Citrus Sinensis ID: 028153

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210---

MKQERDVLVIACAPMASASPAAAAVSTVSPVIASSLTPQQTFPTPSPFSFSVASTRWSSRPSIHFSNLFLRFLALVFCFVSALSLAAPSPKKKGQQPSSFTGYPELVYSFTVDILAFAYSSFQLFKGICDIAHRGIIIPDKISDYISFILDQLMGYLLISSSSVAIPVIQDIDQMHSLWKAAIVSTCMSFVTFVVIVSCTLLSGYKLCKRIIW

ccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc

******VLVIACAP****************************************TRWSSRPSIHFSNLFLRFLALVFCFVSALSLAAPSPKK**QQPSSFTGYPELVYSFTVDILAFAYSSFQLFKGICDIAHRGIIIPDKISDYISFILDQLMGYLLISSSSVAIPVIQDIDQMHSLWKAAIVSTCMSFVTFVVIVSCTLLSGYKLCKRIIW

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
CASP-like protein At4g11655		probable	Q3EA54

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted