Query         028172
Match_columns 212
No_of_seqs    29 out of 31
Neff          2.6 
Searched_HMMs 46136
Date          Fri Mar 29 07:22:15 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/028172.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/028172hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK14472 F0F1 ATP synthase sub  76.7       2 4.2E-05   35.1   2.3   33  144-176     6-42  (175)
  2 PF09188 DUF1951:  Domain of un  54.6     7.2 0.00016   32.8   1.4   60  117-185    54-116 (137)
  3 PF00430 ATP-synt_B:  ATP synth  53.8     9.5 0.00021   28.6   1.9   21  156-176     3-23  (132)
  4 PF06024 DUF912:  Nucleopolyhed  52.8      12 0.00027   28.8   2.4   42  148-193    60-101 (101)
  5 PRK13453 F0F1 ATP synthase sub  49.6      12 0.00025   30.8   1.9   25  152-176    18-42  (173)
  6 PF09451 ATG27:  Autophagy-rela  49.4      14  0.0003   32.5   2.4   22  162-183   208-229 (268)
  7 TIGR00869 sec62 protein transl  47.7      14  0.0003   33.2   2.2   34  145-178   149-183 (232)
  8 PRK07352 F0F1 ATP synthase sub  46.3      19 0.00041   29.4   2.6   20  157-176    24-43  (174)
  9 PF04799 Fzo_mitofusin:  fzo-li  44.6     7.3 0.00016   33.6   0.0   19  155-173    44-62  (171)
 10 PRK09173 F0F1 ATP synthase sub  39.6      21 0.00046   28.5   1.9   18  155-172     4-21  (159)
 11 PRK14473 F0F1 ATP synthase sub  36.1      25 0.00054   28.3   1.8   25  152-176     8-32  (164)
 12 PRK13454 F0F1 ATP synthase sub  35.4      29 0.00062   28.9   2.1   23  154-176    33-55  (181)
 13 COG3966 DltD Protein involved   34.9      25 0.00054   34.2   1.9   25  154-181     5-29  (415)
 14 PRK13460 F0F1 ATP synthase sub  34.4      29 0.00062   28.4   1.9   22  155-176    19-40  (173)
 15 PF12273 RCR:  Chitin synthesis  34.2      23  0.0005   27.8   1.3   16  152-167     4-19  (130)
 16 PRK13460 F0F1 ATP synthase sub  31.8      35 0.00076   27.8   2.1   27  149-175     7-34  (173)
 17 PF06210 DUF1003:  Protein of u  30.7      39 0.00084   26.8   2.1   35  155-193     2-36  (108)
 18 PRK13455 F0F1 ATP synthase sub  28.0      52  0.0011   27.0   2.5   20  156-175    30-49  (184)
 19 CHL00118 atpG ATP synthase CF0  27.0      44 0.00096   26.9   1.9   20  157-176    27-46  (156)
 20 KOG4452 Predicted membrane pro  26.9      37  0.0008   26.3   1.3   25  144-171    54-78  (79)
 21 PRK06569 F0F1 ATP synthase sub  26.6      54  0.0012   27.7   2.4   19  156-174     9-27  (155)
 22 PF06692 MNSV_P7B:  Melon necro  25.7      75  0.0016   23.7   2.7   28  159-186    18-47  (61)
 23 PF14162 YozD:  YozD-like prote  25.3      49  0.0011   24.4   1.6   16   66-81     15-30  (57)
 24 PRK08476 F0F1 ATP synthase sub  24.5      55  0.0012   26.2   2.0   22  155-176    10-31  (141)
 25 COG3462 Predicted membrane pro  24.5      55  0.0012   27.1   2.0   30  156-185    52-81  (117)
 26 COG2886 Uncharacterized small   24.4      48   0.001   25.9   1.5   17   65-81     55-71  (88)
 27 PRK14471 F0F1 ATP synthase sub  24.1      55  0.0012   26.3   1.9   23  154-176    10-32  (164)
 28 PRK07021 fliL flagellar basal   24.0      89  0.0019   25.5   3.1   16  161-176    27-42  (162)
 29 PRK14475 F0F1 ATP synthase sub  23.2      56  0.0012   26.6   1.8   19  156-174    12-30  (167)
 30 PRK06568 F0F1 ATP synthase sub  23.2      62  0.0013   27.1   2.1   22  155-176     7-28  (154)
 31 PF09753 Use1:  Membrane fusion  23.0      88  0.0019   27.0   3.1   46  126-173   202-247 (251)
 32 COG4736 CcoQ Cbb3-type cytochr  23.0      84  0.0018   23.1   2.5   24  154-177    10-33  (60)
 33 PLN03156 GDSL esterase/lipase;  22.9      73  0.0016   29.0   2.7   33  152-184     5-43  (351)
 34 PF02416 MttA_Hcf106:  mttA/Hcf  22.6      81  0.0018   21.9   2.3   20  154-177     1-20  (53)
 35 PRK13461 F0F1 ATP synthase sub  22.3      59  0.0013   26.0   1.7   22  155-176     8-29  (159)
 36 KOG2927 Membrane component of   22.0      57  0.0012   31.5   1.9   20  156-175   232-251 (372)
 37 COG1972 NupC Nucleoside permea  21.9      80  0.0017   30.8   2.8   25  148-172    86-110 (404)
 38 PF12955 DUF3844:  Domain of un  21.7      82  0.0018   25.3   2.4   25  151-175    67-91  (103)
 39 PRK09174 F0F1 ATP synthase sub  21.6      72  0.0016   27.4   2.2   14  159-172    55-68  (204)
 40 PF03918 CcmH:  Cytochrome C bi  21.6      31 0.00067   28.5   0.0   26  148-173    98-123 (148)
 41 TIGR03147 cyt_nit_nrfF cytochr  21.5      72  0.0016   26.3   2.1   21  149-169    99-119 (126)
 42 PRK03625 tatE twin arginine tr  21.2      81  0.0018   23.5   2.1   21  153-177     3-23  (67)
 43 PRK12785 fliL flagellar basal   21.1      44 0.00095   27.7   0.8    9  168-176    41-49  (166)
 44 MTH00119 CYTB cytochrome b; Pr  21.0 1.4E+02   0.003   28.1   4.1   24  173-196   245-272 (380)
 45 PF14257 DUF4349:  Domain of un  20.7      84  0.0018   27.0   2.4   23  134-156   210-232 (262)
 46 TIGR00998 8a0101 efflux pump m  20.3      93   0.002   26.8   2.7   31  153-183     4-35  (334)
 47 KOG2365 Uncharacterized membra  20.2      72  0.0016   33.3   2.2   32  145-176   740-776 (808)
 48 PRK08476 F0F1 ATP synthase sub  20.0      90  0.0019   25.0   2.3   19  157-175     7-25  (141)
 49 COG1862 YajC Preprotein transl  20.0      83  0.0018   24.8   2.1   18  151-168     7-24  (97)

No 1  
>PRK14472 F0F1 ATP synthase subunit B; Provisional
Probab=76.71  E-value=2  Score=35.10  Aligned_cols=33  Identities=21%  Similarity=0.512  Sum_probs=18.2

Q ss_pred             HHHhhcceeehh----hhHHHHHHHHHHHHhhhhccC
Q 028172          144 LLLTLGGTFFLG----FWPLILVTVGFFSALYFYFGP  176 (212)
Q Consensus       144 ~LL~lG~tfFl~----F~PlI~v~~~~F~a~Y~~fG~  176 (212)
                      +.|.-||.|.+-    ||-+|...+++|...||+|+|
T Consensus         6 ~~~~~~~~~~~~~~~~~~~~i~Flil~~lL~~~l~kp   42 (175)
T PRK14472          6 IILLSGGLLSPNPGLIFWTAVTFVIVLLILKKIAWGP   42 (175)
T ss_pred             hhhhcCCccCCCHHHHHHHHHHHHHHHHHHHHHhHHH
Confidence            445667755443    455555555555555666655


No 2  
>PF09188 DUF1951:  Domain of unknown function (DUF1951);  InterPro: IPR015271 Members of this family of Mycoplasma hypothetical proteins adopt a multi-helical structure that contains a buried central helix. Their function has not, as yet, been determined. ; PDB: 1TM9_A.
Probab=54.62  E-value=7.2  Score=32.81  Aligned_cols=60  Identities=27%  Similarity=0.428  Sum_probs=30.5

Q ss_pred             ccchhHHHH-HhhhhhccCccCcchhHHHHHhhc--ceeehhhhHHHHHHHHHHHHhhhhccCccccCCCCC
Q 028172          117 DKSLADQRE-RSMALNSEGLEGLVPRAKLLLTLG--GTFFLGFWPLILVTVGFFSALYFYFGPTFVHDASNS  185 (212)
Q Consensus       117 ~r~~~~QRe-RSmALNSEGLEGLiPRAk~LL~lG--~tfFl~F~PlI~v~~~~F~a~Y~~fG~~FiH~g~~~  185 (212)
                      -.++.+|-+ |-.+.|+         .+-|.+.|  |-..++|.--=--+...||..||+|--+|.||.++.
T Consensus        54 ~~nE~~q~~~~k~~inn---------~~T~~tv~~~~q~v~S~Fstn~e~~~~FC~~YfLy~~~F~~D~nkk  116 (137)
T PF09188_consen   54 IKNEPTQHEIRKFAINN---------IKTLSTVGEEGQYVASLFSTNKEIAIIFCLYYFLYHFSFLFDDNKK  116 (137)
T ss_dssp             S-SHHHHHHHHHHHHHH---------HHHHTT--SS---STHHHHS-HHHHHHHHHHHHHHHTT-S-----S
T ss_pred             HhcCchHHHHHHHHHHH---------HHHHHHhhhhHHHHHHHHhcCchHHHHHHHHHHHHHhhccccchHH
Confidence            335666665 6666665         46666666  334455543222233469999999999999999875


No 3  
>PF00430 ATP-synt_B:  ATP synthase B/B' CF(0);  InterPro: IPR002146 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   F-ATPases (also known as F1F0-ATPase, or H(+)-transporting two-sector ATPase) (3.6.3.14 from EC) are composed of two linked complexes: the F1 ATPase complex is the catalytic core and is composed of 5 subunits (alpha, beta, gamma, delta, epsilon), while the F0 ATPase complex is the membrane-embedded proton channel that is composed of at least 3 subunits (A-C), nine in mitochondria (A-G, F6, F8). Both the F1 and F0 complexes are rotary motors that are coupled back-to-back. In the F1 complex, the central gamma subunit forms the rotor inside the cylinder made of the alpha(3)beta(3) subunits, while in the F0 complex, the ring-shaped C subunits forms the rotor. The two rotors rotate in opposite directions, but the F0 rotor is usually stronger, using the force from the proton gradient to push the F1 rotor in reverse in order to drive ATP synthesis []. These ATPases can also work in reverse to hydrolyse ATP to create a proton gradient. This entry represents subunits B and B' from the F0 complex in F-ATPases found in chloroplasts and in bacterial plasma membranes. The B subunits are part of the peripheral stalk that links the F1 and F0 complexes together, and which acts as a stator to prevent certain subunits from rotating with the central rotary element. The peripheral stalk differs in subunit composition between mitochondrial, chloroplast and bacterial F-ATPases. In bacterial and chloroplast F-ATPases, the peripheral stalk is composed of one copy of the delta subunit (homologous to OSCP in mitochondria), and two copies of subunit B in bacteria, or one copy each of subunits B and B' in chloroplasts and photosynthetic bacteria []. More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0015078 hydrogen ion transmembrane transporter activity, 0015986 ATP synthesis coupled proton transport, 0045263 proton-transporting ATP synthase complex, coupling factor F(o); PDB: 1L2P_A 2KHK_A 1B9U_A.
Probab=53.77  E-value=9.5  Score=28.64  Aligned_cols=21  Identities=38%  Similarity=0.757  Sum_probs=16.7

Q ss_pred             hhHHHHHHHHHHHHhhhhccC
Q 028172          156 FWPLILVTVGFFSALYFYFGP  176 (212)
Q Consensus       156 F~PlI~v~~~~F~a~Y~~fG~  176 (212)
                      ||-+|..++++|+.-||+|+|
T Consensus         3 ~~~~i~Flil~~~l~~~~~~p   23 (132)
T PF00430_consen    3 FWQLINFLILFFLLNKFLYKP   23 (132)
T ss_dssp             HHHHHHHHHHHHHHHHHTHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            677788888888888888876


No 4  
>PF06024 DUF912:  Nucleopolyhedrovirus protein of unknown function (DUF912);  InterPro: IPR009261 This entry is represented by Autographa californica nuclear polyhedrosis virus (AcMNPV), Orf78; it is a family of uncharacterised viral proteins.
Probab=52.82  E-value=12  Score=28.79  Aligned_cols=42  Identities=12%  Similarity=0.350  Sum_probs=27.3

Q ss_pred             hcceeehhhhHHHHHHHHHHHHhhhhccCccccCCCCCCCCCCCCC
Q 028172          148 LGGTFFLGFWPLILVTVGFFSALYFYFGPTFVHDASNSPMSPAQYG  193 (212)
Q Consensus       148 lG~tfFl~F~PlI~v~~~~F~a~Y~~fG~~FiH~g~~~~~~pp~Yi  193 (212)
                      .+...+++...+++++|++++..||+.    +-+..+.....|.||
T Consensus        60 ~~~iili~lls~v~IlVily~IyYFVI----LRer~~~~~~~p~~~  101 (101)
T PF06024_consen   60 NGNIILISLLSFVCILVILYAIYYFVI----LRERQKSIRNQPSFM  101 (101)
T ss_pred             cccchHHHHHHHHHHHHHHhhheEEEE----EecccccccCCCCcC
Confidence            355667777788888888877777653    445555555566664


No 5  
>PRK13453 F0F1 ATP synthase subunit B; Provisional
Probab=49.65  E-value=12  Score=30.80  Aligned_cols=25  Identities=16%  Similarity=0.121  Sum_probs=15.9

Q ss_pred             eehhhhHHHHHHHHHHHHhhhhccC
Q 028172          152 FFLGFWPLILVTVGFFSALYFYFGP  176 (212)
Q Consensus       152 fFl~F~PlI~v~~~~F~a~Y~~fG~  176 (212)
                      .+..||-+|..++++|..-||+|+|
T Consensus        18 ~~t~~~~iInFliL~~lL~~~l~~p   42 (173)
T PRK13453         18 WGTVIVTVLTFIVLLALLKKFAWGP   42 (173)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3455666666666666666777765


No 6  
>PF09451 ATG27:  Autophagy-related protein 27;  InterPro: IPR018939 Autophagy is a degradative transport pathway that delivers cytosolic proteins to the lysosome (vacuole) [] and is induced by starvation []. Cytosolic proteins appear inside the vacuole enclosed in autophagic vesicles. Autophagy significantly differs from other transport pathways by using double membrane layered transport intermediates, called autophagosomes [, ]. The breakdown of vesicular transport intermediates is a unique feature of autophagy []. Autophagy can also function in the elimination of invading bacteria and antigens []. There are more than 25 AuTophaGy-related (ATG) genes that are essential for autophagy, although it is still not known how the autophagosome is made. Atg9 is a potential membrane carrier to deliver lipids that are used to form the vesicle. Atg27 is another transmembrane protein, and is a cycling protein []. It acts as an effector of VPS34 phosphatidylinositol 3-phosphate kinase signalling and regulates the cytoplasm to vacuole transport (Cvt) vesicle formation. It is also required for autophagy-dependent cycling of ATG9. 
Probab=49.41  E-value=14  Score=32.49  Aligned_cols=22  Identities=23%  Similarity=0.413  Sum_probs=15.9

Q ss_pred             HHHHHHHHhhhhccCccccCCC
Q 028172          162 VTVGFFSALYFYFGPTFVHDAS  183 (212)
Q Consensus       162 v~~~~F~a~Y~~fG~~FiH~g~  183 (212)
                      +++.+|.++||.||.-+=|-.-
T Consensus       208 i~~~l~~~~Y~i~g~~~n~~~~  229 (268)
T PF09451_consen  208 IILFLFLAAYLIFGSWYNYNRY  229 (268)
T ss_pred             HHHHHHHHHHhhhhhheeeccC
Confidence            3445556999999998876553


No 7  
>TIGR00869 sec62 protein translocation protein, Sec62 family. protein secretary systems of yeast microsomes. They are also the non-selective cation (NS) channels of the mammalian cytoplasmic membrane. The yeast Sec62 protein has been shown to be essential for cell growth. The mammalian NS channel proteins has been implicated in platelet derived growth factor(PGDF) dependent single channel current in fibroblasts. These channels are essentially closed in serum deprived tissue-culture cells and are specifically opened by exposure to PDGF. These channels are reported to exhibit equal selectivity for Na+, K+ and Cs+ with low permeability to Ca2+, and no permeability to anions.
Probab=47.65  E-value=14  Score=33.22  Aligned_cols=34  Identities=21%  Similarity=0.452  Sum_probs=23.9

Q ss_pred             HHhhcceeehh-hhHHHHHHHHHHHHhhhhccCcc
Q 028172          145 LLTLGGTFFLG-FWPLILVTVGFFSALYFYFGPTF  178 (212)
Q Consensus       145 LL~lG~tfFl~-F~PlI~v~~~~F~a~Y~~fG~~F  178 (212)
                      -|+.|+..|+| |.=++++=..+|+++|+..|..|
T Consensus       149 YlS~~~lgll~~~~~laivRlilF~i~~~~~g~~f  183 (232)
T TIGR00869       149 YLSLGALGIIGGFFAVAILRLILFVLTLIVVKPGI  183 (232)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCe
Confidence            35666666665 44555666789999999988665


No 8  
>PRK07352 F0F1 ATP synthase subunit B; Validated
Probab=46.29  E-value=19  Score=29.36  Aligned_cols=20  Identities=25%  Similarity=0.097  Sum_probs=10.7

Q ss_pred             hHHHHHHHHHHHHhhhhccC
Q 028172          157 WPLILVTVGFFSALYFYFGP  176 (212)
Q Consensus       157 ~PlI~v~~~~F~a~Y~~fG~  176 (212)
                      |-+|-.++++|...||+|.|
T Consensus        24 ~~iinflIl~~lL~~fl~kp   43 (174)
T PRK07352         24 TNLINLAIVIGLLYYFGRGF   43 (174)
T ss_pred             HHHHHHHHHHHHHHHHhHHH
Confidence            44555555555555555554


No 9  
>PF04799 Fzo_mitofusin:  fzo-like conserved region;  InterPro: IPR006884 This entry represents the heptad repeat domain which is conserved at the C terminus of Fzo/mitofusion family of GTPases. Fzo is a mediator of mitochondrial fusion during spermatogenesis []. This conserved region is also found in the human mitofusin protein []. This domain forms a dimeric antiparallel coiled coil structure, which has been proposed to act as a mitochodrial tether before vesicle fusion [].; GO: 0003924 GTPase activity, 0006184 GTP catabolic process, 0008053 mitochondrial fusion, 0005741 mitochondrial outer membrane, 0016021 integral to membrane; PDB: 1T3J_A.
Probab=44.59  E-value=7.3  Score=33.61  Aligned_cols=19  Identities=32%  Similarity=0.719  Sum_probs=0.0

Q ss_pred             hhhHHHHHHHHHHHHhhhh
Q 028172          155 GFWPLILVTVGFFSALYFY  173 (212)
Q Consensus       155 ~F~PlI~v~~~~F~a~Y~~  173 (212)
                      .=|++|+++.++|.++|+|
T Consensus        44 vGWrvIa~~~~~Yg~lYlY   62 (171)
T PF04799_consen   44 VGWRVIAVSGSLYGGLYLY   62 (171)
T ss_dssp             -------------------
T ss_pred             hhHHHHHHHHHHHHHHHHH
Confidence            3499999999999999998


No 10 
>PRK09173 F0F1 ATP synthase subunit B; Validated
Probab=39.61  E-value=21  Score=28.52  Aligned_cols=18  Identities=17%  Similarity=0.534  Sum_probs=11.9

Q ss_pred             hhhHHHHHHHHHHHHhhh
Q 028172          155 GFWPLILVTVGFFSALYF  172 (212)
Q Consensus       155 ~F~PlI~v~~~~F~a~Y~  172 (212)
                      .||-+|..++.+|+..||
T Consensus         4 ~~w~~i~f~i~l~~l~~~   21 (159)
T PRK09173          4 TFWAFVGLVLFLALVVYL   21 (159)
T ss_pred             hHHHHHHHHHHHHHHHHH
Confidence            477777766666666666


No 11 
>PRK14473 F0F1 ATP synthase subunit B; Provisional
Probab=36.08  E-value=25  Score=28.27  Aligned_cols=25  Identities=24%  Similarity=0.190  Sum_probs=17.1

Q ss_pred             eehhhhHHHHHHHHHHHHhhhhccC
Q 028172          152 FFLGFWPLILVTVGFFSALYFYFGP  176 (212)
Q Consensus       152 fFl~F~PlI~v~~~~F~a~Y~~fG~  176 (212)
                      .++.||=+|..++++|..-||+|+|
T Consensus         8 ~~~~~~~~inflil~~lL~~fl~kp   32 (164)
T PRK14473          8 LGLLIAQLINFLLLIFLLRTFLYRP   32 (164)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3455666677777777777777776


No 12 
>PRK13454 F0F1 ATP synthase subunit B'; Provisional
Probab=35.38  E-value=29  Score=28.91  Aligned_cols=23  Identities=17%  Similarity=0.294  Sum_probs=14.8

Q ss_pred             hhhhHHHHHHHHHHHHhhhhccC
Q 028172          154 LGFWPLILVTVGFFSALYFYFGP  176 (212)
Q Consensus       154 l~F~PlI~v~~~~F~a~Y~~fG~  176 (212)
                      ..||-+|..++++|..-+|+|.|
T Consensus        33 q~~~~lI~F~iL~~ll~k~l~~P   55 (181)
T PRK13454         33 QIFWLLVTLVAIYFVLTRVALPR   55 (181)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            45676666666666666776664


No 13 
>COG3966 DltD Protein involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane]
Probab=34.86  E-value=25  Score=34.24  Aligned_cols=25  Identities=20%  Similarity=0.320  Sum_probs=17.9

Q ss_pred             hhhhHHHHHHHHHHHHhhhhccCccccC
Q 028172          154 LGFWPLILVTVGFFSALYFYFGPTFVHD  181 (212)
Q Consensus       154 l~F~PlI~v~~~~F~a~Y~~fG~~FiH~  181 (212)
                      +.|||||+++++|+.+++   +|+=+|.
T Consensus         5 ~~fGPlliA~alf~~~if---~Pss~~~   29 (415)
T COG3966           5 MIFGPLLIAFALFILLIF---LPSSWFT   29 (415)
T ss_pred             cchhHHHHHHHHHHHHHH---hhhHHhh
Confidence            579999999988877665   4544443


No 14 
>PRK13460 F0F1 ATP synthase subunit B; Provisional
Probab=34.39  E-value=29  Score=28.37  Aligned_cols=22  Identities=18%  Similarity=0.277  Sum_probs=11.6

Q ss_pred             hhhHHHHHHHHHHHHhhhhccC
Q 028172          155 GFWPLILVTVGFFSALYFYFGP  176 (212)
Q Consensus       155 ~F~PlI~v~~~~F~a~Y~~fG~  176 (212)
                      .||-+|...+++|..-||+|+|
T Consensus        19 ~~~~~i~Flil~~iL~~~~~kp   40 (173)
T PRK13460         19 VVWTLVTFLVVVLVLKKFAWDV   40 (173)
T ss_pred             HHHHHHHHHHHHHHHHHHhHHH
Confidence            3444454555555555666654


No 15 
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=34.22  E-value=23  Score=27.78  Aligned_cols=16  Identities=25%  Similarity=0.266  Sum_probs=7.2

Q ss_pred             eehhhhHHHHHHHHHH
Q 028172          152 FFLGFWPLILVTVGFF  167 (212)
Q Consensus       152 fFl~F~PlI~v~~~~F  167 (212)
                      +|+.|.-+|++++++|
T Consensus         4 l~~iii~~i~l~~~~~   19 (130)
T PF12273_consen    4 LFAIIIVAILLFLFLF   19 (130)
T ss_pred             eHHHHHHHHHHHHHHH
Confidence            4444444444444443


No 16 
>PRK13460 F0F1 ATP synthase subunit B; Provisional
Probab=31.78  E-value=35  Score=27.84  Aligned_cols=27  Identities=22%  Similarity=0.300  Sum_probs=17.5

Q ss_pred             cceeehhhhH-HHHHHHHHHHHhhhhcc
Q 028172          149 GGTFFLGFWP-LILVTVGFFSALYFYFG  175 (212)
Q Consensus       149 G~tfFl~F~P-lI~v~~~~F~a~Y~~fG  175 (212)
                      ||.=.|.|+| .+++.++.|+.+|+++.
T Consensus         7 ~~~~~l~~~~~~~~~~~i~Flil~~iL~   34 (173)
T PRK13460          7 KGLSLLDVNPGLVVWTLVTFLVVVLVLK   34 (173)
T ss_pred             CCCCccCCcHhHHHHHHHHHHHHHHHHH
Confidence            4433444454 77777888888887653


No 17 
>PF06210 DUF1003:  Protein of unknown function (DUF1003);  InterPro: IPR010406 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=30.70  E-value=39  Score=26.81  Aligned_cols=35  Identities=17%  Similarity=0.424  Sum_probs=20.0

Q ss_pred             hhhHHHHHHHHHHHHhhhhccCccccCCCCCCCCCCCCC
Q 028172          155 GFWPLILVTVGFFSALYFYFGPTFVHDASNSPMSPAQYG  193 (212)
Q Consensus       155 ~F~PlI~v~~~~F~a~Y~~fG~~FiH~g~~~~~~pp~Yi  193 (212)
                      |=|+||++.+++| ++|+....-++..   .+..|+|||
T Consensus         2 GS~~Fi~~~~~~~-~~Wi~~N~~~~~~---~~fDpyPFi   36 (108)
T PF06210_consen    2 GSWTFIIIFTVFL-AVWILLNILAPPR---PAFDPYPFI   36 (108)
T ss_pred             CcHHHHHHHHHHH-HHHHHHHhhcccc---CCCCCccHH
Confidence            4588888776655 4555555443333   234666654


No 18 
>PRK13455 F0F1 ATP synthase subunit B; Provisional
Probab=28.02  E-value=52  Score=27.04  Aligned_cols=20  Identities=15%  Similarity=0.070  Sum_probs=10.8

Q ss_pred             hhHHHHHHHHHHHHhhhhcc
Q 028172          156 FWPLILVTVGFFSALYFYFG  175 (212)
Q Consensus       156 F~PlI~v~~~~F~a~Y~~fG  175 (212)
                      ||-.|..++++|...||+++
T Consensus        30 ~~~~inflil~~iL~~f~~~   49 (184)
T PRK13455         30 FVVTLAFLLFIGILVYFKVP   49 (184)
T ss_pred             HHHHHHHHHHHHHHHHHhcc
Confidence            35555555555555555444


No 19 
>CHL00118 atpG ATP synthase CF0 B' subunit; Validated
Probab=27.02  E-value=44  Score=26.89  Aligned_cols=20  Identities=5%  Similarity=0.009  Sum_probs=10.3

Q ss_pred             hHHHHHHHHHHHHhhhhccC
Q 028172          157 WPLILVTVGFFSALYFYFGP  176 (212)
Q Consensus       157 ~PlI~v~~~~F~a~Y~~fG~  176 (212)
                      |=+|...+.+|..-+|+|+|
T Consensus        27 ~~~inFliL~~lL~k~l~~P   46 (156)
T CHL00118         27 LMALQFLLLMVLLNIILYKP   46 (156)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
Confidence            44444444444555666665


No 20 
>KOG4452 consensus Predicted membrane protein [Function unknown]
Probab=26.91  E-value=37  Score=26.32  Aligned_cols=25  Identities=36%  Similarity=0.701  Sum_probs=15.4

Q ss_pred             HHHhhcceeehhhhHHHHHHHHHHHHhh
Q 028172          144 LLLTLGGTFFLGFWPLILVTVGFFSALY  171 (212)
Q Consensus       144 ~LL~lG~tfFl~F~PlI~v~~~~F~a~Y  171 (212)
                      +|+++-...|+||+-   ++..+.+++|
T Consensus        54 LlIsl~aSvFlGFG~---vFLLLwVGIY   78 (79)
T KOG4452|consen   54 LLISLTASVFLGFGS---VFLLLWVGIY   78 (79)
T ss_pred             HHHHHHHHHHHhhhH---HHHHHHHhhc
Confidence            456677777888774   3344555555


No 21 
>PRK06569 F0F1 ATP synthase subunit B'; Validated
Probab=26.65  E-value=54  Score=27.71  Aligned_cols=19  Identities=21%  Similarity=0.560  Sum_probs=10.4

Q ss_pred             hhHHHHHHHHHHHHhhhhc
Q 028172          156 FWPLILVTVGFFSALYFYF  174 (212)
Q Consensus       156 F~PlI~v~~~~F~a~Y~~f  174 (212)
                      |+..|+.+++.|+++|+++
T Consensus         9 ~~sqifw~iI~FlILy~ll   27 (155)
T PRK06569          9 YYSQIFWLIVTFGLLYIFV   27 (155)
T ss_pred             hhHHHHHHHHHHHHHHHHH
Confidence            4445555555556655554


No 22 
>PF06692 MNSV_P7B:  Melon necrotic spot virus P7B protein;  InterPro: IPR009575 This family consists of several Melon necrotic spot virus (MNSV) P7B proteins. The function of this family is unknown.
Probab=25.70  E-value=75  Score=23.73  Aligned_cols=28  Identities=36%  Similarity=0.413  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHHhhhh--ccCccccCCCCCC
Q 028172          159 LILVTVGFFSALYFY--FGPTFVHDASNSP  186 (212)
Q Consensus       159 lI~v~~~~F~a~Y~~--fG~~FiH~g~~~~  186 (212)
                      ||++++.+|..+|++  =|++++|.-++..
T Consensus        18 Liliis~~f~lI~~l~qq~~~y~HH~d~Ss   47 (61)
T PF06692_consen   18 LILIISFVFFLITSLGQQGNTYVHHFDNSS   47 (61)
T ss_pred             HHHHHHHHHHHHhhhccCCCeeEEeecCcc
Confidence            344555556555554  3678999877653


No 23 
>PF14162 YozD:  YozD-like protein
Probab=25.34  E-value=49  Score=24.39  Aligned_cols=16  Identities=44%  Similarity=0.825  Sum_probs=13.6

Q ss_pred             hhhHHHHHHcCCCCCC
Q 028172           66 SLFMKELKRRGMTPTS   81 (212)
Q Consensus        66 SlF~KELkRRGmap~S   81 (212)
                      .-|-+||.|||.-|+-
T Consensus        15 efFy~eL~kRGyvP~e   30 (57)
T PF14162_consen   15 EFFYHELVKRGYVPTE   30 (57)
T ss_pred             HHHHHHHHHccCCCcH
Confidence            4689999999998864


No 24 
>PRK08476 F0F1 ATP synthase subunit B'; Validated
Probab=24.50  E-value=55  Score=26.20  Aligned_cols=22  Identities=5%  Similarity=0.100  Sum_probs=12.5

Q ss_pred             hhhHHHHHHHHHHHHhhhhccC
Q 028172          155 GFWPLILVTVGFFSALYFYFGP  176 (212)
Q Consensus       155 ~F~PlI~v~~~~F~a~Y~~fG~  176 (212)
                      .+|=+|...+++|..-.|+|+|
T Consensus        10 ~~~qli~Flil~~~l~kfl~kP   31 (141)
T PRK08476         10 MLATFVVFLLLIVILNSWLYKP   31 (141)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            4455555555555555666665


No 25 
>COG3462 Predicted membrane protein [Function unknown]
Probab=24.46  E-value=55  Score=27.14  Aligned_cols=30  Identities=17%  Similarity=0.372  Sum_probs=21.4

Q ss_pred             hhHHHHHHHHHHHHhhhhccCccccCCCCC
Q 028172          156 FWPLILVTVGFFSALYFYFGPTFVHDASNS  185 (212)
Q Consensus       156 F~PlI~v~~~~F~a~Y~~fG~~FiH~g~~~  185 (212)
                      +-|+..++|.+|..++.|+=--=+|+|+.+
T Consensus        52 ImpI~~~vvli~lvvfm~~~~g~~r~~~~~   81 (117)
T COG3462          52 IMPIFWAVVLIFLVVFMFYILGAVRRGSDD   81 (117)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhcccchh
Confidence            558888888877777777655567778764


No 26 
>COG2886 Uncharacterized small protein [Function unknown]
Probab=24.37  E-value=48  Score=25.91  Aligned_cols=17  Identities=29%  Similarity=0.485  Sum_probs=13.7

Q ss_pred             hhhhHHHHHHcCCCCCC
Q 028172           65 ESLFMKELKRRGMTPTS   81 (212)
Q Consensus        65 ESlF~KELkRRGmap~S   81 (212)
                      --.|++||++||..+-+
T Consensus        55 l~ef~~eL~~R~i~l~~   71 (88)
T COG2886          55 LNEFEEELRKRGIPLYD   71 (88)
T ss_pred             HHHHHHHHHHhCCCccc
Confidence            35799999999996654


No 27 
>PRK14471 F0F1 ATP synthase subunit B; Provisional
Probab=24.07  E-value=55  Score=26.27  Aligned_cols=23  Identities=30%  Similarity=0.527  Sum_probs=13.8

Q ss_pred             hhhhHHHHHHHHHHHHhhhhccC
Q 028172          154 LGFWPLILVTVGFFSALYFYFGP  176 (212)
Q Consensus       154 l~F~PlI~v~~~~F~a~Y~~fG~  176 (212)
                      ..||=+|..++++|..-+|+|+|
T Consensus        10 ~~~~~~i~Flil~~ll~~~l~~p   32 (164)
T PRK14471         10 LFFWQTILFLILLLLLAKFAWKP   32 (164)
T ss_pred             HHHHHHHHHHHHHHHHHHHhHHH
Confidence            44555565566666666666665


No 28 
>PRK07021 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=24.00  E-value=89  Score=25.50  Aligned_cols=16  Identities=6%  Similarity=0.183  Sum_probs=10.6

Q ss_pred             HHHHHHHHHhhhhccC
Q 028172          161 LVTVGFFSALYFYFGP  176 (212)
Q Consensus       161 ~v~~~~F~a~Y~~fG~  176 (212)
                      ++..+.+.+.|||++.
T Consensus        27 ~l~~~g~gg~~~~~~~   42 (162)
T PRK07021         27 LLAAAAGAGYSWWLSK   42 (162)
T ss_pred             HHHHHHHHHHHHHhhc
Confidence            3344457788888876


No 29 
>PRK14475 F0F1 ATP synthase subunit B; Provisional
Probab=23.23  E-value=56  Score=26.59  Aligned_cols=19  Identities=16%  Similarity=0.135  Sum_probs=10.8

Q ss_pred             hhHHHHHHHHHHHHhhhhc
Q 028172          156 FWPLILVTVGFFSALYFYF  174 (212)
Q Consensus       156 F~PlI~v~~~~F~a~Y~~f  174 (212)
                      ||-+|..++++|..+|+.|
T Consensus        12 ~w~~i~f~il~~iL~~~k~   30 (167)
T PRK14475         12 FWVGAGLLIFFGILIALKV   30 (167)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            6766655555555554544


No 30 
>PRK06568 F0F1 ATP synthase subunit B; Validated
Probab=23.17  E-value=62  Score=27.10  Aligned_cols=22  Identities=9%  Similarity=0.116  Sum_probs=15.3

Q ss_pred             hhhHHHHHHHHHHHHhhhhccC
Q 028172          155 GFWPLILVTVGFFSALYFYFGP  176 (212)
Q Consensus       155 ~F~PlI~v~~~~F~a~Y~~fG~  176 (212)
                      .||-+|..++++|..-.|.|||
T Consensus         7 ~fwq~I~FlIll~ll~kfawkP   28 (154)
T PRK06568          7 SFWLAVSFVIFVYLIYRPAKKA   28 (154)
T ss_pred             HHHHHHHHHHHHHHHHHHhHHH
Confidence            4787777777777766666665


No 31 
>PF09753 Use1:  Membrane fusion protein Use1;  InterPro: IPR019150  This entry represents a family of proteins, approximately 300 residues in length, involved in vesicle transport. They have a single C-terminal transmembrane domain and a SNARE [soluble NSF (N-ethylmaleimide-sensitive fusion protein) attachment protein receptor] domain of approximately 60 residues. The SNARE domains are essential for membrane fusion and are conserved from yeasts to humans. Use1 is one of the three protein subunits that make up the SNARE complex and it is specifically required for Golgi-endoplasmic reticulum retrograde transport []. 
Probab=23.05  E-value=88  Score=27.02  Aligned_cols=46  Identities=17%  Similarity=0.192  Sum_probs=30.4

Q ss_pred             HhhhhhccCccCcchhHHHHHhhcceeehhhhHHHHHHHHHHHHhhhh
Q 028172          126 RSMALNSEGLEGLVPRAKLLLTLGGTFFLGFWPLILVTVGFFSALYFY  173 (212)
Q Consensus       126 RSmALNSEGLEGLiPRAk~LL~lG~tfFl~F~PlI~v~~~~F~a~Y~~  173 (212)
                      ..+.=|..+|..-=-|.+...+.++.  ..+|=+|++++++|.+.|++
T Consensus       202 ~~~d~n~~~l~~~~~rl~~~~~~~~~--~~~~~~i~~v~~~Fi~mvl~  247 (251)
T PF09753_consen  202 EGLDRNLSSLKRESKRLKEHSSKSWG--CWTWLMIFVVIIVFIMMVLF  247 (251)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhccc--HHHHHHHHHHHHHHHHHHHH
Confidence            44555677777777788888876666  34444666666667777665


No 32 
>COG4736 CcoQ Cbb3-type cytochrome oxidase, subunit 3 [Posttranslational modification, protein turnover, chaperones]
Probab=22.95  E-value=84  Score=23.09  Aligned_cols=24  Identities=29%  Similarity=0.627  Sum_probs=19.4

Q ss_pred             hhhhHHHHHHHHHHHHhhhhccCc
Q 028172          154 LGFWPLILVTVGFFSALYFYFGPT  177 (212)
Q Consensus       154 l~F~PlI~v~~~~F~a~Y~~fG~~  177 (212)
                      .-+|=+|+.+..|.+++|+.|.+.
T Consensus        10 a~a~~t~~~~l~fiavi~~ayr~~   33 (60)
T COG4736          10 ADAWGTIAFTLFFIAVIYFAYRPG   33 (60)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhccc
Confidence            446677888888889999999885


No 33 
>PLN03156 GDSL esterase/lipase; Provisional
Probab=22.91  E-value=73  Score=29.00  Aligned_cols=33  Identities=24%  Similarity=0.401  Sum_probs=26.2

Q ss_pred             eehhhhHHHHHHHHHHHH------hhhhccCccccCCCC
Q 028172          152 FFLGFWPLILVTVGFFSA------LYFYFGPTFVHDASN  184 (212)
Q Consensus       152 fFl~F~PlI~v~~~~F~a------~Y~~fG~~FiH~g~~  184 (212)
                      .||.|.-+|+.++....+      -.|.||.|.+--|..
T Consensus         5 ~~~~~~~~~~~~~~~~~~~~~~~~aifvFGDSl~D~GN~   43 (351)
T PLN03156          5 LFLIFFLLLAQLLVLVAETCAKVPAIIVFGDSSVDAGNN   43 (351)
T ss_pred             hhhHHHHHHHHHHHHHhcccCCCCEEEEecCcCccCCCc
Confidence            477888888888887763      268999999999974


No 34 
>PF02416 MttA_Hcf106:  mttA/Hcf106 family;  InterPro: IPR003369 Members of this protein family are involved in a sec-independent translocation mechanism. This pathway has been called the DeltapH pathway in chloroplasts []. Members of this family in Escherichia coli are involved in export of redox proteins with a "twin arginine" leader motif (S/T-R-R-X-F-L-K) []. This sec-independent pathway is termed TAT for twin-arginine translocation system. This system mainly transports proteins with bound cofactors that require folding prior to export.; GO: 0008565 protein transporter activity, 0015031 protein transport; PDB: 2L16_A.
Probab=22.62  E-value=81  Score=21.94  Aligned_cols=20  Identities=35%  Similarity=0.756  Sum_probs=10.8

Q ss_pred             hhhhHHHHHHHHHHHHhhhhccCc
Q 028172          154 LGFWPLILVTVGFFSALYFYFGPT  177 (212)
Q Consensus       154 l~F~PlI~v~~~~F~a~Y~~fG~~  177 (212)
                      +|+|=++++.++++    ++|||+
T Consensus         1 ig~~El~iI~vval----llfGp~   20 (53)
T PF02416_consen    1 IGFPELLIILVVAL----LLFGPK   20 (53)
T ss_dssp             S-HHHHHHHHHHHH----HHS-TT
T ss_pred             CCHHHHHHHHHHHH----HHhCch
Confidence            35666666655443    478875


No 35 
>PRK13461 F0F1 ATP synthase subunit B; Provisional
Probab=22.29  E-value=59  Score=25.97  Aligned_cols=22  Identities=14%  Similarity=0.158  Sum_probs=13.6

Q ss_pred             hhhHHHHHHHHHHHHhhhhccC
Q 028172          155 GFWPLILVTVGFFSALYFYFGP  176 (212)
Q Consensus       155 ~F~PlI~v~~~~F~a~Y~~fG~  176 (212)
                      .||=+|..++++|..-||+|+|
T Consensus         8 ~~~~~inF~il~~iL~~f~~kp   29 (159)
T PRK13461          8 IIATIINFIILLLILKHFFFDK   29 (159)
T ss_pred             HHHHHHHHHHHHHHHHHHhHHH
Confidence            4555565566666666777765


No 36 
>KOG2927 consensus Membrane component of ER protein translocation complex [Intracellular trafficking, secretion, and vesicular transport]
Probab=22.00  E-value=57  Score=31.48  Aligned_cols=20  Identities=20%  Similarity=0.365  Sum_probs=14.5

Q ss_pred             hhHHHHHHHHHHHHhhhhcc
Q 028172          156 FWPLILVTVGFFSALYFYFG  175 (212)
Q Consensus       156 F~PlI~v~~~~F~a~Y~~fG  175 (212)
                      |.-|.+|=..+|+++|++.|
T Consensus       232 IlvLaIvRlILF~I~~il~~  251 (372)
T KOG2927|consen  232 ILVLAIVRLILFGITWILTG  251 (372)
T ss_pred             HHHHHHHHHHHHHHHHHHhC
Confidence            44444555678999999888


No 37 
>COG1972 NupC Nucleoside permease [Nucleotide transport and metabolism]
Probab=21.93  E-value=80  Score=30.81  Aligned_cols=25  Identities=28%  Similarity=0.495  Sum_probs=22.9

Q ss_pred             hcceeehhhhHHHHHHHHHHHHhhh
Q 028172          148 LGGTFFLGFWPLILVTVGFFSALYF  172 (212)
Q Consensus       148 lG~tfFl~F~PlI~v~~~~F~a~Y~  172 (212)
                      -|..||+--+|-|+.++++++.+|-
T Consensus        86 ~gf~Fa~~VL~~IiF~saLi~iLyy  110 (404)
T COG1972          86 AGFIFAFRVLPPIIFISALISILYY  110 (404)
T ss_pred             CceeeeHHhhhHHHHHHHHHHHHHH
Confidence            5789999999999999999999984


No 38 
>PF12955 DUF3844:  Domain of unknown function (DUF3844);  InterPro: IPR024382 This presumed domain is found in fungal species. It contains 8 largely conserved cysteine residues. This domain is found in proteins thought to be located in the endoplasmic reticulum.
Probab=21.68  E-value=82  Score=25.29  Aligned_cols=25  Identities=24%  Similarity=0.142  Sum_probs=20.3

Q ss_pred             eeehhhhHHHHHHHHHHHHhhhhcc
Q 028172          151 TFFLGFWPLILVTVGFFSALYFYFG  175 (212)
Q Consensus       151 tfFl~F~PlI~v~~~~F~a~Y~~fG  175 (212)
                      -|+|.+|=-|++++++-.++.++|.
T Consensus        67 ~F~L~~~~ti~lv~~~~~~I~lL~s   91 (103)
T PF12955_consen   67 PFWLFAGFTIALVVLVAGAIGLLFS   91 (103)
T ss_pred             hhhHHHHHHHHHHHHHHHHHHHHHH
Confidence            4788888888888888888888874


No 39 
>PRK09174 F0F1 ATP synthase subunit B'; Validated
Probab=21.60  E-value=72  Score=27.43  Aligned_cols=14  Identities=21%  Similarity=0.304  Sum_probs=5.6

Q ss_pred             HHHHHHHHHHHhhh
Q 028172          159 LILVTVGFFSALYF  172 (212)
Q Consensus       159 lI~v~~~~F~a~Y~  172 (212)
                      -|+.+++.|.++|+
T Consensus        55 ~l~w~~I~FliL~~   68 (204)
T PRK09174         55 QLLWLAITFGLFYL   68 (204)
T ss_pred             HHHHHHHHHHHHHH
Confidence            33333334444443


No 40 
>PF03918 CcmH:  Cytochrome C biogenesis protein;  InterPro: IPR005616 Members of this family include NrfF, CcmH, CycL, Ccl2.; PDB: 2KW0_A 2HL7_A.
Probab=21.58  E-value=31  Score=28.53  Aligned_cols=26  Identities=23%  Similarity=0.218  Sum_probs=0.0

Q ss_pred             hcceeehhhhHHHHHHHHHHHHhhhh
Q 028172          148 LGGTFFLGFWPLILVTVGFFSALYFY  173 (212)
Q Consensus       148 lG~tfFl~F~PlI~v~~~~F~a~Y~~  173 (212)
                      -|.|.+|-++|++++.++++.+.+..
T Consensus        98 ~~~~~~lW~~P~~~l~~g~~~~~~~~  123 (148)
T PF03918_consen   98 KGFTWLLWLGPFLLLLLGGALLFRRL  123 (148)
T ss_dssp             --------------------------
T ss_pred             CccHHHHHHHHHHHHHHHHHHHHHHH
Confidence            47899999999999988887766543


No 41 
>TIGR03147 cyt_nit_nrfF cytochrome c nitrite reductase, accessory protein NrfF.
Probab=21.49  E-value=72  Score=26.29  Aligned_cols=21  Identities=24%  Similarity=0.407  Sum_probs=16.9

Q ss_pred             cceeehhhhHHHHHHHHHHHH
Q 028172          149 GGTFFLGFWPLILVTVGFFSA  169 (212)
Q Consensus       149 G~tfFl~F~PlI~v~~~~F~a  169 (212)
                      |.|.+|-++|++++.++++..
T Consensus        99 ~~t~~LW~~P~lll~~G~~~~  119 (126)
T TIGR03147        99 WQTLLLWLLPVLLLLLAFVLL  119 (126)
T ss_pred             cchHHHHHHHHHHHHHHHHHH
Confidence            678999999999987766543


No 42 
>PRK03625 tatE twin arginine translocase protein E; Validated
Probab=21.17  E-value=81  Score=23.46  Aligned_cols=21  Identities=19%  Similarity=0.308  Sum_probs=13.4

Q ss_pred             ehhhhHHHHHHHHHHHHhhhhccCc
Q 028172          153 FLGFWPLILVTVGFFSALYFYFGPT  177 (212)
Q Consensus       153 Fl~F~PlI~v~~~~F~a~Y~~fG~~  177 (212)
                      -+++|=+++|.+++    .++|||.
T Consensus         3 ~ig~~elliIlvI~----lllFGpk   23 (67)
T PRK03625          3 EISITKLLVVAALV----VLLFGTK   23 (67)
T ss_pred             CCcHHHHHHHHHHH----HHHcCcc
Confidence            46777666655443    3678885


No 43 
>PRK12785 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=21.07  E-value=44  Score=27.66  Aligned_cols=9  Identities=22%  Similarity=0.589  Sum_probs=6.2

Q ss_pred             HHhhhhccC
Q 028172          168 SALYFYFGP  176 (212)
Q Consensus       168 ~a~Y~~fG~  176 (212)
                      .+.||+|+.
T Consensus        41 ~g~~f~~~~   49 (166)
T PRK12785         41 GGGFFFFFS   49 (166)
T ss_pred             hheEEEEEe
Confidence            567777765


No 44 
>MTH00119 CYTB cytochrome b; Provisional
Probab=21.00  E-value=1.4e+02  Score=28.06  Aligned_cols=24  Identities=21%  Similarity=0.448  Sum_probs=15.4

Q ss_pred             hccCccccCC----CCCCCCCCCCCCcc
Q 028172          173 YFGPTFVHDA----SNSPMSPAQYGDPY  196 (212)
Q Consensus       173 ~fG~~FiH~g----~~~~~~pp~YidP~  196 (212)
                      .|.|.++++-    ...|..+|..|.||
T Consensus       245 ~~~P~~l~~p~n~~panp~~TP~~i~PE  272 (380)
T MTH00119        245 LFSPNLLGDPENFTPANPLVTPPHIKPE  272 (380)
T ss_pred             HhCCCcccCccccccCCCCCCCCCCCcc
Confidence            4557777764    22456677778775


No 45 
>PF14257 DUF4349:  Domain of unknown function (DUF4349)
Probab=20.69  E-value=84  Score=27.00  Aligned_cols=23  Identities=17%  Similarity=0.134  Sum_probs=16.4

Q ss_pred             CccCcchhHHHHHhhcceeehhh
Q 028172          134 GLEGLVPRAKLLLTLGGTFFLGF  156 (212)
Q Consensus       134 GLEGLiPRAk~LL~lG~tfFl~F  156 (212)
                      .-.++..+...-++-|...|..|
T Consensus       210 ~~~~~~~~~~~al~~~~~~~~~~  232 (262)
T PF14257_consen  210 ESPSFGSRFRDALKNGWNALVSF  232 (262)
T ss_pred             CCCCcchHHHHHHHHHHHHHHHH
Confidence            55688888887777777666555


No 46 
>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A).
Probab=20.34  E-value=93  Score=26.79  Aligned_cols=31  Identities=16%  Similarity=0.223  Sum_probs=16.1

Q ss_pred             ehhhhHHHHHHHHHHH-HhhhhccCccccCCC
Q 028172          153 FLGFWPLILVTVGFFS-ALYFYFGPTFVHDAS  183 (212)
Q Consensus       153 Fl~F~PlI~v~~~~F~-a~Y~~fG~~FiH~g~  183 (212)
                      |+.+|+++++++++++ ++|++++.+++-.+.
T Consensus         4 ~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~   35 (334)
T TIGR00998         4 FLLLLVVLLIVVAGAYAIYWFLVLRDYESTDD   35 (334)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHhcCceeeccc
Confidence            4444555555554444 555556666554433


No 47 
>KOG2365 consensus Uncharacterized membrane protein [Function unknown]
Probab=20.15  E-value=72  Score=33.28  Aligned_cols=32  Identities=41%  Similarity=0.780  Sum_probs=27.0

Q ss_pred             HHhhcceeehh-----hhHHHHHHHHHHHHhhhhccC
Q 028172          145 LLTLGGTFFLG-----FWPLILVTVGFFSALYFYFGP  176 (212)
Q Consensus       145 LL~lG~tfFl~-----F~PlI~v~~~~F~a~Y~~fG~  176 (212)
                      |--+||.++||     +||+|+-++.+|+-+|+..|-
T Consensus       740 LAIiGG~y~lgl~gaiiGpiilc~~~v~snIyl~~~~  776 (808)
T KOG2365|consen  740 LAIIGGVYLLGLVGAIIGPIILCFVMVFSNIYLLQGA  776 (808)
T ss_pred             ehhhccchhhhhhhhhhhhhHHHHHHHHHHHHHHhcc
Confidence            44578888876     799999999999999998764


No 48 
>PRK08476 F0F1 ATP synthase subunit B'; Validated
Probab=20.04  E-value=90  Score=24.98  Aligned_cols=19  Identities=26%  Similarity=0.189  Sum_probs=13.7

Q ss_pred             hHHHHHHHHHHHHhhhhcc
Q 028172          157 WPLILVTVGFFSALYFYFG  175 (212)
Q Consensus       157 ~PlI~v~~~~F~a~Y~~fG  175 (212)
                      |+.+++.++.|.++|+++.
T Consensus         7 ~~~~~~qli~Flil~~~l~   25 (141)
T PRK08476          7 PYLMLATFVVFLLLIVILN   25 (141)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            5667777777888877764


No 49 
>COG1862 YajC Preprotein translocase subunit YajC [Intracellular trafficking and secretion]
Probab=20.04  E-value=83  Score=24.81  Aligned_cols=18  Identities=22%  Similarity=0.399  Sum_probs=8.6

Q ss_pred             eeehhhhHHHHHHHHHHH
Q 028172          151 TFFLGFWPLILVTVGFFS  168 (212)
Q Consensus       151 tfFl~F~PlI~v~~~~F~  168 (212)
                      .++..+.||+++++.||.
T Consensus         7 ~~~~~ll~~vl~~~ifyF   24 (97)
T COG1862           7 SGLVLLLPLVLIFAIFYF   24 (97)
T ss_pred             ccHHHHHHHHHHHHHHHH
Confidence            444445555554444443


Done!