Citrus Sinensis ID: 028144

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210---

MSSSSTTLSLDQFPTSEQLCYVHCNLCDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLLPSANQFHLGHNFFSPSHNLREEIPNPSPNFLINQTNTNDFIVPTRGVVDELPRPPATSRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLVPDHQPVKKANVRQQEGEDVLMKDGFFASANVGVSPY

ccccccccccccccccccEEEEEcccccEEEEEccccccccCEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccCCccccccccccccccc

**************TSEQLCYVHCNLCDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLLPSA*********************************************************************RFIKDEIQRIKA***DISHREAFSAAAKNWAHFPHIHFGLVPD********************DGFFASANVGVS**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Axial regulator YABBY 1	Involved in the abaxial cell fate determination during embryogenesis and organogenesis. Required during flower formation and development, particularly for the patterning of floral organs. Positive regulator of class B (AP3 and PI) activity in whorls 2 and 3. Negative regulator of class B activity in whorl 1 and of SUP activity in whorl 3. Interacts with class A proteins (AP1, AP2 and LUG) to repress class C (AG) activity in whorls 1 and 2. Contributes to the repression of KNOX genes (STM, KNAT1/BP and KNAT2) to avoid ectopic meristems. Binds DNA without sequence specificity. In vitro, can compete and displace the AP1 protein binding to DNA containing CArG box.	probable	O22152

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YRQ, chain A
Confidence level:confident
Coverage over the Query: 123-170
View the alignment between query and template
View the model in PyMOL