Citrus Sinensis ID: 028155

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210---
MAVEICVKAAVGAPDILGDCPFSQRALLTLEEKKVPYKRHLINISDKPQWFMEISPEGKVPVVKFDDKWVADSDVIVRIIEEKYPEPSLTNPPEFASLGSKIFPSFVNFLKSKDPNDGTEQALLEELKALDEHLKTHGGPFIAGEKVTAVDLSLAPKLYHLQVALEHFKQWTVPESLAHVHGYTKKLFALESFQKTKAEKQYVIAGWVPKVNA
ccEEEEEEEccccccccccccHHHHHHHHHHHcccccEEEEEccccccHHHHHHcccccccEEEEccCEEECHHHHHHHHHHHccccccccccHHHHHHcHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccHHHHHccccHHHHHHHHcccccc
*AVEICVKAAVGAPDILGDCPFSQRALLTLEEKKVPYKRHLINISDKPQWFMEISPEGKVPVVKFDDKWVADSDVIVRIIEEKYPEPSLTNPPEFASLGSKIFPSFVNFLKSK*******QALLEELKALDEHLKTHGGPFIAGEKVTAVDLSLAPKLYHLQVALEHFKQWTVPESLAHVHGYTKKLFALESFQKTKAEKQYVIAGWVPKVN*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVEICVKAAVGAPDILGDCPFSQRALLTLEEKKVPYKRHLINISDKPQWFMEISPEGKVPVVKFDDKWVADSDVIVRIIEEKYPEPSLTNPPEFASLGSKIFPSFVNFLKSKDPNDGTEQALLEELKALDEHLKTHGGPFIAGEKVTAVDLSLAPKLYHLQVALEHFKQWTVPESLAHVHGYTKKLFALESFQKTKAEKQYVIAGWVPKVNA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glutathione S-transferase DHAR2 Exhibits glutathione-dependent thiol transferase and dehydroascorbate (DHA) reductase activities. Key component of the ascorbate recycling system. Involved in the redox homeostasis, especially in scavenging of ROS under oxidative stresses. Plays a role in ozone tolerance.confidentQ9FRL8
Glutathione S-transferase DHAR1, mitochondrial Displays a dual function. As a soluble protein, exhibits glutathione-dependent thiol transferase and dehydroascorbate (DHA) reductase activities. Key component of the ascorbate recycling system. Involved in the redox homeostasis, especially in scavenging of ROS under oxidative stresses, subsequently to biotic or abiotic inducers. As a peripheral membrane protein, could also function as voltage-gated ion channel.probableQ9FWR4

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.5.-.-Transferring alkyl or aryl groups, other than methyl groups.probable
2.5.1.-5,10-methenyltetrahydromethanopterin hydrogenase.probable
2.5.1.18Transferred entry: 2.5.1.18.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R4V, chain A
Confidence level:very confident
Coverage over the Query: 1-45,56-213
View the alignment between query and template
View the model in PyMOL