BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 028189
(212 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3R23|A Chain A, Crystal Structure Of D-Alanine--D-Alanine Ligase From
Bacillus Anthracis
pdb|3R23|B Chain B, Crystal Structure Of D-Alanine--D-Alanine Ligase From
Bacillus Anthracis
pdb|3R5X|A Chain A, Crystal Structure Of D-Alanine--D-Alanine Ligase From
Bacillus Anthracis Complexed With Atp
pdb|3R5X|B Chain B, Crystal Structure Of D-Alanine--D-Alanine Ligase From
Bacillus Anthracis Complexed With Atp
pdb|3R5X|C Chain C, Crystal Structure Of D-Alanine--D-Alanine Ligase From
Bacillus Anthracis Complexed With Atp
pdb|3R5X|D Chain D, Crystal Structure Of D-Alanine--D-Alanine Ligase From
Bacillus Anthracis Complexed With Atp
Length = 307
Score = 28.1 bits (61), Expect = 3.9, Method: Compositional matrix adjust.
Identities = 14/34 (41%), Positives = 21/34 (61%)
Query: 65 LEGNALKAIELTEELAQDLLEKNKDLHFDLLSLH 98
L+ N + + +T DL+EK KD+ F LL+LH
Sbjct: 31 LDKNKYEIVPITLNEKXDLIEKAKDIDFALLALH 64
>pdb|3B8B|A Chain A, Crystal Structure Of Cysq From Bacteroides
Thetaiotaomicron, A Bacterial Member Of The Inositol
Monophosphatase Family
Length = 292
Score = 27.7 bits (60), Expect = 4.3, Method: Compositional matrix adjust.
Identities = 16/68 (23%), Positives = 31/68 (45%), Gaps = 4/68 (5%)
Query: 142 EEPEKSPMF----HLLSLEYRQHVADNLNRAILERPRYAAMERLIQQTTAVRQCLSQELG 197
E+ E+ P+ H +++ R H+ I + + LI ++++ CL E
Sbjct: 175 EKSERXPLADARDHFIAVASRSHLTPETETYIADLKKKHGNVELISSGSSIKICLVAEGK 234
Query: 198 KDVHPPFS 205
DV+P F+
Sbjct: 235 ADVYPRFA 242
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.321 0.135 0.391
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,546,239
Number of Sequences: 62578
Number of extensions: 197669
Number of successful extensions: 630
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 9
Number of HSP's that attempted gapping in prelim test: 629
Number of HSP's gapped (non-prelim): 10
length of query: 212
length of database: 14,973,337
effective HSP length: 95
effective length of query: 117
effective length of database: 9,028,427
effective search space: 1056325959
effective search space used: 1056325959
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 49 (23.5 bits)