAMFNLKFhi~   21 (41)
T PF12426_consen    7 RSALEAMFNLKFHIG   21 (41)
T ss_pred             HHHHHHHhceeeeeC
Confidence            6899999996 5443


No 22 
>PF02013 CBM_10:  Cellulose or protein binding domain;  InterPro: IPR002883 This domain is found in two distinct sets of proteins with different functions. Those found in aerobic bacteria bind cellulose (or other carbohydrates); but in anaerobic fungi they are protein binding domains, referred to as dockerin domains or docking domains. They are believed to be responsible for the assembly of a multiprotein cellulase/hemicellulase complex, similar to the cellulosome found in certain anaerobic bacteria. The recycling of photosynthetically fixed carbon in plant cell walls is a key microbial process. Enzyme systems that attack the plant cell wall contain noncatalytic carbohydrate-binding modules that mediate attachment to this composite structure and play a pivotal role in maximizing the hydrolytic process. In anaerobes, the degradation is carried out by a high molecular weight, multifunctional complex termed the cellulosome. This consists of a number of independent enzyme components, each of which contains a conserved 40-residue dockerin domain, which functions to bind the enzyme to a cohesin domain within the scaffoldin protein [, ].  In anaerobic bacteria that degrade plant cell walls, exemplified by Clostridium thermocellum, the dockerin domains of the catalytic polypeptides can bind equally well to any cohesin from the same organism. More recently, anaerobic fungi, typified by Piromyces equi, have been suggested to also synthesise a cellulosome complex, although the dockerin sequences of the bacterial and fungal enzymes are completely different []. For example, the fungal enzymes contain one, two or three copies of the dockerin sequence in tandem within the catalytic polypeptide. In contrast, all the C. thermocellum cellulosome catalytic components contain a single dockerin domain. The anaerobic bacterial dockerins are homologous to EF hands (calcium-binding motifs) and require calcium for activity whereas the fungal dockerin does not require calcium. Finally, the interaction between cohesin and dockerin appears to be species specific in bacteria, there is almost no species specificity of binding within fungal species and no identified sites that distinguish different species.  The structure of dockerin from P. equi contains two helical stretches and four short beta-strands which form an antiparallel sheet structure adjacent to an additional short twisted parallel strand. The N- and C-termini are adjacent to each other.  Aerobic bacteria contain related regions, however these appear to function as cellulose/carbohydrate binding domains.; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 2J4M_A 2J4N_A 1E8R_A 1QLD_A 1E8P_A 1E8Q_A.
Probab=23.96  E-value=27  Score=22.78  Aligned_cols=11  Identities=45%  Similarity=1.054  Sum_probs=8.5

Q ss_pred             eEEEeeCCCCe
Q 028141          194 VPTYEDKDGDW  204 (213)
Q Consensus       194 vltYEDkdGDw  204 (213)
                      .+.|.|.+|+|
T Consensus        16 ~v~y~d~~g~W   26 (36)
T PF02013_consen   16 EVVYTDDDGGW   26 (36)
T ss_dssp             --SEEETTEEE
T ss_pred             ceEEcCCCCCE
Confidence            57899999998


No 23 
>PF11576 DUF3236:  Protein of unknown function (DUF3236);  InterPro: IPR012019  This family of proteins with unknown function appears to be restricted to Methanobacteria. ; PDB: 3BRC_B.
Probab=23.63  E-value=29  Score=29.43  Aligned_cols=9  Identities=56%  Similarity=1.025  Sum_probs=6.1

Q ss_pred             cccCCCCCC
Q 028141            9 LRLGLPGGN   17 (213)
Q Consensus         9 LrLGLPG~~   17 (213)
                      =|||.||+.
T Consensus       100 GRLGvPGSG  108 (154)
T PF11576_consen  100 GRLGVPGSG  108 (154)
T ss_dssp             EE-SSTTS-
T ss_pred             ccccCCCCc
Confidence            499999985


No 24 
>cd00771 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class II core catalytic domain. ThrRS is a homodimer. It is responsible for the attachment of threonine to the 3' OH group of ribose of the appropriate tRNA. This domain is primarily responsible for ATP-dependent formation of the enzyme bound aminoacyl-adenylate. Class II assignment is based upon its structure and the presence of three characteristic sequence motifs in the core domain.
Probab=22.13  E-value=28  Score=31.31  Aligned_cols=54  Identities=26%  Similarity=0.421  Sum_probs=32.1

Q ss_pred             cceEEEEecCccccceeecCCccCHHHHHHHHHHhhcccccCCcCCCCcccccchhhhhccCCCCCeeEEEeeCCCC
Q 028141          127 VAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGD  203 (213)
Q Consensus       127 ~~~VKV~MdG~pigRKVDL~~~~sY~eL~~aLe~MF~~~~~g~~~~~g~~~~~~e~~l~d~~~~seyvltYEDkdGD  203 (213)
                      -.|.-.-=||+-||-|||..+.++       |.+.+.+-|+               + .|......|-|+|.|+||.
T Consensus       209 ~~~~~~~g~~afygpkid~~~~d~-------~gr~~q~~t~---------------q-ld~~~~~~f~l~y~~~~~~  262 (298)
T cd00771         209 LPYEINEGEGAFYGPKIDFHVKDA-------LGREWQCSTI---------------Q-LDFNLPERFDLTYIGEDGE  262 (298)
T ss_pred             CCceECCCCcccccceEEEEEEeC-------CCCeeeccee---------------E-eeccChhhcCCEEEccCCC
Confidence            346666667778888888877643       3333333221               1 1222234678999999985


No 25 
>cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of  NADPH oxidase during phagocytosis. PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes . A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants. The p67 proteins contain
Probab=21.90  E-value=2.7e+02  Score=21.12  Aligned_cols=33  Identities=18%  Similarity=0.159  Sum_probs=26.6

Q ss_pred             eEEEEecCccccceeecCCccCHHHHHHHHHHhhcc
Q 028141          129 FVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSS  164 (213)
Q Consensus       129 ~VKV~MdG~pigRKVDL~~~~sY~eL~~aLe~MF~~  164 (213)
                      -|||+..+   .=.|-...=-+|++|...|.+-+..
T Consensus         4 vvKV~f~~---tIaIrvp~~~~y~~L~~ki~~kLkl   36 (80)
T cd06406           4 VVKVHFKY---TVAIQVARGLSYATLLQKISSKLEL   36 (80)
T ss_pred             EEEEEEEE---EEEEEcCCCCCHHHHHHHHHHHhCC
Confidence            58999997   3456666677999999999998886


Done!