Query         028198
Match_columns 212
No_of_seqs    170 out of 303
Neff          4.4 
Searched_HMMs 46136
Date          Fri Mar 29 07:48:02 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/028198.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/028198hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2463 Predicted RNA-binding  100.0 1.5E-61 3.3E-66  438.6  10.1  181   18-209   176-375 (376)
  2 PF08772 NOB1_Zn_bind:  Nin one 100.0 1.1E-33 2.3E-38  209.2   2.8   71   62-133     1-73  (73)
  3 COG1439 Predicted nucleic acid  99.9 7.8E-24 1.7E-28  179.1   4.1   85   20-106    83-173 (177)
  4 PRK12496 hypothetical protein;  99.7 5.5E-19 1.2E-23  147.3   2.9   80   20-101    76-157 (164)
  5 TIGR03875 RNA_lig_partner RNA   97.7 1.2E-05 2.6E-10   70.2   1.0   28   31-58    168-195 (206)
  6 PRK04358 hypothetical protein;  97.5 2.3E-05 4.9E-10   68.9   0.5   38   21-58    161-199 (217)
  7 PF09723 Zn-ribbon_8:  Zinc rib  96.4  0.0041 8.9E-08   41.2   3.3   32   68-100     3-40  (42)
  8 smart00834 CxxC_CXXC_SSSS Puta  96.2  0.0041 8.8E-08   39.8   2.2   31   68-100     3-39  (41)
  9 TIGR02605 CxxC_CxxC_SSSS putat  96.1  0.0059 1.3E-07   41.3   2.8   33   68-101     3-41  (52)
 10 PF13248 zf-ribbon_3:  zinc-rib  95.6  0.0035 7.5E-08   37.7   0.2   23   71-94      3-25  (26)
 11 PF08745 UPF0278:  UPF0278 fami  95.5  0.0069 1.5E-07   53.1   1.8   29   31-59    165-193 (205)
 12 PF13240 zinc_ribbon_2:  zinc-r  94.5   0.015 3.3E-07   34.3   0.7   22   72-94      1-22  (23)
 13 COG1545 Predicted nucleic-acid  94.2   0.073 1.6E-06   43.6   4.5   44   65-111    24-67  (140)
 14 PF12172 DUF35_N:  Rubredoxin-l  94.1   0.035 7.6E-07   35.4   1.9   27   67-94      8-34  (37)
 15 PRK03681 hypA hydrogenase nick  94.0   0.038 8.3E-07   43.8   2.3   30   65-94     65-96  (114)
 16 PRK00564 hypA hydrogenase nick  94.0   0.046 9.9E-07   43.5   2.7   31   67-98     68-100 (117)
 17 TIGR00100 hypA hydrogenase nic  93.9   0.046   1E-06   43.3   2.7   29   66-94     66-95  (115)
 18 PRK12380 hydrogenase nickel in  93.8   0.044 9.6E-07   43.3   2.4   30   65-94     65-95  (113)
 19 PRK13130 H/ACA RNA-protein com  93.5   0.044 9.6E-07   39.0   1.6   26   68-97      3-28  (56)
 20 PF10571 UPF0547:  Uncharacteri  93.4    0.04 8.6E-07   33.5   1.2   22   72-94      2-23  (26)
 21 PRK00398 rpoP DNA-directed RNA  93.3    0.07 1.5E-06   35.5   2.3   25   70-94      3-30  (46)
 22 PRK03824 hypA hydrogenase nick  93.0   0.073 1.6E-06   43.3   2.4   27   68-94     68-116 (135)
 23 PF01155 HypA:  Hydrogenase exp  92.9   0.078 1.7E-06   41.8   2.4   30   65-94     65-95  (113)
 24 smart00659 RPOLCX RNA polymera  92.3    0.14 3.1E-06   34.5   2.7   30   70-100     2-33  (44)
 25 COG3364 Zn-ribbon containing p  92.2   0.074 1.6E-06   42.5   1.4   30   71-101     3-35  (112)
 26 PF09845 DUF2072:  Zn-ribbon co  92.0   0.085 1.8E-06   43.5   1.6   30   71-101     2-34  (131)
 27 cd00729 rubredoxin_SM Rubredox  91.7    0.15 3.3E-06   32.4   2.2   25   70-94      2-27  (34)
 28 COG1579 Zn-ribbon protein, pos  91.5    0.11 2.3E-06   46.6   1.8   32   52-93    189-229 (239)
 29 PF10263 SprT-like:  SprT-like   91.3     0.3 6.5E-06   39.1   4.1   58   41-100    85-156 (157)
 30 COG1996 RPC10 DNA-directed RNA  91.3    0.15 3.2E-06   35.5   2.0   32   68-100     4-38  (49)
 31 cd00350 rubredoxin_like Rubred  91.2    0.15 3.3E-06   32.0   1.8   25   70-94      1-26  (33)
 32 PF09538 FYDLN_acid:  Protein o  90.8    0.11 2.4E-06   41.2   1.1   24   71-94     10-35  (108)
 33 COG1592 Rubrerythrin [Energy p  90.8    0.17 3.7E-06   43.1   2.3   25   70-94    134-158 (166)
 34 PF04135 Nop10p:  Nucleolar RNA  90.7    0.34 7.4E-06   34.2   3.4   26   68-97      3-28  (53)
 35 PRK04351 hypothetical protein;  89.6    0.55 1.2E-05   39.0   4.3   55   41-100    85-145 (149)
 36 COG2093 DNA-directed RNA polym  89.5    0.17 3.8E-06   37.0   1.1   23   71-94      5-27  (64)
 37 COG1645 Uncharacterized Zn-fin  89.2    0.29 6.3E-06   40.4   2.4   23   72-94     30-53  (131)
 38 PRK00415 rps27e 30S ribosomal   88.9    0.31 6.8E-06   35.2   2.1   25   70-94     11-39  (59)
 39 PRK06393 rpoE DNA-directed RNA  88.3    0.23 4.9E-06   36.4   1.0   24   70-97      5-28  (64)
 40 PRK07591 threonine synthase; V  88.2    0.37   8E-06   45.5   2.7   27   68-94     16-42  (421)
 41 TIGR03844 cysteate_syn cysteat  88.2    0.33 7.2E-06   45.8   2.4   26   69-94      1-26  (398)
 42 PF03604 DNA_RNApol_7kD:  DNA d  87.5     0.5 1.1E-05   30.0   2.2   28   71-99      1-30  (32)
 43 COG2260 Predicted Zn-ribbon RN  87.5    0.25 5.5E-06   35.7   0.9   24   70-97      5-28  (59)
 44 PRK08351 DNA-directed RNA poly  87.4     0.3 6.5E-06   35.4   1.2   22   72-97      5-26  (61)
 45 PF11023 DUF2614:  Protein of u  87.4    0.38 8.1E-06   38.9   1.9   33   65-97     64-97  (114)
 46 COG1198 PriA Primosomal protei  87.3    0.46 9.9E-06   48.6   2.9   30   69-101   461-490 (730)
 47 COG2331 Uncharacterized protei  86.9    0.45 9.7E-06   36.3   1.9   33   66-100     8-46  (82)
 48 PRK00762 hypA hydrogenase nick  86.8    0.55 1.2E-05   37.7   2.6   32   65-98     65-104 (124)
 49 TIGR02300 FYDLN_acid conserved  86.4    0.36 7.9E-06   39.7   1.3   25   70-94      9-35  (129)
 50 PRK00241 nudC NADH pyrophospha  86.0    0.81 1.8E-05   40.8   3.5   55   71-128   100-161 (256)
 51 TIGR00595 priA primosomal prot  85.8    0.55 1.2E-05   45.5   2.5   28   70-100   240-267 (505)
 52 COG5257 GCD11 Translation init  85.8     1.1 2.4E-05   42.8   4.3   41   68-109    55-96  (415)
 53 PRK06450 threonine synthase; V  85.6    0.51 1.1E-05   43.4   2.1   24   71-94      4-27  (338)
 54 PRK14714 DNA polymerase II lar  85.6    0.66 1.4E-05   50.1   3.1   27   65-94    662-688 (1337)
 55 PF07295 DUF1451:  Protein of u  84.9    0.67 1.5E-05   38.6   2.3   31   70-101   112-145 (146)
 56 PRK06260 threonine synthase; V  84.4     0.7 1.5E-05   43.1   2.4   26   69-94      2-28  (397)
 57 PF05191 ADK_lid:  Adenylate ki  84.2    0.96 2.1E-05   29.3   2.3   24   71-94      2-30  (36)
 58 PF14803 Nudix_N_2:  Nudix N-te  84.1    0.56 1.2E-05   30.2   1.1   15   86-101     1-15  (34)
 59 PRK00420 hypothetical protein;  83.9    0.59 1.3E-05   37.5   1.5   24   71-94     24-49  (112)
 60 COG0267 RpmG Ribosomal protein  83.4    0.75 1.6E-05   32.2   1.6   31   68-99      5-47  (50)
 61 PRK11032 hypothetical protein;  83.2    0.88 1.9E-05   38.6   2.3   31   70-101   124-157 (160)
 62 TIGR02098 MJ0042_CXXC MJ0042 f  83.1    0.97 2.1E-05   28.6   2.0   25   70-94      2-34  (38)
 63 smart00731 SprT SprT homologue  82.9     1.6 3.4E-05   35.3   3.6   52   43-94     84-142 (146)
 64 PRK14559 putative protein seri  82.6    0.53 1.2E-05   47.4   0.9   21   73-94     30-50  (645)
 65 PF12773 DZR:  Double zinc ribb  82.4    0.63 1.4E-05   30.9   0.9   22   72-93     14-37  (50)
 66 PF12773 DZR:  Double zinc ribb  82.4    0.68 1.5E-05   30.8   1.1   21   73-94      1-21  (50)
 67 COG0375 HybF Zn finger protein  81.9       1 2.2E-05   36.4   2.1   33   65-98     65-98  (115)
 68 PF14205 Cys_rich_KTR:  Cystein  81.7    0.77 1.7E-05   32.8   1.2   15   86-101     5-19  (55)
 69 PF02150 RNA_POL_M_15KD:  RNA p  81.1    0.67 1.5E-05   29.7   0.6    9   86-94      2-10  (35)
 70 PF09297 zf-NADH-PPase:  NADH p  79.9    0.86 1.9E-05   28.2   0.9    9   86-94      4-12  (32)
 71 PF14446 Prok-RING_1:  Prokaryo  79.1       1 2.2E-05   32.0   1.1   25   70-94      5-30  (54)
 72 PF14369 zf-RING_3:  zinc-finge  79.1     1.5 3.4E-05   28.1   1.9   24   71-94      3-30  (35)
 73 PRK14873 primosome assembly pr  79.0     1.5 3.3E-05   44.3   2.7   29   70-102   410-438 (665)
 74 TIGR02827 RNR_anaer_Bdell anae  78.7     1.8 3.9E-05   43.4   3.0   49   42-100   509-560 (586)
 75 PF06676 DUF1178:  Protein of u  78.4     2.3   5E-05   35.6   3.2   33   67-101     2-47  (148)
 76 TIGR00354 polC DNA polymerase,  78.1     1.9 4.1E-05   45.7   3.1   29   65-97    620-648 (1095)
 77 cd01675 RNR_III Class III ribo  77.4     1.9 4.1E-05   42.5   2.8   30   70-101   518-547 (555)
 78 PF07282 OrfB_Zn_ribbon:  Putat  77.2     2.7 5.8E-05   29.6   2.8   45   44-94      8-55  (69)
 79 PRK05580 primosome assembly pr  77.1     1.6 3.5E-05   43.8   2.3   28   70-100   408-435 (679)
 80 PF14319 Zn_Tnp_IS91:  Transpos  77.1     1.7 3.7E-05   34.3   2.0   27   68-94     40-69  (111)
 81 COG3091 SprT Zn-dependent meta  76.6     1.5 3.3E-05   37.2   1.6   52   45-99     89-152 (156)
 82 PF09151 DUF1936:  Domain of un  76.4     4.2 9.1E-05   26.3   3.2   25   86-114     2-26  (36)
 83 PRK07111 anaerobic ribonucleos  75.5     1.9 4.2E-05   44.1   2.4   26   70-98    680-705 (735)
 84 PLN00209 ribosomal protein S27  75.5     1.7 3.8E-05   33.5   1.6   25   70-94     36-64  (86)
 85 PF07191 zinc-ribbons_6:  zinc-  75.5     2.4 5.2E-05   31.6   2.3   28   70-101    17-44  (70)
 86 PF00301 Rubredoxin:  Rubredoxi  75.4     2.7 5.9E-05   28.8   2.3   25   70-94      1-43  (47)
 87 PTZ00083 40S ribosomal protein  74.9     1.8   4E-05   33.3   1.5   25   70-94     35-63  (85)
 88 PF14205 Cys_rich_KTR:  Cystein  74.8       3 6.6E-05   29.8   2.5   31   68-100     3-42  (55)
 89 PRK04023 DNA polymerase II lar  74.4     2.5 5.4E-05   45.0   2.8   34   68-106  1035-1069(1121)
 90 TIGR00354 polC DNA polymerase,  74.1     2.4 5.3E-05   44.9   2.7   27   68-94   1010-1037(1095)
 91 COG1110 Reverse gyrase [DNA re  73.7    0.97 2.1E-05   48.1  -0.3   25   69-94    693-717 (1187)
 92 PRK11788 tetratricopeptide rep  73.6     2.1 4.6E-05   37.8   1.9   27   71-98    355-381 (389)
 93 PRK02935 hypothetical protein;  73.5     2.5 5.3E-05   34.0   2.0   30   67-96     67-97  (110)
 94 smart00661 RPOL9 RNA polymeras  73.3     1.6 3.4E-05   29.0   0.7    9   86-94      1-9   (52)
 95 PF15017 AF1Q:  Drug resistance  73.3     1.9 4.1E-05   33.4   1.3   16   14-29     64-79  (87)
 96 PRK05978 hypothetical protein;  73.1     1.1 2.5E-05   37.5   0.0   32   67-100    30-65  (148)
 97 TIGR02487 NrdD anaerobic ribon  73.0       2 4.4E-05   42.5   1.8   44   42-94    501-547 (579)
 98 PF08792 A2L_zn_ribbon:  A2L zi  72.8     2.4 5.1E-05   27.0   1.4   23   71-93      4-29  (33)
 99 COG0846 SIR2 NAD-dependent pro  72.7     3.5 7.5E-05   37.1   3.0   57   34-99     93-159 (250)
100 PRK14559 putative protein seri  72.7     1.8 3.8E-05   43.8   1.2   23   71-94      2-24  (645)
101 PRK14714 DNA polymerase II lar  72.6     2.8 6.2E-05   45.5   2.8   34   68-106  1251-1285(1337)
102 COG2888 Predicted Zn-ribbon RN  72.5     1.4 2.9E-05   32.1   0.3    8   86-93     51-58  (61)
103 PF13597 NRDD:  Anaerobic ribon  72.5     1.9   4E-05   42.5   1.4   23   70-94    491-513 (546)
104 cd00730 rubredoxin Rubredoxin;  72.1     2.2 4.7E-05   29.6   1.2   25   70-94      1-43  (50)
105 PF03119 DNA_ligase_ZBD:  NAD-d  72.0     2.2 4.7E-05   26.1   1.1    8   87-94      1-8   (28)
106 PRK14890 putative Zn-ribbon RN  71.6     1.8   4E-05   31.3   0.8   22   70-94     36-57  (59)
107 COG2888 Predicted Zn-ribbon RN  71.5     1.8   4E-05   31.5   0.8   31   70-101     9-42  (61)
108 PF14353 CpXC:  CpXC protein     71.5     3.7 8.1E-05   32.3   2.6    9   86-94     39-47  (128)
109 PRK04023 DNA polymerase II lar  71.5     2.2 4.7E-05   45.5   1.6   10  139-148   773-782 (1121)
110 PRK11823 DNA repair protein Ra  71.4       3 6.5E-05   39.9   2.4   31   68-99      5-35  (446)
111 PRK07218 replication factor A;  71.4     5.8 0.00013   38.3   4.4   69   41-112   266-339 (423)
112 smart00531 TFIIE Transcription  71.0       3 6.5E-05   34.0   2.0   28   67-94     96-132 (147)
113 cd04476 RPA1_DBD_C RPA1_DBD_C:  70.5     6.3 0.00014   32.1   3.9   43   67-110    31-81  (166)
114 PRK14890 putative Zn-ribbon RN  70.5     2.7 5.8E-05   30.4   1.4   31   70-101     7-40  (59)
115 PF02591 DUF164:  Putative zinc  70.3     2.3 4.9E-05   29.3   1.0   22   72-93     24-54  (56)
116 COG1933 Archaeal DNA polymeras  70.2     2.7 5.8E-05   38.1   1.7   27   68-94    165-192 (253)
117 PF13638 PIN_4:  PIN domain; PD  69.4       5 0.00011   30.9   2.9   27   32-58    106-132 (133)
118 TIGR00686 phnA alkylphosphonat  69.1     3.7 8.1E-05   33.0   2.2   38   72-111     4-51  (109)
119 PRK08270 anaerobic ribonucleos  69.0     3.4 7.4E-05   41.8   2.4   43   42-94    602-648 (656)
120 COG4031 Predicted metal-bindin  68.6     3.6 7.7E-05   36.4   2.1   32   71-106     1-32  (227)
121 PRK14715 DNA polymerase II lar  68.2     3.8 8.2E-05   45.0   2.6   25   69-94   1541-1566(1627)
122 cd01121 Sms Sms (bacterial rad  68.0     2.6 5.6E-05   39.6   1.2   28   71-99      1-28  (372)
123 PF12677 DUF3797:  Domain of un  67.8     5.5 0.00012   27.9   2.5   21   85-112    13-33  (49)
124 PRK08579 anaerobic ribonucleos  67.7     2.9 6.2E-05   42.2   1.5   46   40-94    543-591 (625)
125 PRK12366 replication factor A;  67.6     6.8 0.00015   39.3   4.2   48   63-110   525-576 (637)
126 PF04216 FdhE:  Protein involve  67.6       5 0.00011   36.0   2.9   40   69-109   196-235 (290)
127 cd01407 SIR2-fam SIR2 family o  67.5     4.7  0.0001   34.5   2.6   41   48-94     92-142 (218)
128 PF01780 Ribosomal_L37ae:  Ribo  67.5     2.2 4.9E-05   33.1   0.6   18   85-103    35-52  (90)
129 PRK00504 rpmG 50S ribosomal pr  66.7     6.4 0.00014   27.4   2.7   31   68-99      5-47  (50)
130 PRK08402 replication factor A;  66.7     9.8 0.00021   35.9   4.8   45   67-111   209-259 (355)
131 PF07754 DUF1610:  Domain of un  66.7     3.5 7.7E-05   24.8   1.2   21   73-93      1-24  (24)
132 PRK10220 hypothetical protein;  66.7     4.6 9.9E-05   32.6   2.2   38   72-111     5-52  (111)
133 PRK03988 translation initiatio  66.5     5.3 0.00011   33.0   2.6   48   34-81     78-134 (138)
134 PF13717 zinc_ribbon_4:  zinc-r  66.5     4.1 8.9E-05   26.1   1.6   24   70-93      2-33  (36)
135 PLN02569 threonine synthase     66.3     5.7 0.00012   38.7   3.2   57   35-98     18-75  (484)
136 PRK08329 threonine synthase; V  66.3     3.6 7.7E-05   37.8   1.7   25   71-98      2-26  (347)
137 PRK05638 threonine synthase; V  66.2     3.7 8.1E-05   38.9   1.9   24   70-94      1-24  (442)
138 PF13719 zinc_ribbon_5:  zinc-r  65.8     5.1 0.00011   25.7   1.9   24   71-94      3-34  (37)
139 PF03833 PolC_DP2:  DNA polymer  65.6       2 4.4E-05   44.9   0.0   10  139-148   802-811 (900)
140 COG1096 Predicted RNA-binding   65.3       4 8.7E-05   35.6   1.8   33   70-103   149-182 (188)
141 TIGR00311 aIF-2beta translatio  64.9       7 0.00015   32.1   3.0   39   42-80     84-128 (133)
142 TIGR01023 rpmG_bact ribosomal   64.8       8 0.00017   27.2   2.9   32   67-99      8-51  (54)
143 TIGR00416 sms DNA repair prote  64.6     4.4 9.4E-05   39.0   2.0   31   68-99      5-35  (454)
144 PRK08271 anaerobic ribonucleos  63.7       4 8.6E-05   41.2   1.6   44   42-94    543-589 (623)
145 COG1997 RPL43A Ribosomal prote  63.7     4.2   9E-05   31.7   1.4   17   85-102    35-51  (89)
146 PRK08197 threonine synthase; V  63.1     5.8 0.00013   37.0   2.5   25   69-94      6-31  (394)
147 cd01413 SIR2_Af2 SIR2_Af2: Arc  62.7     5.2 0.00011   34.6   2.0   27   68-94    111-145 (222)
148 cd01408 SIRT1 SIRT1: Eukaryoti  62.7     5.8 0.00013   34.7   2.3   34   55-94    107-149 (235)
149 COG0777 AccD Acetyl-CoA carbox  62.7     2.4 5.1E-05   39.2  -0.1   73   71-163    29-108 (294)
150 PF02146 SIR2:  Sir2 family;  I  62.4     8.4 0.00018   31.8   3.1   27   68-94    103-138 (178)
151 PRK00595 rpmG 50S ribosomal pr  62.4     8.8 0.00019   26.8   2.8   32   67-99      7-50  (53)
152 smart00653 eIF2B_5 domain pres  62.4     6.7 0.00015   31.1   2.4   45   34-78     56-109 (110)
153 PF08271 TF_Zn_Ribbon:  TFIIB z  62.2     3.5 7.7E-05   26.9   0.7   23   71-93      1-27  (43)
154 PRK04338 N(2),N(2)-dimethylgua  61.9       6 0.00013   37.3   2.4   27   68-94    242-270 (382)
155 cd01410 SIRT7 SIRT7: Eukaryoti  61.0     6.1 0.00013   33.9   2.1   27   68-94     93-129 (206)
156 PRK00432 30S ribosomal protein  60.7     6.5 0.00014   27.1   1.8    8   86-93     21-28  (50)
157 PRK00481 NAD-dependent deacety  60.6     6.7 0.00015   34.2   2.4   27   68-94    120-151 (242)
158 PF07975 C1_4:  TFIIH C1-like d  60.6     3.9 8.5E-05   28.6   0.7   10   73-82      2-11  (51)
159 PTZ00255 60S ribosomal protein  60.3     8.1 0.00018   30.0   2.5   20   84-104    35-54  (90)
160 PF03833 PolC_DP2:  DNA polymer  60.3     2.9 6.2E-05   43.8   0.0   21   71-94    656-676 (900)
161 PF04606 Ogr_Delta:  Ogr/Delta-  60.1     6.8 0.00015   26.3   1.8   23   87-110     1-23  (47)
162 CHL00104 rpl33 ribosomal prote  59.8       9  0.0002   28.1   2.5   32   67-99      9-62  (66)
163 PRK05452 anaerobic nitric oxid  59.7     6.3 0.00014   38.0   2.2   25   70-94    425-467 (479)
164 COG1867 TRM1 N2,N2-dimethylgua  59.3       6 0.00013   37.9   1.9   28   67-94    237-266 (380)
165 TIGR00280 L37a ribosomal prote  59.0     8.7 0.00019   29.9   2.5   19   85-104    35-53  (91)
166 TIGR00308 TRM1 tRNA(guanine-26  58.3       8 0.00017   36.5   2.6   27   68-94    231-261 (374)
167 cd01411 SIR2H SIR2H: Uncharact  58.1     6.9 0.00015   34.0   2.0   26   69-94    117-145 (225)
168 PRK14704 anaerobic ribonucleos  58.0       6 0.00013   39.8   1.8   23   70-94    559-581 (618)
169 COG0675 Transposase and inacti  58.0       5 0.00011   34.5   1.1   22   71-94    310-331 (364)
170 PF01907 Ribosomal_L37e:  Ribos  57.8     6.5 0.00014   28.1   1.4   24   71-94     16-39  (55)
171 PTZ00408 NAD-dependent deacety  57.5     7.4 0.00016   34.5   2.1   26   68-93    115-145 (242)
172 PRK12336 translation initiatio  57.3      10 0.00023   32.7   2.9   47   35-81     75-130 (201)
173 TIGR00155 pqiA_fam integral me  57.2       6 0.00013   37.6   1.6   25   70-94    215-239 (403)
174 PRK06266 transcription initiat  57.1     7.4 0.00016   33.1   2.0   63   35-99     82-148 (178)
175 PTZ00410 NAD-dependent SIR2; P  56.6      11 0.00025   35.5   3.3   27   68-94    145-180 (349)
176 PHA00626 hypothetical protein   56.4     7.4 0.00016   28.1   1.6   14   87-101     2-15  (59)
177 PF06906 DUF1272:  Protein of u  56.2     4.5 9.8E-05   29.1   0.4   29   66-94     22-50  (57)
178 PRK03976 rpl37ae 50S ribosomal  56.2      11 0.00023   29.4   2.5   19   85-104    36-54  (90)
179 COG1656 Uncharacterized conser  56.2     5.1 0.00011   34.3   0.8   23   33-56     47-69  (165)
180 PRK14138 NAD-dependent deacety  54.9      10 0.00022   33.4   2.5   26   69-94    118-152 (244)
181 PRK09263 anaerobic ribonucleos  54.8      10 0.00023   38.7   2.9   25   70-94    641-668 (711)
182 cd00296 SIR2 SIR2 superfamily   54.8      11 0.00023   31.7   2.6   53   34-94     82-143 (222)
183 PF05991 NYN_YacP:  YacP-like N  54.6      13 0.00027   31.0   2.9   44   16-59     73-121 (166)
184 PRK15103 paraquat-inducible me  54.3     6.4 0.00014   37.7   1.2   24   71-94     11-39  (419)
185 COG2126 RPL37A Ribosomal prote  54.1     5.7 0.00012   28.9   0.7   27   68-94     14-40  (61)
186 PRK09521 exosome complex RNA-b  53.6     7.7 0.00017   32.7   1.5   31   70-101   149-181 (189)
187 PRK14289 chaperone protein Dna  53.4      51  0.0011   30.9   7.0   28   69-97    196-223 (386)
188 TIGR00373 conserved hypothetic  53.2     8.9 0.00019   31.9   1.8   27   68-94    107-137 (158)
189 COG2176 PolC DNA polymerase II  53.1     7.2 0.00016   42.6   1.5   24   71-94    915-948 (1444)
190 PRK05654 acetyl-CoA carboxylas  52.9     7.3 0.00016   35.7   1.3   25   70-94     27-55  (292)
191 PF01783 Ribosomal_L32p:  Ribos  52.8      12 0.00026   26.1   2.2   21   71-93     27-47  (56)
192 TIGR00515 accD acetyl-CoA carb  52.5     7.6 0.00016   35.5   1.4   25   69-94     26-54  (285)
193 PF14206 Cys_rich_CPCC:  Cystei  52.5     6.8 0.00015   29.6   0.9   23   71-93      2-28  (78)
194 CHL00174 accD acetyl-CoA carbo  52.4     7.4 0.00016   36.0   1.3   25   69-94     38-66  (296)
195 COG1379 PHP family phosphoeste  52.3     4.7  0.0001   38.4  -0.0   32   63-94    239-274 (403)
196 PRK04011 peptide chain release  52.2      16 0.00034   34.9   3.5   27   68-94    326-359 (411)
197 TIGR03826 YvyF flagellar opero  52.1     4.6  0.0001   33.4  -0.1   23   72-94      5-27  (137)
198 PRK14715 DNA polymerase II lar  51.8      12 0.00026   41.4   2.9   27   65-94    669-695 (1627)
199 PRK04860 hypothetical protein;  51.7      20 0.00043   30.2   3.7   58   41-101    87-157 (160)
200 COG3478 Predicted nucleic-acid  51.3     7.9 0.00017   28.7   1.0    7   88-94      7-13  (68)
201 cd01409 SIRT4 SIRT4: Eukaryoti  51.1      12 0.00025   33.4   2.3   14   68-81    116-129 (260)
202 PRK00448 polC DNA polymerase I  50.9     9.2  0.0002   42.2   1.9   24   71-94    909-942 (1437)
203 PF06221 zf-C2HC5:  Putative zi  50.6     8.5 0.00018   27.5   1.1   32   63-94     11-44  (57)
204 TIGR00155 pqiA_fam integral me  50.4      10 0.00022   36.1   1.9   25   70-94     13-42  (403)
205 KOG3084 NADH pyrophosphatase I  50.1     7.1 0.00015   36.9   0.8   12   85-97    150-161 (345)
206 PF09082 DUF1922:  Domain of un  50.1     9.3  0.0002   28.4   1.2   24   69-94      2-28  (68)
207 KOG1779 40s ribosomal protein   49.9       8 0.00017   29.7   0.9   24   71-94     35-62  (84)
208 cd01412 SIRT5_Af1_CobB SIRT5_A  49.6      11 0.00024   32.2   1.9   27   68-94    107-139 (224)
209 PF10122 Mu-like_Com:  Mu-like   49.6     9.3  0.0002   26.9   1.1   24   70-93      4-32  (51)
210 COG1328 NrdD Oxygen-sensitive   49.3     9.5 0.00021   39.2   1.6   47   39-94    615-664 (700)
211 PF04828 GFA:  Glutathione-depe  49.3     5.6 0.00012   28.3  -0.0   15   80-94     43-57  (92)
212 PF09855 DUF2082:  Nucleic-acid  49.2      14 0.00029   26.9   2.0   19   87-106     2-20  (64)
213 PF06827 zf-FPG_IleRS:  Zinc fi  48.9     7.3 0.00016   23.5   0.5   13   87-101     3-15  (30)
214 COG1631 RPL42A Ribosomal prote  48.8      12 0.00025   29.5   1.7   18   85-103     8-25  (94)
215 COG0498 ThrC Threonine synthas  48.6      10 0.00022   36.5   1.6   27   68-94      3-30  (411)
216 PHA02942 putative transposase;  47.9      24 0.00051   33.4   3.9   42   47-94    308-351 (383)
217 PRK15103 paraquat-inducible me  47.8      10 0.00022   36.3   1.5   24   70-94    221-244 (419)
218 TIGR01405 polC_Gram_pos DNA po  47.6      11 0.00025   40.8   2.0   24   71-94    684-717 (1213)
219 cd04511 Nudix_Hydrolase_4 Memb  47.4      36 0.00078   26.1   4.3   24  104-128    20-43  (130)
220 PF09332 Mcm10:  Mcm10 replicat  46.7      15 0.00032   34.7   2.4   37   71-108   286-325 (344)
221 TIGR00340 zpr1_rel ZPR1-relate  46.4      15 0.00033   31.1   2.2   12   88-100     1-12  (163)
222 COG1458 Predicted DNA-binding   46.3      17 0.00036   32.5   2.4   28   31-58    172-199 (221)
223 PF01667 Ribosomal_S27e:  Ribos  46.2      13 0.00028   26.5   1.4   25   70-94      7-35  (55)
224 PF14690 zf-ISL3:  zinc-finger   45.8      10 0.00023   24.5   0.9   11   86-97      3-13  (47)
225 PF02005 TRM:  N2,N2-dimethylgu  45.3      15 0.00033   34.6   2.2   28   67-94    237-268 (377)
226 PTZ00157 60S ribosomal protein  44.9      15 0.00033   28.3   1.7   19   85-104     9-27  (84)
227 TIGR01562 FdhE formate dehydro  44.7      23  0.0005   32.9   3.3   31   70-101   210-240 (305)
228 PRK00464 nrdR transcriptional   44.6      20 0.00043   30.1   2.6    8   86-93     29-36  (154)
229 KOG3799 Rab3 effector RIM1 and  44.5      11 0.00023   31.9   1.0   16   83-98     87-102 (169)
230 KOG2906 RNA polymerase III sub  43.9      10 0.00022   30.3   0.7    9   86-94      2-10  (105)
231 PRK12286 rpmF 50S ribosomal pr  43.9      16 0.00034   25.9   1.6    9   86-94     28-36  (57)
232 TIGR01031 rpmF_bact ribosomal   43.9      15 0.00032   25.8   1.4   19   72-92     28-46  (55)
233 COG3357 Predicted transcriptio  43.5      12 0.00025   29.6   1.0   26   71-97     59-87  (97)
234 COG3791 Uncharacterized conser  43.2      13 0.00027   30.0   1.2   12   83-94     67-78  (133)
235 PF00471 Ribosomal_L33:  Riboso  42.4      12 0.00026   25.7   0.8   30   68-98      3-44  (48)
236 COG2051 RPS27A Ribosomal prote  42.1      15 0.00032   27.3   1.3   24   70-93     19-46  (67)
237 PF08646 Rep_fac-A_C:  Replicat  41.9      39 0.00084   26.9   3.8   44   68-111    16-68  (146)
238 PF15616 TerY-C:  TerY-C metal   41.7      16 0.00034   30.1   1.5   22   72-94     91-114 (131)
239 PRK12495 hypothetical protein;  41.5      16 0.00034   32.8   1.6   24   71-94     43-67  (226)
240 PRK03564 formate dehydrogenase  41.4      30 0.00064   32.3   3.4   29   69-98    211-239 (309)
241 PRK12775 putative trifunctiona  41.3      14  0.0003   39.1   1.4   25   70-94    821-847 (1006)
242 COG5270 PUA domain (predicted   41.3      22 0.00047   31.4   2.4   32   67-103    11-42  (202)
243 PRK05767 rpl44e 50S ribosomal   41.2      22 0.00048   27.8   2.2   19   85-104     8-26  (92)
244 PF01396 zf-C4_Topoisom:  Topoi  41.0      17 0.00036   23.6   1.3   25   86-115     2-26  (39)
245 PF10058 DUF2296:  Predicted in  40.8      21 0.00045   25.0   1.8   27   67-93     19-52  (54)
246 TIGR03831 YgiT_finger YgiT-typ  40.7      32 0.00068   21.7   2.6   21   74-94     21-41  (46)
247 PF09862 DUF2089:  Protein of u  40.7      18 0.00038   29.2   1.6   19   73-92      1-19  (113)
248 COG2401 ABC-type ATPase fused   40.6      16 0.00034   36.5   1.5   50   36-94    104-153 (593)
249 PRK06386 replication factor A;  40.6      18 0.00039   34.3   1.9   68   39-112   205-278 (358)
250 PRK00241 nudC NADH pyrophospha  40.2      13 0.00027   33.2   0.8   10   85-94     99-108 (256)
251 COG1594 RPB9 DNA-directed RNA   40.1      12 0.00026   29.7   0.6    9   86-94      3-11  (113)
252 COG2816 NPY1 NTP pyrophosphohy  40.1      32 0.00069   31.8   3.4   28   71-99    112-142 (279)
253 PRK07956 ligA NAD-dependent DN  40.0      36 0.00077   34.6   4.0   47   46-94    361-413 (665)
254 PF01927 Mut7-C:  Mut7-C RNAse   39.9      19  0.0004   29.3   1.7   13   87-101    93-105 (147)
255 PTZ00073 60S ribosomal protein  39.3      14 0.00031   28.8   0.9   24   71-94     17-40  (91)
256 KOG2324 Prolyl-tRNA synthetase  39.3      84  0.0018   30.7   6.1   55   46-101   189-262 (457)
257 PRK04179 rpl37e 50S ribosomal   39.0      14  0.0003   27.1   0.7   24   70-93     17-40  (62)
258 PF01623 Carla_C4:  Carlavirus   39.0      17 0.00036   28.4   1.2   25   68-94     51-75  (91)
259 PRK05333 NAD-dependent deacety  38.8      26 0.00057   31.4   2.6   13   68-80    126-138 (285)
260 TIGR03676 aRF1/eRF1 peptide ch  38.5      23 0.00051   33.7   2.4   27   68-94    318-351 (403)
261 COG2995 PqiA Uncharacterized p  38.1      15 0.00032   35.6   1.0   24   71-94    221-244 (418)
262 TIGR00627 tfb4 transcription f  37.8      23  0.0005   32.4   2.1   24   70-94    255-278 (279)
263 COG2995 PqiA Uncharacterized p  37.4      19 0.00042   34.9   1.6   32   67-100    15-51  (418)
264 COG0384 Predicted epimerase, P  37.3      31 0.00066   31.7   2.8   50   39-98     31-80  (291)
265 COG1601 GCD7 Translation initi  37.1     9.6 0.00021   32.1  -0.4   42   40-81     90-137 (151)
266 COG2816 NPY1 NTP pyrophosphohy  36.7      16 0.00034   33.8   0.8   11   84-94    110-120 (279)
267 PF10609 ParA:  ParA/MinD ATPas  36.6      15 0.00033   27.8   0.6   13   82-94     62-74  (81)
268 PF06677 Auto_anti-p27:  Sjogre  36.5      30 0.00065   23.0   2.0    9   86-94     18-26  (41)
269 COG1066 Sms Predicted ATP-depe  36.1      27 0.00058   34.3   2.4   32   69-101     6-37  (456)
270 PF13408 Zn_ribbon_recom:  Reco  36.0      19  0.0004   23.9   0.9   14   84-99      4-17  (58)
271 PF01873 eIF-5_eIF-2B:  Domain   35.9      14  0.0003   29.9   0.4   37   43-79     81-123 (125)
272 PTZ00409 Sir2 (Silent Informat  35.9      23  0.0005   32.0   1.8   14   68-81    135-148 (271)
273 COG4888 Uncharacterized Zn rib  35.7      30 0.00066   27.6   2.2   22   85-109    22-43  (104)
274 PF05876 Terminase_GpA:  Phage   35.0      24 0.00052   34.9   1.9   29   66-94    196-238 (557)
275 COG1773 Rubredoxin [Energy pro  34.9      27 0.00058   24.9   1.6   12   70-81      3-14  (55)
276 PF12760 Zn_Tnp_IS1595:  Transp  34.6      23 0.00049   23.4   1.2    9   86-94     19-27  (46)
277 PF09862 DUF2089:  Protein of u  34.5      18  0.0004   29.1   0.8   20   88-109     1-20  (113)
278 TIGR00575 dnlj DNA ligase, NAD  34.2      50  0.0011   33.5   4.0   48   46-94    349-401 (652)
279 PF14447 Prok-RING_4:  Prokaryo  34.0      27 0.00058   25.0   1.5   21   71-94     28-48  (55)
280 COG4469 CoiA Competence protei  33.9      20 0.00044   33.9   1.1   10   85-94     25-34  (342)
281 KOG0402 60S ribosomal protein   33.5      13 0.00029   28.9  -0.1   20   84-104    35-54  (92)
282 KOG2768 Translation initiation  33.1      24 0.00052   31.7   1.4   54   40-94    136-211 (231)
283 PF14255 Cys_rich_CPXG:  Cystei  32.8      31 0.00067   24.1   1.6    8   87-94      2-9   (52)
284 COG4640 Predicted membrane pro  32.5      18  0.0004   35.2   0.6   23   71-94      2-24  (465)
285 COG4260 Membrane protease subu  32.0      20 0.00044   33.7   0.8    9   86-94    335-343 (345)
286 smart00440 ZnF_C2C2 C2C2 Zinc   31.6      22 0.00049   23.1   0.7    8   87-94      2-9   (40)
287 KOG3475 60S ribosomal protein   31.6      16 0.00034   28.5   0.0   23   72-94     18-40  (92)
288 PF13453 zf-TFIIB:  Transcripti  31.5      32 0.00069   22.2   1.5   13   88-102     2-14  (41)
289 PRK14350 ligA NAD-dependent DN  31.3      47   0.001   34.0   3.3   43   46-94    358-407 (669)
290 TIGR01384 TFS_arch transcripti  31.3      27 0.00057   26.5   1.2   23   72-94      2-25  (104)
291 KOG4718 Non-SMC (structural ma  31.3      16 0.00035   32.8   0.0   30   64-93    188-224 (235)
292 TIGR01562 FdhE formate dehydro  31.1      24 0.00052   32.7   1.1   10   85-94    184-193 (305)
293 TIGR02820 formald_GSH S-(hydro  31.1      21 0.00046   30.8   0.7   12   83-94     87-98  (182)
294 PF14569 zf-UDP:  Zinc-binding   30.9      10 0.00022   29.0  -1.1   24   71-94     37-60  (80)
295 PRK05417 glutathione-dependent  30.8      20 0.00043   31.2   0.5   12   83-94     91-102 (191)
296 PF04216 FdhE:  Protein involve  30.6      50  0.0011   29.6   3.0   23   85-110   172-196 (290)
297 COG4530 Uncharacterized protei  30.5      25 0.00055   28.7   1.0   24   71-94     10-35  (129)
298 PF15499 Peptidase_C98:  Ubiqui  30.4      26 0.00057   32.3   1.2   83   40-129   109-223 (275)
299 COG3058 FdhE Uncharacterized p  30.3      36 0.00077   31.8   2.1   11   84-94    184-194 (308)
300 TIGR00375 conserved hypothetic  30.2      33 0.00071   32.7   1.9   50   44-94    213-267 (374)
301 PRK09678 DNA-binding transcrip  30.1      29 0.00064   25.8   1.2   21   86-107     2-22  (72)
302 PRK07225 DNA-directed RNA poly  29.7      36 0.00077   34.4   2.1   32   70-101   544-578 (605)
303 PF01747 ATP-sulfurylase:  ATP-  29.6      76  0.0016   27.9   3.9   51   32-94    125-179 (215)
304 PRK07217 replication factor A;  29.6      31 0.00068   32.3   1.6   44   64-110   182-230 (311)
305 PF10083 DUF2321:  Uncharacteri  29.5     4.9 0.00011   34.2  -3.3   15   85-100    28-42  (158)
306 PF06044 DRP:  Dam-replacing fa  29.5      26 0.00057   32.0   1.0   14   86-100    32-45  (254)
307 PF13824 zf-Mss51:  Zinc-finger  29.4      39 0.00084   24.1   1.7   22   73-94      2-23  (55)
308 TIGR00108 eRF peptide chain re  28.9      44 0.00095   31.9   2.5   27   68-94    322-355 (409)
309 TIGR00595 priA primosomal prot  28.9      26 0.00056   34.1   1.0   19   70-94    213-231 (505)
310 PRK14892 putative transcriptio  28.6      47   0.001   26.0   2.2   18   85-106    21-38  (99)
311 PF10601 zf-LITAF-like:  LITAF-  28.6      52  0.0011   23.5   2.3   20   83-103     5-24  (73)
312 PRK14873 primosome assembly pr  28.5      33 0.00072   34.8   1.7   11   69-79    382-392 (665)
313 PF08273 Prim_Zn_Ribbon:  Zinc-  28.5      23  0.0005   23.5   0.4   19   86-107     4-22  (40)
314 KOG0806 Carbon-nitrogen hydrol  28.0 1.3E+02  0.0029   28.0   5.3   94   41-150    83-177 (298)
315 PF15135 UPF0515:  Uncharacteri  27.9      26 0.00057   32.2   0.8   25   70-94    132-164 (278)
316 PF01096 TFIIS_C:  Transcriptio  27.8      28 0.00061   22.5   0.7    8   87-94      2-9   (39)
317 COG1571 Predicted DNA-binding   27.8      34 0.00073   33.3   1.5   33   62-94    339-376 (421)
318 PRK14287 chaperone protein Dna  27.7 1.3E+02  0.0028   28.2   5.3   24   70-94    181-204 (371)
319 cd03361 TOPRIM_TopoIA_RevGyr T  27.6      46 0.00099   27.8   2.1   26   68-94     75-100 (170)
320 PF14354 Lar_restr_allev:  Rest  27.6      43 0.00092   22.8   1.6    9   86-94      4-12  (61)
321 PF08274 PhnA_Zn_Ribbon:  PhnA   27.3      28 0.00061   21.8   0.6   21   73-93      5-27  (30)
322 COG2405 Predicted nucleic acid  27.3      45 0.00097   28.4   2.0   30   32-61     85-115 (157)
323 PF11781 RRN7:  RNA polymerase   27.2      22 0.00048   22.9   0.1   25   70-94      8-34  (36)
324 PF10367 Vps39_2:  Vacuolar sor  27.2      54  0.0012   24.0   2.2   23   86-110    79-101 (109)
325 COG5533 UBP5 Ubiquitin C-termi  27.1      76  0.0017   30.5   3.7   60   86-146   285-345 (415)
326 PF08996 zf-DNA_Pol:  DNA Polym  27.1      39 0.00085   28.6   1.7   36   59-94      7-54  (188)
327 PRK03564 formate dehydrogenase  27.1      46 0.00099   31.0   2.2   12   84-95    186-197 (309)
328 PF14949 ARF7EP_C:  ARF7 effect  27.1      35 0.00075   27.1   1.2   16   71-94     68-83  (103)
329 PF03243 MerB:  Alkylmercury ly  27.0      58  0.0013   26.0   2.6   37   86-133    40-76  (127)
330 PRK14894 glycyl-tRNA synthetas  26.7      40 0.00087   33.8   1.9   36   63-99     81-117 (539)
331 PF02639 DUF188:  Uncharacteriz  26.7      73  0.0016   25.9   3.1   30   34-63     52-81  (130)
332 smart00714 LITAF Possible memb  26.5      62  0.0013   22.8   2.4   18   85-103     3-20  (67)
333 TIGR02159 PA_CoA_Oxy4 phenylac  26.4      31 0.00068   28.5   0.9   11   86-96    106-116 (146)
334 PF05129 Elf1:  Transcription e  26.3      42 0.00092   25.2   1.5   22   85-109    22-44  (81)
335 smart00532 LIGANc Ligase N fam  25.9      81  0.0017   30.6   3.7   46   46-94    356-408 (441)
336 PRK14301 chaperone protein Dna  25.7 2.6E+02  0.0056   26.2   7.0    9   86-94    198-206 (373)
337 KOG3022 Predicted ATPase, nucl  25.6      71  0.0015   29.9   3.1   46   34-94    184-231 (300)
338 PRK00566 DNA-directed RNA poly  25.4      33 0.00073   37.3   1.1   29   71-100    58-87  (1156)
339 PRK14283 chaperone protein Dna  25.2 2.7E+02  0.0058   26.1   7.0   27   69-96    188-214 (378)
340 PF00628 PHD:  PHD-finger;  Int  25.1      56  0.0012   21.2   1.8   22   72-93      1-22  (51)
341 COG1040 ComFC Predicted amidop  24.7      18 0.00039   31.6  -0.8   27   71-100    25-51  (225)
342 PF01363 FYVE:  FYVE zinc finge  24.7      39 0.00085   23.5   1.0   22   72-93     11-33  (69)
343 PRK14296 chaperone protein Dna  24.6 1.9E+02   0.004   27.2   5.8    9   86-94    207-215 (372)
344 PF12674 Zn_ribbon_2:  Putative  24.5      31 0.00067   26.0   0.5   23   86-110     1-24  (81)
345 COG2956 Predicted N-acetylgluc  24.4      23 0.00049   34.0  -0.3   36   60-98    346-381 (389)
346 PHA02325 hypothetical protein   24.3      35 0.00076   25.4   0.7   11   84-94      2-12  (72)
347 COG3880 Modulator of heat shoc  24.2      17 0.00037   31.5  -1.0   50   41-93     47-100 (176)
348 TIGR03670 rpoB_arch DNA-direct  24.2      54  0.0012   33.1   2.3   31   70-100   538-571 (599)
349 PRK14285 chaperone protein Dna  24.0 3.2E+02   0.007   25.5   7.2    9   86-94    200-208 (365)
350 COG0143 MetG Methionyl-tRNA sy  23.9      48   0.001   33.2   1.9   30   63-92    119-149 (558)
351 PF04032 Rpr2:  RNAse P Rpr2/Rp  23.8      40 0.00086   24.2   1.0   13   82-94     43-55  (85)
352 PF04423 Rad50_zn_hook:  Rad50   23.7      30 0.00065   23.5   0.3    8   87-94     22-29  (54)
353 PRK14284 chaperone protein Dna  23.7 2.7E+02  0.0058   26.2   6.7   11  140-150   260-270 (391)
354 COG5319 Uncharacterized protei  23.5      37  0.0008   28.4   0.8   32   67-99      2-45  (142)
355 PRK10546 pyrimidine (deoxy)nuc  23.4 1.4E+02   0.003   22.6   4.0   35   97-134     4-38  (135)
356 PF03854 zf-P11:  P-11 zinc fin  23.3      19 0.00042   25.2  -0.7   23   71-94     22-44  (50)
357 PF06397 Desulfoferrod_N:  Desu  23.2      72  0.0016   20.8   2.0   20   86-110     7-26  (36)
358 CHL00018 rpoC1 RNA polymerase   23.2      30 0.00064   35.5   0.2   32   66-100    64-99  (663)
359 COG1326 Uncharacterized archae  23.1      77  0.0017   28.1   2.8   12   97-108    49-60  (201)
360 PRK14293 chaperone protein Dna  23.0 2.8E+02   0.006   25.9   6.6   26   70-96    186-211 (374)
361 COG4311 SoxD Sarcosine oxidase  22.8      38 0.00083   26.8   0.7   11   84-94      2-12  (97)
362 PRK10445 endonuclease VIII; Pr  22.3      56  0.0012   29.1   1.8   16   85-102   235-250 (263)
363 PF02132 RecR:  RecR protein;    22.3     7.2 0.00016   25.5  -2.9   29   63-94     10-38  (41)
364 PRK14810 formamidopyrimidine-D  22.2      57  0.0012   29.2   1.8   16   85-102   244-259 (272)
365 PF03367 zf-ZPR1:  ZPR1 zinc-fi  22.1      76  0.0016   26.6   2.4   13   87-100     3-15  (161)
366 TIGR03830 CxxCG_CxxCG_HTH puta  22.1      67  0.0015   24.4   2.0   10   88-98      1-10  (127)
367 TIGR03655 anti_R_Lar restricti  22.0      42 0.00091   22.8   0.7    8   87-94      3-10  (53)
368 PRK02625 rpoC1 DNA-directed RN  22.0      46   0.001   34.0   1.3   26   66-94     66-92  (627)
369 PRK14351 ligA NAD-dependent DN  21.8 1.1E+02  0.0024   31.4   3.9   44   47-94    384-432 (689)
370 TIGR02387 rpoC1_cyan DNA-direc  21.6      35 0.00076   34.8   0.4   32   66-100    59-91  (619)
371 TIGR00201 comF comF family pro  21.6      46   0.001   27.8   1.0   21   73-94      1-21  (190)
372 COG2824 PhnA Uncharacterized Z  21.5      53  0.0012   26.6   1.3   26   69-94      2-29  (112)
373 TIGR01079 rplX_bact ribosomal   21.2      84  0.0018   24.7   2.4   23   85-110    71-93  (104)
374 PF09567 RE_MamI:  MamI restric  21.2      43 0.00093   31.1   0.8   28   71-100    83-110 (314)
375 TIGR01206 lysW lysine biosynth  21.1      80  0.0017   22.2   2.0   27   71-99      3-34  (54)
376 PRK13764 ATPase; Provisional    21.0      79  0.0017   32.0   2.7   29   32-60    101-129 (602)
377 PF12387 Peptidase_C74:  Pestiv  21.0      43 0.00093   29.4   0.8   45   42-96    142-186 (200)
378 PRK14278 chaperone protein Dna  21.0 3.4E+02  0.0073   25.5   6.8   26   70-96    182-207 (378)
379 TIGR03847 conserved hypothetic  21.0      55  0.0012   28.4   1.4   18   84-110   155-172 (177)
380 PRK14281 chaperone protein Dna  20.8   3E+02  0.0065   26.0   6.4   27   70-97    205-231 (397)
381 COG1885 Uncharacterized protei  20.7      82  0.0018   25.5   2.2   18   83-102    47-64  (115)
382 COG3809 Uncharacterized protei  20.7      42 0.00091   25.9   0.6   10   85-94     21-30  (88)
383 PLN02915 cellulose synthase A   20.6      43 0.00092   36.1   0.8   26   72-99     44-69  (1044)
384 PF06839 zf-GRF:  GRF zinc fing  20.6      73  0.0016   20.9   1.7   14   87-102     2-15  (45)
385 COG0333 RpmF Ribosomal protein  20.3      61  0.0013   23.2   1.3   19   72-92     29-47  (57)
386 PLN02189 cellulose synthase     20.2      40 0.00088   36.3   0.5   28   72-101    63-90  (1040)
387 PRK13795 hypothetical protein;  20.2      87  0.0019   31.5   2.8   38   66-110     8-45  (636)
388 KOG1522 RNA polymerase II, sub  20.1      75  0.0016   29.3   2.1   20   32-51     17-36  (285)

No 1  
>KOG2463 consensus Predicted RNA-binding protein Nob1p involved in 26S proteasome assembly [Posttranslational modification, protein turnover, chaperones]
Probab=100.00  E-value=1.5e-61  Score=438.64  Aligned_cols=181  Identities=41%  Similarity=0.721  Sum_probs=156.0

Q ss_pred             CcCCCCceeeec--------------CCCceeeEecchHHHHHHHHHhCceeecCCCCcceeeeeEEEEccCcccccccc
Q 028198           18 DECSEQSWMLRS--------------LSESTVACITGDYAMQNVILQMGLRLLAPGGMQIRQLHRWILKCHACYTITAEI   83 (212)
Q Consensus        18 d~~s~~~Wi~~~--------------l~~~~vac~TdDfAmQNVllqmGL~~~s~~g~~I~~~k~wvlrC~aC~k~~~~~   83 (212)
                      ||.++..||+++              ..++.|||+|+||||||||+||||+++++.|++|+++++|+|||||||+++++|
T Consensus       176 ed~DdDgwitp~ni~~~~~e~~al~~pe~~~Vac~TtDfamQNVlLqm~L~l~~~~G~~Ir~~r~~iLRCh~Cfsit~~m  255 (376)
T KOG2463|consen  176 EDADDDGWITPSNITEAIIELGALNRPENQLVACLTTDFAMQNVLLQMNLNLLAMSGMKIRSVRSYILRCHGCFSITSEM  255 (376)
T ss_pred             cccccccccccchHHHHHHhhhcccccccceeeeecccHHHHHHHHHhcccccCccchhhhhhhhheeEeeeeeEecCcc
Confidence            333344499977              146789999999999999999999999999999999999999999999999999


Q ss_pred             CccccCCCCCCCceeEEEEEeCCCceEEeec--CCccccccceeccCCCCCCCCCCCCCceecCCCCcccccchhhhcc-
Q 028198           84 GRIFCPKCGNGGTLRKVAVTVGENGIVLASR--RPRITLRGTKFSLPMPQGGRDAITKNLILREDQLPQKYLYPRNKKK-  160 (212)
Q Consensus        84 ~k~FCp~CG~~~TL~Rvsvsv~~~G~~~~~~--k~~~n~RG~~ySlPkpkgGk~~~~~~~IL~EDQ~~~~~~~~k~r~k-  160 (212)
                      ++.|||+||++ ||+||+|||++||+++.|.  +++||+||++||||+|||||+.  +|+||+|||+++++..+++|+| 
T Consensus       256 ~k~FCp~CG~~-TL~K~aVsv~~dG~~~~h~k~r~~~n~RG~~YSlp~PkGgk~~--kN~~LrEDQ~~~q~~~~q~rkk~  332 (376)
T KOG2463|consen  256 PKDFCPSCGHK-TLTKCAVSVDEDGNGQTHFKKRFQWNNRGLQYSLPKPKGGKVA--KNPILREDQPEPQRRYVQTRKKV  332 (376)
T ss_pred             chhcccccCCC-eeeEEEEEecCCCceeEEeecccccccCcceeecCCCCCCccc--cCccccccCchHHHHHHHHHHhh
Confidence            99999999999 9999999999999987665  5579999999999999999997  8999999998888888778887 


Q ss_pred             cCCCCCCccCCCCcccc--CCCccccCCchhhhhceeccccCCCCCCCCCC
Q 028198          161 VNKEGDNFVTSDDIFKH--HTDKRAPLQPPIRKALAVFSGRRNPNDNHYSH  209 (212)
Q Consensus       161 ~~~~d~dy~~~~~~f~~--~~~k~a~l~~~~~~~~~~~~grrNPN~~~~~~  209 (212)
                      .+++++ |    .||+.  ..+++|.++  +|+.+.+|. |||||++|+++
T Consensus       333 ~~~~~~-y----gpf~~~d~~s~~a~~~--v~~~~~~~k-~rnpN~skr~~  375 (376)
T KOG2463|consen  333 KKPLNE-Y----GPFSGHDVTSRSAILG--VRQHVRIGK-RRNPNESKRKS  375 (376)
T ss_pred             hccccc-c----CCcccccccccccccc--hhhhhhhhc-cCCCchhcccc
Confidence            577776 7    38953  367777776  455565665 78999999875


No 2  
>PF08772 NOB1_Zn_bind:  Nin one binding (NOB1) Zn-ribbon like;  InterPro: IPR014881 This entry corresponds to a zinc ribbon and is found on the RNA binding protein NOB1. ; PDB: 2CON_A.
Probab=99.98  E-value=1.1e-33  Score=209.23  Aligned_cols=71  Identities=48%  Similarity=1.056  Sum_probs=24.5

Q ss_pred             cceeeeeEEEEccCccccccccCccccCCCCCCCceeEEEEEeCCCceEEeec--CCccccccceeccCCCCCC
Q 028198           62 QIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENGIVLASR--RPRITLRGTKFSLPMPQGG  133 (212)
Q Consensus        62 ~I~~~k~wvlrC~aC~k~~~~~~k~FCp~CG~~~TL~Rvsvsv~~~G~~~~~~--k~~~n~RG~~ySlPkpkgG  133 (212)
                      +|+++++|+|||||||+++.+|+++|||+|||+ ||.||+|+||+||++++|+  +++||+||++||||+|+||
T Consensus         1 rIk~~k~~vlrC~aCf~~t~~~~k~FCp~CGn~-TL~rvsvsv~~~G~~~~~~~~~~~~n~RG~~ySlPkPkgG   73 (73)
T PF08772_consen    1 RIKRVKTWVLRCHACFKITKDMTKQFCPKCGNA-TLKRVSVSVDEDGKIKLHLKKNFQWNLRGTKYSLPKPKGG   73 (73)
T ss_dssp             -------EEEE-SSS--EES-SS--S-SSS--S---EEEE-B--SS---B------------------------
T ss_pred             CcchhheeeEEccccccCcCCCCceeCcccCCC-cceEEEEEECCCCCEEEEecCCceeccCCCCccCCCCCCC
Confidence            589999999999999999999999999999998 9999999999999987665  4579999999999999998


No 3  
>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only]
Probab=99.88  E-value=7.8e-24  Score=179.06  Aligned_cols=85  Identities=34%  Similarity=0.578  Sum_probs=68.7

Q ss_pred             CCCCceeeecC-----CCceeeEecchHHHHHHHHHhCceeec-CCCCcceeeeeEEEEccCccccccccCccccCCCCC
Q 028198           20 CSEQSWMLRSL-----SESTVACITGDYAMQNVILQMGLRLLA-PGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGN   93 (212)
Q Consensus        20 ~s~~~Wi~~~l-----~~~~vac~TdDfAmQNVllqmGL~~~s-~~g~~I~~~k~wvlrC~aC~k~~~~~~k~FCp~CG~   93 (212)
                      +|+++.-..+|     .+.+|+++||||+|||||+||||+|.+ ..+..|+++++|++||+||+++|+ +..+|||.||+
T Consensus        83 LS~tDi~VlalAlel~~~~~v~l~TdDysvQNVa~~Lgi~~~~~~~~~~I~~v~~w~~rC~GC~~~f~-~~~~~Cp~CG~  161 (177)
T COG1439          83 LSPTDIEVLALALELGEEVQVALATDDYSVQNVALQLGLNVRSISYKGKIKKVRKWRLRCHGCKRIFP-EPKDFCPICGS  161 (177)
T ss_pred             cChhhHHHHHHHHhhccccceeEEecchHHHHHHHHhCceEEeeeccCccceEeeeeEEEecCceecC-CCCCcCCCCCC
Confidence            55555544443     235689999999999999999999998 456679999999999999999999 67899999999


Q ss_pred             CCceeEEEEEeCC
Q 028198           94 GGTLRKVAVTVGE  106 (212)
Q Consensus        94 ~~TL~Rvsvsv~~  106 (212)
                      + ++++...+.+.
T Consensus       162 ~-~~~~~~~~~~~  173 (177)
T COG1439         162 P-LKRKRVKSRSS  173 (177)
T ss_pred             c-eEEeeechhhc
Confidence            9 76666554443


No 4  
>PRK12496 hypothetical protein; Provisional
Probab=99.74  E-value=5.5e-19  Score=147.26  Aligned_cols=80  Identities=21%  Similarity=0.365  Sum_probs=67.6

Q ss_pred             CCCCceeeecC-CCceeeEecchHHHHHHHHHhCceeecCCCCcceeeeeEEEEccCcccccccc-CccccCCCCCCCce
Q 028198           20 CSEQSWMLRSL-SESTVACITGDYAMQNVILQMGLRLLAPGGMQIRQLHRWILKCHACYTITAEI-GRIFCPKCGNGGTL   97 (212)
Q Consensus        20 ~s~~~Wi~~~l-~~~~vac~TdDfAmQNVllqmGL~~~s~~g~~I~~~k~wvlrC~aC~k~~~~~-~k~FCp~CG~~~TL   97 (212)
                      +|+++--..+| .++++.++||||++|||+.+|||.+.++.+.+|++++.|+++|+||++.|+.. ..+|||.||++  |
T Consensus        76 Ls~~D~~~iaLA~el~~~lvtDD~~~~~vA~~lgi~v~~~~~~~i~~~~~w~~~C~gC~~~~~~~~~~~~C~~CG~~--~  153 (164)
T PRK12496         76 LSNTDIEVLALALELNGTLYTDDYGIQNVAKKLNIKFENIKTKGIKKVIKWRKVCKGCKKKYPEDYPDDVCEICGSP--V  153 (164)
T ss_pred             cchhhHHHHHHHHHhCCcEECcHHHHHHHHHHcCCeEeccccccchhheeeeEECCCCCccccCCCCCCcCCCCCCh--h
Confidence            55555544444 36678999999999999999999999999999999999999999999999753 46899999998  6


Q ss_pred             eEEE
Q 028198           98 RKVA  101 (212)
Q Consensus        98 ~Rvs  101 (212)
                      +|..
T Consensus       154 ~r~~  157 (164)
T PRK12496        154 KRKM  157 (164)
T ss_pred             hhcc
Confidence            5544


No 5  
>TIGR03875 RNA_lig_partner RNA ligase partner, MJ_0950 family. This uncharacterized protein family is found almost perfectly in the same set of genomes as the Pab1020 family described by model TIGR01209. These pairs are found mostly in Archaea, but also in a few bacteria (e.g. Alkalilimnicola ehrlichei MLHE-1, Aquifex aeolicus). While the partner protein has been described as homodimeric ligase that has RNA circularization activity, the function of this protein (also called UPF0278) is unknown.
Probab=97.70  E-value=1.2e-05  Score=70.18  Aligned_cols=28  Identities=21%  Similarity=0.402  Sum_probs=25.6

Q ss_pred             CCceeeEecchHHHHHHHHHhCceeecC
Q 028198           31 SESTVACITGDYAMQNVILQMGLRLLAP   58 (212)
Q Consensus        31 ~~~~vac~TdDfAmQNVllqmGL~~~s~   58 (212)
                      .+++++++|+|||||||+.+|||.+++.
T Consensus       168 ~ELda~lvTdD~giqn~A~~Lgi~~~~~  195 (206)
T TIGR03875       168 KELDAAVVSADEGIRKWAERLGLRFVDA  195 (206)
T ss_pred             HHcCcEEEeCcHHHHHHHHHcCCeeecH
Confidence            4789999999999999999999999863


No 6  
>PRK04358 hypothetical protein; Provisional
Probab=97.54  E-value=2.3e-05  Score=68.93  Aligned_cols=38  Identities=21%  Similarity=0.316  Sum_probs=29.7

Q ss_pred             CCCceeeecC-CCceeeEecchHHHHHHHHHhCceeecC
Q 028198           21 SEQSWMLRSL-SESTVACITGDYAMQNVILQMGLRLLAP   58 (212)
Q Consensus        21 s~~~Wi~~~l-~~~~vac~TdDfAmQNVllqmGL~~~s~   58 (212)
                      |.+|....+| .+++++++|+||+|||++.+|||++++.
T Consensus       161 S~~DidvlaLA~ELda~lvTdD~giqn~A~~LGI~~~~~  199 (217)
T PRK04358        161 SAEDLDVLLLAKELDAAVVSADEGIRKWAERLGLRFVDA  199 (217)
T ss_pred             chhhHHHHHHHHHhCCEEEeCCHHHHHHHHHcCCeeecH
Confidence            3344433444 4789999999999999999999999864


No 7  
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=96.38  E-value=0.0041  Score=41.16  Aligned_cols=32  Identities=25%  Similarity=0.619  Sum_probs=25.0

Q ss_pred             eEEEEccCccccccc------cCccccCCCCCCCceeEE
Q 028198           68 RWILKCHACYTITAE------IGRIFCPKCGNGGTLRKV  100 (212)
Q Consensus        68 ~wvlrC~aC~k~~~~------~~k~FCp~CG~~~TL~Rv  100 (212)
                      .|.|+|..|+..+..      .....||.||+. .++||
T Consensus         3 ~Yey~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~~-~~~r~   40 (42)
T PF09723_consen    3 IYEYRCEECGHEFEVLQSISEDDPVPCPECGST-EVRRV   40 (42)
T ss_pred             CEEEEeCCCCCEEEEEEEcCCCCCCcCCCCCCC-ceEEe
Confidence            488999999976642      235789999995 68876


No 8  
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=96.15  E-value=0.0041  Score=39.76  Aligned_cols=31  Identities=23%  Similarity=0.593  Sum_probs=23.4

Q ss_pred             eEEEEccCccccccc------cCccccCCCCCCCceeEE
Q 028198           68 RWILKCHACYTITAE------IGRIFCPKCGNGGTLRKV  100 (212)
Q Consensus        68 ~wvlrC~aC~k~~~~------~~k~FCp~CG~~~TL~Rv  100 (212)
                      .|.++|..|++.+..      .....||.||..  ++|+
T Consensus         3 ~Y~y~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~~--~~r~   39 (41)
T smart00834        3 IYEYRCEDCGHTFEVLQKISDDPLATCPECGGD--VRRL   39 (41)
T ss_pred             CEEEEcCCCCCEEEEEEecCCCCCCCCCCCCCc--ceec
Confidence            488999999997642      224679999985  6665


No 9  
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=96.06  E-value=0.0059  Score=41.26  Aligned_cols=33  Identities=27%  Similarity=0.628  Sum_probs=24.5

Q ss_pred             eEEEEccCcccccccc------CccccCCCCCCCceeEEE
Q 028198           68 RWILKCHACYTITAEI------GRIFCPKCGNGGTLRKVA  101 (212)
Q Consensus        68 ~wvlrC~aC~k~~~~~------~k~FCp~CG~~~TL~Rvs  101 (212)
                      .|.|+|..|+..+...      ....||.||.. .++|+-
T Consensus         3 ~Yey~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~~-~~~r~~   41 (52)
T TIGR02605         3 IYEYRCTACGHRFEVLQKMSDDPLATCPECGGE-KLRRLL   41 (52)
T ss_pred             CEEEEeCCCCCEeEEEEecCCCCCCCCCCCCCC-ceeEEe
Confidence            4889999999976542      23469999995 676663


No 10 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=95.62  E-value=0.0035  Score=37.65  Aligned_cols=23  Identities=30%  Similarity=0.791  Sum_probs=18.3

Q ss_pred             EEccCccccccccCccccCCCCCC
Q 028198           71 LKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        71 lrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      ..|+.|++.... .-.|||.||.+
T Consensus         3 ~~Cp~Cg~~~~~-~~~fC~~CG~~   25 (26)
T PF13248_consen    3 MFCPNCGAEIDP-DAKFCPNCGAK   25 (26)
T ss_pred             CCCcccCCcCCc-ccccChhhCCC
Confidence            579999996544 46899999985


No 11 
>PF08745 UPF0278:  UPF0278 family;  InterPro: IPR022785 This entry contains proteins of the UPF0278 family and proteins containing PIN domains. Members of the UPF0278 family are uncharacterised and about 200 amino acids in length.; PDB: 2LCQ_A.
Probab=95.53  E-value=0.0069  Score=53.09  Aligned_cols=29  Identities=28%  Similarity=0.481  Sum_probs=17.7

Q ss_pred             CCceeeEecchHHHHHHHHHhCceeecCC
Q 028198           31 SESTVACITGDYAMQNVILQMGLRLLAPG   59 (212)
Q Consensus        31 ~~~~vac~TdDfAmQNVllqmGL~~~s~~   59 (212)
                      .+++++++|+|++|||++.+|||+++...
T Consensus       165 ~El~a~lvt~D~gi~~~A~~lGi~~i~~~  193 (205)
T PF08745_consen  165 LELDAVLVTDDYGIQNWAEKLGIRFIDAR  193 (205)
T ss_dssp             HHHT--EE---HHHHHHHHHTT--EE---
T ss_pred             HHcCCEEEeCCHhHHHHHHHCCCEEEecc
Confidence            37899999999999999999999998654


No 12 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=94.47  E-value=0.015  Score=34.27  Aligned_cols=22  Identities=32%  Similarity=0.801  Sum_probs=17.9

Q ss_pred             EccCccccccccCccccCCCCCC
Q 028198           72 KCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        72 rC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      +|+-|++...+. -.|||.||.+
T Consensus         1 ~Cp~CG~~~~~~-~~fC~~CG~~   22 (23)
T PF13240_consen    1 YCPNCGAEIEDD-AKFCPNCGTP   22 (23)
T ss_pred             CCcccCCCCCCc-CcchhhhCCc
Confidence            489999887764 5799999985


No 13 
>COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only]
Probab=94.24  E-value=0.073  Score=43.57  Aligned_cols=44  Identities=30%  Similarity=0.517  Sum_probs=33.1

Q ss_pred             eeeeEEEEccCccccccccCccccCCCCCCCceeEEEEEeCCCceEE
Q 028198           65 QLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENGIVL  111 (212)
Q Consensus        65 ~~k~wvlrC~aC~k~~~~~~k~FCp~CG~~~TL~Rvsvsv~~~G~~~  111 (212)
                      +-+-.-.+|..|++++-. ++.+||.||..+.+.-|.  +...|.+.
T Consensus        24 ~~kl~g~kC~~CG~v~~P-Pr~~Cp~C~~~~~~E~ve--ls~~G~V~   67 (140)
T COG1545          24 EGKLLGTKCKKCGRVYFP-PRAYCPKCGSETELEWVE--LSGEGKVE   67 (140)
T ss_pred             hCcEEEEEcCCCCeEEcC-CcccCCCCCCCCceEEEE--eCCCeEEE
Confidence            345667899999999976 589999999984345554  56778764


No 14 
>PF12172 DUF35_N:  Rubredoxin-like zinc ribbon domain (DUF35_N);  InterPro: IPR022002  This domain has no known function and is found in conserved hypothetical archaeal and bacterial proteins. The domain is duplicated in O53566 from SWISSPROT. The structure of a DUF35 representative reveals two long N-terminal helices followed by a rubredoxin-like zinc ribbon domain represented in this family and a C-terminal OB fold domain. Zinc is chelated by the four conserved cysteines in the alignment. ; PDB: 3IRB_A.
Probab=94.15  E-value=0.035  Score=35.38  Aligned_cols=27  Identities=26%  Similarity=0.656  Sum_probs=16.5

Q ss_pred             eeEEEEccCccccccccCccccCCCCCC
Q 028198           67 HRWILKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        67 k~wvlrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      +-.+.+|..|++++.. .+.+||.||+.
T Consensus         8 ~l~~~rC~~Cg~~~~p-Pr~~Cp~C~s~   34 (37)
T PF12172_consen    8 RLLGQRCRDCGRVQFP-PRPVCPHCGSD   34 (37)
T ss_dssp             -EEEEE-TTT--EEES---SEETTTT--
T ss_pred             EEEEEEcCCCCCEecC-CCcCCCCcCcc
Confidence            4567899999999765 46899999985


No 15 
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=94.02  E-value=0.038  Score=43.75  Aligned_cols=30  Identities=20%  Similarity=0.452  Sum_probs=22.2

Q ss_pred             eeeeEEEEccCccccccccC-c-cccCCCCCC
Q 028198           65 QLHRWILKCHACYTITAEIG-R-IFCPKCGNG   94 (212)
Q Consensus        65 ~~k~wvlrC~aC~k~~~~~~-k-~FCp~CG~~   94 (212)
                      +...-..+|..|+..++... . ..||.||+.
T Consensus        65 ~~~p~~~~C~~Cg~~~~~~~~~~~~CP~Cgs~   96 (114)
T PRK03681         65 EEQEAECWCETCQQYVTLLTQRVRRCPQCHGD   96 (114)
T ss_pred             EeeCcEEEcccCCCeeecCCccCCcCcCcCCC
Confidence            33455689999998887642 2 349999987


No 16 
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=93.99  E-value=0.046  Score=43.48  Aligned_cols=31  Identities=19%  Similarity=0.427  Sum_probs=22.8

Q ss_pred             eeEEEEccCccccccccC-ccc-cCCCCCCCcee
Q 028198           67 HRWILKCHACYTITAEIG-RIF-CPKCGNGGTLR   98 (212)
Q Consensus        67 k~wvlrC~aC~k~~~~~~-k~F-Cp~CG~~~TL~   98 (212)
                      ..-..+|..|+..++... ..+ ||.||+. .+.
T Consensus        68 vp~~~~C~~Cg~~~~~~~~~~~~CP~Cgs~-~~~  100 (117)
T PRK00564         68 EKVELECKDCSHVFKPNALDYGVCEKCHSK-NVI  100 (117)
T ss_pred             cCCEEEhhhCCCccccCCccCCcCcCCCCC-ceE
Confidence            455689999998876643 344 9999997 443


No 17 
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=93.94  E-value=0.046  Score=43.28  Aligned_cols=29  Identities=21%  Similarity=0.276  Sum_probs=22.0

Q ss_pred             eeeEEEEccCccccccccC-ccccCCCCCC
Q 028198           66 LHRWILKCHACYTITAEIG-RIFCPKCGNG   94 (212)
Q Consensus        66 ~k~wvlrC~aC~k~~~~~~-k~FCp~CG~~   94 (212)
                      ...-..+|..|++.+.... ..-||.||+.
T Consensus        66 ~~p~~~~C~~Cg~~~~~~~~~~~CP~Cgs~   95 (115)
T TIGR00100        66 DEPVECECEDCSEEVSPEIDLYRCPKCHGI   95 (115)
T ss_pred             eeCcEEEcccCCCEEecCCcCccCcCCcCC
Confidence            3455689999998887643 3449999997


No 18 
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=93.83  E-value=0.044  Score=43.33  Aligned_cols=30  Identities=17%  Similarity=0.340  Sum_probs=22.6

Q ss_pred             eeeeEEEEccCcccccccc-CccccCCCCCC
Q 028198           65 QLHRWILKCHACYTITAEI-GRIFCPKCGNG   94 (212)
Q Consensus        65 ~~k~wvlrC~aC~k~~~~~-~k~FCp~CG~~   94 (212)
                      +...-..+|..|+..+... ....||.||+.
T Consensus        65 ~~vp~~~~C~~Cg~~~~~~~~~~~CP~Cgs~   95 (113)
T PRK12380         65 VYKPAQAWCWDCSQVVEIHQHDAQCPHCHGE   95 (113)
T ss_pred             EeeCcEEEcccCCCEEecCCcCccCcCCCCC
Confidence            3445679999999887663 34459999987


No 19 
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed
Probab=93.45  E-value=0.044  Score=39.01  Aligned_cols=26  Identities=38%  Similarity=0.713  Sum_probs=21.0

Q ss_pred             eEEEEccCccccccccCccccCCCCCCCce
Q 028198           68 RWILKCHACYTITAEIGRIFCPKCGNGGTL   97 (212)
Q Consensus        68 ~wvlrC~aC~k~~~~~~k~FCp~CG~~~TL   97 (212)
                      .=+..|..|+..|-   +..||.||.+ |.
T Consensus         3 s~mr~C~~CgvYTL---k~~CP~CG~~-t~   28 (56)
T PRK13130          3 SKIRKCPKCGVYTL---KEICPVCGGK-TK   28 (56)
T ss_pred             ccceECCCCCCEEc---cccCcCCCCC-CC
Confidence            34568999998876   6799999998 54


No 20 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=93.45  E-value=0.04  Score=33.49  Aligned_cols=22  Identities=36%  Similarity=0.890  Sum_probs=18.4

Q ss_pred             EccCccccccccCccccCCCCCC
Q 028198           72 KCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        72 rC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      .|+.|+++.+.. -.+||+||..
T Consensus         2 ~CP~C~~~V~~~-~~~Cp~CG~~   23 (26)
T PF10571_consen    2 TCPECGAEVPES-AKFCPHCGYD   23 (26)
T ss_pred             cCCCCcCCchhh-cCcCCCCCCC
Confidence            699999988764 4699999984


No 21 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=93.33  E-value=0.07  Score=35.54  Aligned_cols=25  Identities=28%  Similarity=0.514  Sum_probs=19.4

Q ss_pred             EEEccCcccccc---ccCccccCCCCCC
Q 028198           70 ILKCHACYTITA---EIGRIFCPKCGNG   94 (212)
Q Consensus        70 vlrC~aC~k~~~---~~~k~FCp~CG~~   94 (212)
                      .++|..|+....   ......||.||++
T Consensus         3 ~y~C~~CG~~~~~~~~~~~~~Cp~CG~~   30 (46)
T PRK00398          3 EYKCARCGREVELDEYGTGVRCPYCGYR   30 (46)
T ss_pred             EEECCCCCCEEEECCCCCceECCCCCCe
Confidence            589999998753   2225789999997


No 22 
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=92.97  E-value=0.073  Score=43.30  Aligned_cols=27  Identities=33%  Similarity=0.667  Sum_probs=20.3

Q ss_pred             eEEEEccCcccccccc----------------------CccccCCCCCC
Q 028198           68 RWILKCHACYTITAEI----------------------GRIFCPKCGNG   94 (212)
Q Consensus        68 ~wvlrC~aC~k~~~~~----------------------~k~FCp~CG~~   94 (212)
                      .-.++|..|+.++...                      ....||.||+.
T Consensus        68 p~~~~C~~CG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CP~Cgs~  116 (135)
T PRK03824         68 EAVLKCRNCGNEWSLKEVKESLDEEIREAIHFIPEVVHAFLKCPKCGSR  116 (135)
T ss_pred             ceEEECCCCCCEEecccccccccccccccccccccccccCcCCcCCCCC
Confidence            3569999999887653                      22349999987


No 23 
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=92.94  E-value=0.078  Score=41.76  Aligned_cols=30  Identities=20%  Similarity=0.419  Sum_probs=20.0

Q ss_pred             eeeeEEEEccCccccccccC-ccccCCCCCC
Q 028198           65 QLHRWILKCHACYTITAEIG-RIFCPKCGNG   94 (212)
Q Consensus        65 ~~k~wvlrC~aC~k~~~~~~-k~FCp~CG~~   94 (212)
                      ....-+.+|..|+..+.... ...||.||+.
T Consensus        65 e~~p~~~~C~~Cg~~~~~~~~~~~CP~Cgs~   95 (113)
T PF01155_consen   65 EEVPARARCRDCGHEFEPDEFDFSCPRCGSP   95 (113)
T ss_dssp             EEE--EEEETTTS-EEECHHCCHH-SSSSSS
T ss_pred             EecCCcEECCCCCCEEecCCCCCCCcCCcCC
Confidence            44566799999999886433 4569999997


No 24 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=92.29  E-value=0.14  Score=34.51  Aligned_cols=30  Identities=27%  Similarity=0.455  Sum_probs=22.8

Q ss_pred             EEEccCcccccccc--CccccCCCCCCCceeEE
Q 028198           70 ILKCHACYTITAEI--GRIFCPKCGNGGTLRKV  100 (212)
Q Consensus        70 vlrC~aC~k~~~~~--~k~FCp~CG~~~TL~Rv  100 (212)
                      +|+|..|+..+...  ....||.||++ -|-|.
T Consensus         2 ~Y~C~~Cg~~~~~~~~~~irC~~CG~r-IlyK~   33 (44)
T smart00659        2 IYICGECGRENEIKSKDVVRCRECGYR-ILYKK   33 (44)
T ss_pred             EEECCCCCCEeecCCCCceECCCCCce-EEEEe
Confidence            58999999876532  36889999998 66443


No 25 
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=92.16  E-value=0.074  Score=42.52  Aligned_cols=30  Identities=27%  Similarity=0.535  Sum_probs=24.4

Q ss_pred             EEccCccccccccC---ccccCCCCCCCceeEEE
Q 028198           71 LKCHACYTITAEIG---RIFCPKCGNGGTLRKVA  101 (212)
Q Consensus        71 lrC~aC~k~~~~~~---k~FCp~CG~~~TL~Rvs  101 (212)
                      .+|+.|+++|++..   ..=||+||++ ....|+
T Consensus         3 H~CtrCG~vf~~g~~~il~GCp~CG~n-kF~yv~   35 (112)
T COG3364           3 HQCTRCGEVFDDGSEEILSGCPKCGCN-KFLYVP   35 (112)
T ss_pred             ceecccccccccccHHHHccCccccch-heEecc
Confidence            48999999998733   4569999997 777776


No 26 
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=91.96  E-value=0.085  Score=43.49  Aligned_cols=30  Identities=23%  Similarity=0.583  Sum_probs=23.0

Q ss_pred             EEccCccccccccC---ccccCCCCCCCceeEEE
Q 028198           71 LKCHACYTITAEIG---RIFCPKCGNGGTLRKVA  101 (212)
Q Consensus        71 lrC~aC~k~~~~~~---k~FCp~CG~~~TL~Rvs  101 (212)
                      .+|+.|+++|.+-.   ..=||.||++ ....|.
T Consensus         2 H~Ct~Cg~~f~dgs~eil~GCP~CGg~-kF~yv~   34 (131)
T PF09845_consen    2 HQCTKCGRVFEDGSKEILSGCPECGGN-KFQYVP   34 (131)
T ss_pred             cccCcCCCCcCCCcHHHHccCcccCCc-ceEEcC
Confidence            47999999998754   4679999997 554443


No 27 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=91.72  E-value=0.15  Score=32.44  Aligned_cols=25  Identities=28%  Similarity=0.584  Sum_probs=19.6

Q ss_pred             EEEccCcccccccc-CccccCCCCCC
Q 028198           70 ILKCHACYTITAEI-GRIFCPKCGNG   94 (212)
Q Consensus        70 vlrC~aC~k~~~~~-~k~FCp~CG~~   94 (212)
                      .++|.-|+.++... .-..||.||.+
T Consensus         2 ~~~C~~CG~i~~g~~~p~~CP~Cg~~   27 (34)
T cd00729           2 VWVCPVCGYIHEGEEAPEKCPICGAP   27 (34)
T ss_pred             eEECCCCCCEeECCcCCCcCcCCCCc
Confidence            47999999887542 34689999985


No 28 
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=91.47  E-value=0.11  Score=46.60  Aligned_cols=32  Identities=28%  Similarity=0.691  Sum_probs=22.4

Q ss_pred             CceeecCCCCcceeeeeEEEEccCccccccc---------cCccccCCCCC
Q 028198           52 GLRLLAPGGMQIRQLHRWILKCHACYTITAE---------IGRIFCPKCGN   93 (212)
Q Consensus        52 GL~~~s~~g~~I~~~k~wvlrC~aC~k~~~~---------~~k~FCp~CG~   93 (212)
                      |+-|+++.|.          +|.||+-+-+.         -...|||+||-
T Consensus       189 g~gvvpl~g~----------~C~GC~m~l~~~~~~~V~~~d~iv~CP~CgR  229 (239)
T COG1579         189 GVGVVPLEGR----------VCGGCHMKLPSQTLSKVRKKDEIVFCPYCGR  229 (239)
T ss_pred             CceEEeecCC----------cccCCeeeecHHHHHHHhcCCCCccCCccch
Confidence            5666666654          89999954331         23689999996


No 29 
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=91.34  E-value=0.3  Score=39.07  Aligned_cols=58  Identities=17%  Similarity=0.380  Sum_probs=37.7

Q ss_pred             hHHHHHHHHHhCceee------c-CCCCcce--eeeeEEEEccCccccccc-----cCccccCCCCCCCceeEE
Q 028198           41 DYAMQNVILQMGLRLL------A-PGGMQIR--QLHRWILKCHACYTITAE-----IGRIFCPKCGNGGTLRKV  100 (212)
Q Consensus        41 DfAmQNVllqmGL~~~------s-~~g~~I~--~~k~wvlrC~aC~k~~~~-----~~k~FCp~CG~~~TL~Rv  100 (212)
                      +-+=|.++..+|....      . .+...|.  ...+|.++|..|+....-     ..+..|+.||.+  |..|
T Consensus        85 g~~fk~~~~~ig~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~~~r~~~~~~~~~~C~~C~~~--l~~~  156 (157)
T PF10263_consen   85 GKEFKQWARRIGASPPRGRPNPTTCHSYEIEGKEYKKYVYRCPSCGREYKRHRRSKRKRYRCGRCGGP--LVQV  156 (157)
T ss_pred             CHHHHHHHHHHCCcccccccccccccccccccccccceEEEcCCCCCEeeeecccchhhEECCCCCCE--EEEc
Confidence            3377889999998441      1 1222222  237899999999965532     224579999964  8765


No 30 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=91.32  E-value=0.15  Score=35.53  Aligned_cols=32  Identities=31%  Similarity=0.476  Sum_probs=24.4

Q ss_pred             eEEEEccCccccccc---cCccccCCCCCCCceeEE
Q 028198           68 RWILKCHACYTITAE---IGRIFCPKCGNGGTLRKV  100 (212)
Q Consensus        68 ~wvlrC~aC~k~~~~---~~k~FCp~CG~~~TL~Rv  100 (212)
                      .-+|+|.-|++.+..   ....-||.||++ -|-|.
T Consensus         4 ~~~Y~C~~Cg~~~~~~~~~~~irCp~Cg~r-Il~K~   38 (49)
T COG1996           4 MMEYKCARCGREVELDQETRGIRCPYCGSR-ILVKE   38 (49)
T ss_pred             eEEEEhhhcCCeeehhhccCceeCCCCCcE-EEEec
Confidence            457999999998862   235789999998 55443


No 31 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=91.17  E-value=0.15  Score=32.00  Aligned_cols=25  Identities=28%  Similarity=0.562  Sum_probs=19.8

Q ss_pred             EEEccCcccccccc-CccccCCCCCC
Q 028198           70 ILKCHACYTITAEI-GRIFCPKCGNG   94 (212)
Q Consensus        70 vlrC~aC~k~~~~~-~k~FCp~CG~~   94 (212)
                      +++|..|+-++... .-..||.||.+
T Consensus         1 ~~~C~~CGy~y~~~~~~~~CP~Cg~~   26 (33)
T cd00350           1 KYVCPVCGYIYDGEEAPWVCPVCGAP   26 (33)
T ss_pred             CEECCCCCCEECCCcCCCcCcCCCCc
Confidence            37899999997653 35689999985


No 32 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=90.79  E-value=0.11  Score=41.20  Aligned_cols=24  Identities=33%  Similarity=0.886  Sum_probs=19.6

Q ss_pred             EEccCccccccccCc--cccCCCCCC
Q 028198           71 LKCHACYTITAEIGR--IFCPKCGNG   94 (212)
Q Consensus        71 lrC~aC~k~~~~~~k--~FCp~CG~~   94 (212)
                      ..|+.|++-|.++.|  ..||+||..
T Consensus        10 R~Cp~CG~kFYDLnk~PivCP~CG~~   35 (108)
T PF09538_consen   10 RTCPSCGAKFYDLNKDPIVCPKCGTE   35 (108)
T ss_pred             ccCCCCcchhccCCCCCccCCCCCCc
Confidence            479999988877664  679999975


No 33 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=90.76  E-value=0.17  Score=43.05  Aligned_cols=25  Identities=24%  Similarity=0.569  Sum_probs=22.2

Q ss_pred             EEEccCccccccccCccccCCCCCC
Q 028198           70 ILKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        70 vlrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      +++|.-|+.+....+-..||+||.+
T Consensus       134 ~~vC~vCGy~~~ge~P~~CPiCga~  158 (166)
T COG1592         134 VWVCPVCGYTHEGEAPEVCPICGAP  158 (166)
T ss_pred             EEEcCCCCCcccCCCCCcCCCCCCh
Confidence            8999999999887667899999975


No 34 
>PF04135 Nop10p:  Nucleolar RNA-binding protein, Nop10p family;  InterPro: IPR007264 H/ACA ribonucleoprotein particles (RNPs) are a family of RNA pseudouridine synthases that specify modification sites through guide RNAs. More than 100 mammalian H/ACA RNAs form an equal number of ribonucleoproteins (RNPs) by associating with the same four core proteins: Cbf5, Gar1, Nhp2 and Nop10. The function of these H/ACA RNPs is essential for biogenesis of the ribosome, splicing of precursor mRNAs (pre-mRNAs), maintenance of telomeres and probably for additional cellular processes []. Recent crystal structures of archaeal H/ACA protein complexes show how the same four proteins accommodate >100 distinct but related H/ACA RNAs []. The complex contains a stable core composed of Cbf5 and Nop10, to which Gar1 and Nhp2 subsequently bind, the complex interacts with snoRNAs []. In eukaryotes Nop10 is a nucleolar protein that is specifically associated with H/ACA snoRNAs. It is essential for normal 18S rRNA production and rRNA pseudouridylation by the ribonucleoprotein particles containing H/ACA snoRNAs (H/ACA snoRNPs). Nop10 is probably necessary for the stability of these RNPs [].; PDB: 2RFK_B 3LWR_B 2HVY_C 3HAX_C 3MQK_B 3LWO_B 3LWV_B 3HAY_C 3HJY_B 2EY4_E ....
Probab=90.71  E-value=0.34  Score=34.21  Aligned_cols=26  Identities=38%  Similarity=0.740  Sum_probs=20.1

Q ss_pred             eEEEEccCccccccccCccccCCCCCCCce
Q 028198           68 RWILKCHACYTITAEIGRIFCPKCGNGGTL   97 (212)
Q Consensus        68 ~wvlrC~aC~k~~~~~~k~FCp~CG~~~TL   97 (212)
                      .++..|.+|...|-.   +-||.||.. |+
T Consensus         3 ~~~r~c~~~~~YTLk---~~cp~cG~~-T~   28 (53)
T PF04135_consen    3 YYIRKCPGCRVYTLK---DKCPPCGGP-TE   28 (53)
T ss_dssp             EEEEECTTTCEEESS---SBBTTTSSB-SE
T ss_pred             cccccCCCCCcEeCC---CccCCCCCC-Cc
Confidence            445599999976643   579999998 65


No 35 
>PRK04351 hypothetical protein; Provisional
Probab=89.62  E-value=0.55  Score=39.05  Aligned_cols=55  Identities=22%  Similarity=0.410  Sum_probs=36.5

Q ss_pred             hHHHHHHHHHhCc-eeecCCCCcceeeeeEEEEccCcccccc-----ccCccccCCCCCCCceeEE
Q 028198           41 DYAMQNVILQMGL-RLLAPGGMQIRQLHRWILKCHACYTITA-----EIGRIFCPKCGNGGTLRKV  100 (212)
Q Consensus        41 DfAmQNVllqmGL-~~~s~~g~~I~~~k~wvlrC~aC~k~~~-----~~~k~FCp~CG~~~TL~Rv  100 (212)
                      |-.-|-+|.++|- ...+ +-..  .-+.|+|+|.+|+..+.     +..+..|..||..  |.-+
T Consensus        85 g~~fk~~~~~v~~~r~~~-~~~~--~~~~y~Y~C~~Cg~~~~r~Rr~n~~~yrCg~C~g~--L~~~  145 (149)
T PRK04351         85 DRDFKELLKQVGGPRYCP-PLPS--QKKNYLYECQSCGQQYLRKRRINTKRYRCGKCRGK--LKLI  145 (149)
T ss_pred             CHHHHHHHHHhCCCcccC-CCCC--CCceEEEECCCCCCEeeeeeecCCCcEEeCCCCcE--eeec
Confidence            4455888888873 3222 1111  33679999999997663     3457899999985  6543


No 36 
>COG2093 DNA-directed RNA polymerase, subunit E'' [Transcription]
Probab=89.50  E-value=0.17  Score=37.00  Aligned_cols=23  Identities=35%  Similarity=0.830  Sum_probs=18.9

Q ss_pred             EEccCccccccccCccccCCCCCC
Q 028198           71 LKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        71 lrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      +.|+.|.+++++- ...||.||+.
T Consensus         5 kAC~~Ck~l~~~d-~e~CP~Cgs~   27 (64)
T COG2093           5 KACKNCKRLTPED-TEICPVCGST   27 (64)
T ss_pred             HHHhhccccCCCC-CccCCCCCCc
Confidence            4699999998763 4679999997


No 37 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=89.23  E-value=0.29  Score=40.36  Aligned_cols=23  Identities=39%  Similarity=0.910  Sum_probs=17.7

Q ss_pred             EccCcccc-ccccCccccCCCCCC
Q 028198           72 KCHACYTI-TAEIGRIFCPKCGNG   94 (212)
Q Consensus        72 rC~aC~k~-~~~~~k~FCp~CG~~   94 (212)
                      -|+.|+.- |.-....|||+||..
T Consensus        30 hCp~Cg~PLF~KdG~v~CPvC~~~   53 (131)
T COG1645          30 HCPKCGTPLFRKDGEVFCPVCGYR   53 (131)
T ss_pred             hCcccCCcceeeCCeEECCCCCce
Confidence            49999954 444568999999974


No 38 
>PRK00415 rps27e 30S ribosomal protein S27e; Reviewed
Probab=88.88  E-value=0.31  Score=35.16  Aligned_cols=25  Identities=24%  Similarity=0.517  Sum_probs=17.6

Q ss_pred             EEEccCcccccc----ccCccccCCCCCC
Q 028198           70 ILKCHACYTITA----EIGRIFCPKCGNG   94 (212)
Q Consensus        70 vlrC~aC~k~~~----~~~k~FCp~CG~~   94 (212)
                      ..+|..|+.+.-    ..+...|+.||..
T Consensus        11 ~VkCp~C~n~q~vFsha~t~V~C~~Cg~~   39 (59)
T PRK00415         11 KVKCPDCGNEQVVFSHASTVVRCLVCGKT   39 (59)
T ss_pred             EEECCCCCCeEEEEecCCcEEECcccCCC
Confidence            467999987762    1236789999974


No 39 
>PRK06393 rpoE DNA-directed RNA polymerase subunit E''; Validated
Probab=88.27  E-value=0.23  Score=36.40  Aligned_cols=24  Identities=29%  Similarity=0.631  Sum_probs=19.2

Q ss_pred             EEEccCccccccccCccccCCCCCCCce
Q 028198           70 ILKCHACYTITAEIGRIFCPKCGNGGTL   97 (212)
Q Consensus        70 vlrC~aC~k~~~~~~k~FCp~CG~~~TL   97 (212)
                      .+.|.-|..++.+   ..||.||+. ++
T Consensus         5 ~~AC~~C~~i~~~---~~Cp~Cgs~-~~   28 (64)
T PRK06393          5 YRACKKCKRLTPE---KTCPVHGDE-KT   28 (64)
T ss_pred             hhhHhhCCcccCC---CcCCCCCCC-cC
Confidence            3579999999954   589999997 54


No 40 
>PRK07591 threonine synthase; Validated
Probab=88.19  E-value=0.37  Score=45.50  Aligned_cols=27  Identities=22%  Similarity=0.285  Sum_probs=22.1

Q ss_pred             eEEEEccCccccccccCccccCCCCCC
Q 028198           68 RWILKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        68 ~wvlrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      .+.|+|..|++.++......||.||..
T Consensus        16 ~~~l~C~~Cg~~~~~~~~~~C~~cg~~   42 (421)
T PRK07591         16 AVALKCRECGAEYPLGPIHVCEECFGP   42 (421)
T ss_pred             eeEEEeCCCCCcCCCCCCccCCCCCCe
Confidence            457999999999975445779999974


No 41 
>TIGR03844 cysteate_syn cysteate synthase. Members of this family are cysteate synthase, an enzyme of alternate pathway to sulfopyruvate, a precursor of coenzyme M.
Probab=88.18  E-value=0.33  Score=45.77  Aligned_cols=26  Identities=19%  Similarity=0.446  Sum_probs=21.8

Q ss_pred             EEEEccCccccccccCccccCCCCCC
Q 028198           69 WILKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        69 wvlrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      |.|+|..|++.+++.....||.||..
T Consensus         1 ~~l~C~~Cg~~~~~~~~~~C~~c~g~   26 (398)
T TIGR03844         1 YTLRCPGCGEVLPDHYTLSCPLDCGL   26 (398)
T ss_pred             CEEEeCCCCCccCCccccCCCCCCCc
Confidence            57999999999986556789999964


No 42 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=87.50  E-value=0.5  Score=30.01  Aligned_cols=28  Identities=32%  Similarity=0.618  Sum_probs=19.4

Q ss_pred             EEccCcccccccc--CccccCCCCCCCceeE
Q 028198           71 LKCHACYTITAEI--GRIFCPKCGNGGTLRK   99 (212)
Q Consensus        71 lrC~aC~k~~~~~--~k~FCp~CG~~~TL~R   99 (212)
                      |.|..|+......  ...-||.||++ .|-|
T Consensus         1 Y~C~~Cg~~~~~~~~~~irC~~CG~R-IlyK   30 (32)
T PF03604_consen    1 YICGECGAEVELKPGDPIRCPECGHR-ILYK   30 (32)
T ss_dssp             EBESSSSSSE-BSTSSTSSBSSSS-S-EEBE
T ss_pred             CCCCcCCCeeEcCCCCcEECCcCCCe-EEEe
Confidence            5789999877542  35789999998 6654


No 43 
>COG2260 Predicted Zn-ribbon RNA-binding protein [Translation, ribosomal structure and biogenesis]
Probab=87.46  E-value=0.25  Score=35.65  Aligned_cols=24  Identities=42%  Similarity=0.757  Sum_probs=18.9

Q ss_pred             EEEccCccccccccCccccCCCCCCCce
Q 028198           70 ILKCHACYTITAEIGRIFCPKCGNGGTL   97 (212)
Q Consensus        70 vlrC~aC~k~~~~~~k~FCp~CG~~~TL   97 (212)
                      +.+|..|+..|-.   +-||+||.. |.
T Consensus         5 ~rkC~~cg~YTLk---e~Cp~CG~~-t~   28 (59)
T COG2260           5 IRKCPKCGRYTLK---EKCPVCGGD-TK   28 (59)
T ss_pred             hhcCcCCCceeec---ccCCCCCCc-cc
Confidence            4579999987753   679999997 53


No 44 
>PRK08351 DNA-directed RNA polymerase subunit E''; Validated
Probab=87.42  E-value=0.3  Score=35.41  Aligned_cols=22  Identities=45%  Similarity=0.930  Sum_probs=18.0

Q ss_pred             EccCccccccccCccccCCCCCCCce
Q 028198           72 KCHACYTITAEIGRIFCPKCGNGGTL   97 (212)
Q Consensus        72 rC~aC~k~~~~~~k~FCp~CG~~~TL   97 (212)
                      .|.-|..+...   ..||.||+. +|
T Consensus         5 AC~~C~~i~~~---~~CP~Cgs~-~~   26 (61)
T PRK08351          5 ACRHCHYITTE---DRCPVCGSR-DL   26 (61)
T ss_pred             hhhhCCcccCC---CcCCCCcCC-cc
Confidence            79999999854   479999997 53


No 45 
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=87.38  E-value=0.38  Score=38.89  Aligned_cols=33  Identities=24%  Similarity=0.366  Sum_probs=25.6

Q ss_pred             eeeeEEEEccCccccccccC-ccccCCCCCCCce
Q 028198           65 QLHRWILKCHACYTITAEIG-RIFCPKCGNGGTL   97 (212)
Q Consensus        65 ~~k~wvlrC~aC~k~~~~~~-k~FCp~CG~~~TL   97 (212)
                      ..+....+|+.|.|.|.... .+-|++|+.+-||
T Consensus        64 Stkav~V~CP~C~K~TKmLGr~D~CM~C~~pLTL   97 (114)
T PF11023_consen   64 STKAVQVECPNCGKQTKMLGRVDACMHCKEPLTL   97 (114)
T ss_pred             cccceeeECCCCCChHhhhchhhccCcCCCcCcc
Confidence            34567788999999997655 4789999998443


No 46 
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=87.33  E-value=0.46  Score=48.61  Aligned_cols=30  Identities=37%  Similarity=0.671  Sum_probs=22.2

Q ss_pred             EEEEccCccccccccCccccCCCCCCCceeEEE
Q 028198           69 WILKCHACYTITAEIGRIFCPKCGNGGTLRKVA  101 (212)
Q Consensus        69 wvlrC~aC~k~~~~~~k~FCp~CG~~~TL~Rvs  101 (212)
                      =.++||-|+...+.+  ..||.||+. +|+-+-
T Consensus       461 ~~L~CH~Cg~~~~~p--~~Cp~Cgs~-~L~~~G  490 (730)
T COG1198         461 GQLRCHYCGYQEPIP--QSCPECGSE-HLRAVG  490 (730)
T ss_pred             CeeEeCCCCCCCCCC--CCCCCCCCC-eeEEec
Confidence            468899999874443  689999997 776443


No 47 
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=86.86  E-value=0.45  Score=36.28  Aligned_cols=33  Identities=21%  Similarity=0.529  Sum_probs=24.6

Q ss_pred             eeeEEEEccCcccccc------ccCccccCCCCCCCceeEE
Q 028198           66 LHRWILKCHACYTITA------EIGRIFCPKCGNGGTLRKV  100 (212)
Q Consensus        66 ~k~wvlrC~aC~k~~~------~~~k~FCp~CG~~~TL~Rv  100 (212)
                      +=.|.|+|..|+..+.      +-+...||.||.+  |+|+
T Consensus         8 MPtY~Y~c~~cg~~~dvvq~~~ddplt~ce~c~a~--~kk~   46 (82)
T COG2331           8 MPTYSYECTECGNRFDVVQAMTDDPLTTCEECGAR--LKKL   46 (82)
T ss_pred             ccceEEeecccchHHHHHHhcccCccccChhhChH--HHHh
Confidence            3479999999998774      3346789999975  5443


No 48 
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=86.81  E-value=0.55  Score=37.66  Aligned_cols=32  Identities=25%  Similarity=0.457  Sum_probs=20.9

Q ss_pred             eeeeEEEEccCcccccccc--------CccccCCCCCCCcee
Q 028198           65 QLHRWILKCHACYTITAEI--------GRIFCPKCGNGGTLR   98 (212)
Q Consensus        65 ~~k~wvlrC~aC~k~~~~~--------~k~FCp~CG~~~TL~   98 (212)
                      +...-..+| .|+..+...        ...-||.||+. .+.
T Consensus        65 ~~vp~~~~C-~Cg~~~~~~~~~~~~~~~~~~CP~Cgs~-~~~  104 (124)
T PRK00762         65 EMIPVEIEC-ECGYEGVVDEDEIDHYAAVIECPVCGNK-RAH  104 (124)
T ss_pred             EecCeeEEe-eCcCcccccccchhccccCCcCcCCCCC-CCE
Confidence            334557899 999875421        11349999987 443


No 49 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=86.37  E-value=0.36  Score=39.73  Aligned_cols=25  Identities=16%  Similarity=0.211  Sum_probs=20.2

Q ss_pred             EEEccCccccccccCc--cccCCCCCC
Q 028198           70 ILKCHACYTITAEIGR--IFCPKCGNG   94 (212)
Q Consensus        70 vlrC~aC~k~~~~~~k--~FCp~CG~~   94 (212)
                      +..|+.|++-|.++.|  ..||+||..
T Consensus         9 Kr~Cp~cg~kFYDLnk~p~vcP~cg~~   35 (129)
T TIGR02300         9 KRICPNTGSKFYDLNRRPAVSPYTGEQ   35 (129)
T ss_pred             cccCCCcCccccccCCCCccCCCcCCc
Confidence            3579999988877663  789999974


No 50 
>PRK00241 nudC NADH pyrophosphatase; Reviewed
Probab=86.00  E-value=0.81  Score=40.76  Aligned_cols=55  Identities=22%  Similarity=0.394  Sum_probs=35.2

Q ss_pred             EEccCcccccc---ccCccccCCCCCCCcee----EEEEEeCCCceEEeecCCccccccceeccC
Q 028198           71 LKCHACYTITA---EIGRIFCPKCGNGGTLR----KVAVTVGENGIVLASRRPRITLRGTKFSLP  128 (212)
Q Consensus        71 lrC~aC~k~~~---~~~k~FCp~CG~~~TL~----Rvsvsv~~~G~~~~~~k~~~n~RG~~ySlP  128 (212)
                      ..|..|+..+.   ...+..|+.||.. -.-    -|.|.|..++.+++.+++++  ....|++|
T Consensus       100 ~fC~~CG~~~~~~~~~~~~~C~~c~~~-~yp~~~paViv~V~~~~~iLL~rr~~~--~~g~wslP  161 (256)
T PRK00241        100 RFCGYCGHPMHPSKTEWAMLCPHCRER-YYPRIAPCIIVAVRRGDEILLARHPRH--RNGVYTVL  161 (256)
T ss_pred             ccccccCCCCeecCCceeEECCCCCCE-ECCCCCCEEEEEEEeCCEEEEEEccCC--CCCcEeCc
Confidence            47999997643   2236789999964 221    25555666677777666544  25688876


No 51 
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=85.80  E-value=0.55  Score=45.54  Aligned_cols=28  Identities=32%  Similarity=0.610  Sum_probs=20.5

Q ss_pred             EEEccCccccccccCccccCCCCCCCceeEE
Q 028198           70 ILKCHACYTITAEIGRIFCPKCGNGGTLRKV  100 (212)
Q Consensus        70 vlrC~aC~k~~~~~~k~FCp~CG~~~TL~Rv  100 (212)
                      .++||-|+......  ..||.||+. .|+-+
T Consensus       240 ~l~Ch~Cg~~~~~~--~~Cp~C~s~-~l~~~  267 (505)
T TIGR00595       240 KLRCHYCGYQEPIP--KTCPQCGSE-DLVYK  267 (505)
T ss_pred             eEEcCCCcCcCCCC--CCCCCCCCC-eeEee
Confidence            57788888766544  589999997 66643


No 52 
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis]
Probab=85.79  E-value=1.1  Score=42.77  Aligned_cols=41  Identities=34%  Similarity=0.644  Sum_probs=29.1

Q ss_pred             eEEEEccCccccccccCccccCCCCCCCce-eEEEEEeCCCce
Q 028198           68 RWILKCHACYTITAEIGRIFCPKCGNGGTL-RKVAVTVGENGI  109 (212)
Q Consensus        68 ~wvlrC~aC~k~~~~~~k~FCp~CG~~~TL-~Rvsvsv~~~G~  109 (212)
                      .=+++|..|+.-..-....-||.||..+-| ++||+ ||.-|-
T Consensus        55 ~~i~kC~~c~~~~~y~~~~~C~~cg~~~~l~R~VSf-VDaPGH   96 (415)
T COG5257          55 AKIYKCPECYRPECYTTEPKCPNCGAETELVRRVSF-VDAPGH   96 (415)
T ss_pred             CceEeCCCCCCCcccccCCCCCCCCCCccEEEEEEE-eeCCch
Confidence            457899999974333346789999987545 66665 777663


No 53 
>PRK06450 threonine synthase; Validated
Probab=85.63  E-value=0.51  Score=43.42  Aligned_cols=24  Identities=33%  Similarity=0.589  Sum_probs=20.2

Q ss_pred             EEccCccccccccCccccCCCCCC
Q 028198           71 LKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        71 lrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      |+|..|++.+.......||.||.+
T Consensus         4 ~~C~~Cg~~~~~~~~~~C~~cg~~   27 (338)
T PRK06450          4 EVCMKCGKERESIYEIRCKKCGGP   27 (338)
T ss_pred             eEECCcCCcCCCcccccCCcCCCE
Confidence            899999999976446689999975


No 54 
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=85.56  E-value=0.66  Score=50.07  Aligned_cols=27  Identities=33%  Similarity=0.611  Sum_probs=18.8

Q ss_pred             eeeeEEEEccCccccccccCccccCCCCCC
Q 028198           65 QLHRWILKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        65 ~~k~wvlrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      ++.....+|+.|+..+..   .|||.||.+
T Consensus       662 eVEV~~rkCPkCG~~t~~---~fCP~CGs~  688 (1337)
T PRK14714        662 EVEVGRRRCPSCGTETYE---NRCPDCGTH  688 (1337)
T ss_pred             EEEEEEEECCCCCCcccc---ccCcccCCc
Confidence            456677899999986543   377777765


No 55 
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=84.93  E-value=0.67  Score=38.56  Aligned_cols=31  Identities=26%  Similarity=0.524  Sum_probs=23.1

Q ss_pred             EEEccCcccccc---ccCccccCCCCCCCceeEEE
Q 028198           70 ILKCHACYTITA---EIGRIFCPKCGNGGTLRKVA  101 (212)
Q Consensus        70 vlrC~aC~k~~~---~~~k~FCp~CG~~~TL~Rvs  101 (212)
                      .|+|..|+....   .....-||+||+. ...|.+
T Consensus       112 ~l~C~~Cg~~~~~~~~~~l~~Cp~C~~~-~F~R~~  145 (146)
T PF07295_consen  112 TLVCENCGHEVELTHPERLPPCPKCGHT-EFTRQP  145 (146)
T ss_pred             eEecccCCCEEEecCCCcCCCCCCCCCC-eeeeCC
Confidence            589999996542   2225679999997 888765


No 56 
>PRK06260 threonine synthase; Validated
Probab=84.41  E-value=0.7  Score=43.09  Aligned_cols=26  Identities=31%  Similarity=0.584  Sum_probs=20.5

Q ss_pred             EEEEccCccccccccC-ccccCCCCCC
Q 028198           69 WILKCHACYTITAEIG-RIFCPKCGNG   94 (212)
Q Consensus        69 wvlrC~aC~k~~~~~~-k~FCp~CG~~   94 (212)
                      +.|+|..|++.++... ...||.||..
T Consensus         2 ~~~~C~~cg~~~~~~~~~~~Cp~cg~~   28 (397)
T PRK06260          2 YWLKCIECGKEYDPDEIIYTCPECGGL   28 (397)
T ss_pred             CEEEECCCCCCCCCCCccccCCCCCCe
Confidence            4699999999997543 4569999974


No 57 
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=84.18  E-value=0.96  Score=29.28  Aligned_cols=24  Identities=25%  Similarity=0.430  Sum_probs=18.9

Q ss_pred             EEccCcccccccc-----CccccCCCCCC
Q 028198           71 LKCHACYTITAEI-----GRIFCPKCGNG   94 (212)
Q Consensus        71 lrC~aC~k~~~~~-----~k~FCp~CG~~   94 (212)
                      ..|..|+++|...     ....|..||.+
T Consensus         2 r~C~~Cg~~Yh~~~~pP~~~~~Cd~cg~~   30 (36)
T PF05191_consen    2 RICPKCGRIYHIEFNPPKVEGVCDNCGGE   30 (36)
T ss_dssp             EEETTTTEEEETTTB--SSTTBCTTTTEB
T ss_pred             cCcCCCCCccccccCCCCCCCccCCCCCe
Confidence            5799999998642     24789999986


No 58 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=84.09  E-value=0.56  Score=30.17  Aligned_cols=15  Identities=40%  Similarity=1.090  Sum_probs=5.9

Q ss_pred             cccCCCCCCCceeEEE
Q 028198           86 IFCPKCGNGGTLRKVA  101 (212)
Q Consensus        86 ~FCp~CG~~~TL~Rvs  101 (212)
                      .|||.||.+ +-.++.
T Consensus         1 kfC~~CG~~-l~~~ip   15 (34)
T PF14803_consen    1 KFCPQCGGP-LERRIP   15 (34)
T ss_dssp             -B-TTT--B--EEE--
T ss_pred             CccccccCh-hhhhcC
Confidence            499999997 334443


No 59 
>PRK00420 hypothetical protein; Validated
Probab=83.86  E-value=0.59  Score=37.50  Aligned_cols=24  Identities=25%  Similarity=0.512  Sum_probs=18.4

Q ss_pred             EEccCcccccc--ccCccccCCCCCC
Q 028198           71 LKCHACYTITA--EIGRIFCPKCGNG   94 (212)
Q Consensus        71 lrC~aC~k~~~--~~~k~FCp~CG~~   94 (212)
                      ..|+.|+....  ..+..|||.||..
T Consensus        24 ~~CP~Cg~pLf~lk~g~~~Cp~Cg~~   49 (112)
T PRK00420         24 KHCPVCGLPLFELKDGEVVCPVHGKV   49 (112)
T ss_pred             CCCCCCCCcceecCCCceECCCCCCe
Confidence            46999996544  3458999999986


No 60 
>COG0267 RpmG Ribosomal protein L33 [Translation, ribosomal structure and biogenesis]
Probab=83.38  E-value=0.75  Score=32.19  Aligned_cols=31  Identities=32%  Similarity=0.676  Sum_probs=22.4

Q ss_pred             eEEEEccCcc-ccccc----------c-CccccCCCCCCCceeE
Q 028198           68 RWILKCHACY-TITAE----------I-GRIFCPKCGNGGTLRK   99 (212)
Q Consensus        68 ~wvlrC~aC~-k~~~~----------~-~k~FCp~CG~~~TL~R   99 (212)
                      .-.|.|.+|. +.|..          + -+.|||+|... ||-+
T Consensus         5 kI~L~ct~c~g~nY~t~kN~r~~~~rLelkKycp~~~kh-tlhk   47 (50)
T COG0267           5 KIKLACTACTSRNYTTTKNKRNKPERLELKKYCPVCRKH-TLHK   47 (50)
T ss_pred             eEEEEEeccCCeeEEEeeccCCCcceEEEEecCcccccE-EEEe
Confidence            5679999999 54421          1 16899999997 7754


No 61 
>PRK11032 hypothetical protein; Provisional
Probab=83.19  E-value=0.88  Score=38.56  Aligned_cols=31  Identities=29%  Similarity=0.600  Sum_probs=23.6

Q ss_pred             EEEccCcccccc---ccCccccCCCCCCCceeEEE
Q 028198           70 ILKCHACYTITA---EIGRIFCPKCGNGGTLRKVA  101 (212)
Q Consensus        70 vlrC~aC~k~~~---~~~k~FCp~CG~~~TL~Rvs  101 (212)
                      .|+|..|+....   .....-||+||+. ..+|++
T Consensus       124 ~LvC~~Cg~~~~~~~p~~i~pCp~C~~~-~F~R~~  157 (160)
T PRK11032        124 NLVCEKCHHHLAFYTPEVLPLCPKCGHD-QFQRRP  157 (160)
T ss_pred             eEEecCCCCEEEecCCCcCCCCCCCCCC-eeeeCC
Confidence            589999996543   2235779999997 888876


No 62 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=83.11  E-value=0.97  Score=28.56  Aligned_cols=25  Identities=32%  Similarity=0.683  Sum_probs=18.1

Q ss_pred             EEEccCccccccc--------cCccccCCCCCC
Q 028198           70 ILKCHACYTITAE--------IGRIFCPKCGNG   94 (212)
Q Consensus        70 vlrC~aC~k~~~~--------~~k~FCp~CG~~   94 (212)
                      .+.|+.|++.+..        ..+..||+||+.
T Consensus         2 ~~~CP~C~~~~~v~~~~~~~~~~~v~C~~C~~~   34 (38)
T TIGR02098         2 RIQCPNCKTSFRVVDSQLGANGGKVRCGKCGHV   34 (38)
T ss_pred             EEECCCCCCEEEeCHHHcCCCCCEEECCCCCCE
Confidence            3689999985532        225799999985


No 63 
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=82.94  E-value=1.6  Score=35.34  Aligned_cols=52  Identities=17%  Similarity=0.344  Sum_probs=32.1

Q ss_pred             HHHHHHHHhCceee-cCCCCcceeeeeEEEEccCcccccc------ccCccccCCCCCC
Q 028198           43 AMQNVILQMGLRLL-APGGMQIRQLHRWILKCHACYTITA------EIGRIFCPKCGNG   94 (212)
Q Consensus        43 AmQNVllqmGL~~~-s~~g~~I~~~k~wvlrC~aC~k~~~------~~~k~FCp~CG~~   94 (212)
                      .=|.++.++|-..- -.....+..+++|.|+|..|+..+.      +..+..|..||..
T Consensus        84 ~f~~~~~~~~~~~~~~~h~~~~~~~~~~~y~C~~C~~~~~~~rr~~~~~~y~C~~C~g~  142 (146)
T smart00731       84 EWKRWMRQVNGLFPERCHTFLIESVKKYPYRCTGCGQRYLRVRRSNNVSRYRCGKCGGK  142 (146)
T ss_pred             HHHHHHHHHcCCCcceEcCCcccccceEEEECCCCCCCCceEccccCcceEEcCCCCCE
Confidence            44555555554411 0122334444789999999997654      2245889999985


No 64 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=82.61  E-value=0.53  Score=47.44  Aligned_cols=21  Identities=33%  Similarity=0.831  Sum_probs=9.5

Q ss_pred             ccCccccccccCccccCCCCCC
Q 028198           73 CHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        73 C~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      |..|+...+. .-.|||.||.+
T Consensus        30 Cp~CG~~~~~-~~~fC~~CG~~   50 (645)
T PRK14559         30 CPQCGTEVPV-DEAHCPNCGAE   50 (645)
T ss_pred             CCCCCCCCCc-ccccccccCCc
Confidence            4444444332 22455555554


No 65 
>PF12773 DZR:  Double zinc ribbon
Probab=82.39  E-value=0.63  Score=30.92  Aligned_cols=22  Identities=32%  Similarity=0.806  Sum_probs=9.2

Q ss_pred             EccCcccccc--ccCccccCCCCC
Q 028198           72 KCHACYTITA--EIGRIFCPKCGN   93 (212)
Q Consensus        72 rC~aC~k~~~--~~~k~FCp~CG~   93 (212)
                      .|..|+....  .....+||.||.
T Consensus        14 fC~~CG~~l~~~~~~~~~C~~Cg~   37 (50)
T PF12773_consen   14 FCPHCGTPLPPPDQSKKICPNCGA   37 (50)
T ss_pred             CChhhcCChhhccCCCCCCcCCcC
Confidence            3444444333  222344555554


No 66 
>PF12773 DZR:  Double zinc ribbon
Probab=82.38  E-value=0.68  Score=30.77  Aligned_cols=21  Identities=38%  Similarity=0.977  Sum_probs=17.2

Q ss_pred             ccCccccccccCccccCCCCCC
Q 028198           73 CHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        73 C~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      |..|++...+ ...|||+||.+
T Consensus         1 Cp~Cg~~~~~-~~~fC~~CG~~   21 (50)
T PF12773_consen    1 CPHCGTPNPD-DAKFCPHCGTP   21 (50)
T ss_pred             CCCcCCcCCc-cccCChhhcCC
Confidence            7889987665 35899999997


No 67 
>COG0375 HybF Zn finger protein HypA/HybF (possibly regulating hydrogenase expression) [General function prediction only]
Probab=81.89  E-value=1  Score=36.42  Aligned_cols=33  Identities=30%  Similarity=0.400  Sum_probs=23.0

Q ss_pred             eeeeEEEEccCcccccc-ccCccccCCCCCCCcee
Q 028198           65 QLHRWILKCHACYTITA-EIGRIFCPKCGNGGTLR   98 (212)
Q Consensus        65 ~~k~wvlrC~aC~k~~~-~~~k~FCp~CG~~~TL~   98 (212)
                      +...-..+|.-|..... +.....||.||+. +++
T Consensus        65 e~~p~~~~C~~C~~~~~~e~~~~~CP~C~s~-~~~   98 (115)
T COG0375          65 EEEPAECWCLDCGQEVELEELDYRCPKCGSI-NLR   98 (115)
T ss_pred             EEeccEEEeccCCCeecchhheeECCCCCCC-ceE
Confidence            34455689999976554 4445669999998 554


No 68 
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=81.72  E-value=0.77  Score=32.79  Aligned_cols=15  Identities=53%  Similarity=1.057  Sum_probs=11.3

Q ss_pred             cccCCCCCCCceeEEE
Q 028198           86 IFCPKCGNGGTLRKVA  101 (212)
Q Consensus        86 ~FCp~CG~~~TL~Rvs  101 (212)
                      ..||.|||+ |..|+.
T Consensus         5 i~CP~CgnK-TR~kir   19 (55)
T PF14205_consen    5 ILCPICGNK-TRLKIR   19 (55)
T ss_pred             EECCCCCCc-cceeee
Confidence            469999999 755554


No 69 
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=81.05  E-value=0.67  Score=29.71  Aligned_cols=9  Identities=67%  Similarity=1.567  Sum_probs=7.2

Q ss_pred             cccCCCCCC
Q 028198           86 IFCPKCGNG   94 (212)
Q Consensus        86 ~FCp~CG~~   94 (212)
                      .|||.|||=
T Consensus         2 ~FCp~C~nl   10 (35)
T PF02150_consen    2 RFCPECGNL   10 (35)
T ss_dssp             -BETTTTSB
T ss_pred             eeCCCCCcc
Confidence            699999983


No 70 
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=79.94  E-value=0.86  Score=28.20  Aligned_cols=9  Identities=44%  Similarity=1.235  Sum_probs=5.4

Q ss_pred             cccCCCCCC
Q 028198           86 IFCPKCGNG   94 (212)
Q Consensus        86 ~FCp~CG~~   94 (212)
                      .|||.||.+
T Consensus         4 rfC~~CG~~   12 (32)
T PF09297_consen    4 RFCGRCGAP   12 (32)
T ss_dssp             SB-TTT--B
T ss_pred             cccCcCCcc
Confidence            699999998


No 71 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=79.13  E-value=1  Score=31.99  Aligned_cols=25  Identities=28%  Similarity=0.579  Sum_probs=20.1

Q ss_pred             EEEccCcccccc-ccCccccCCCCCC
Q 028198           70 ILKCHACYTITA-EIGRIFCPKCGNG   94 (212)
Q Consensus        70 vlrC~aC~k~~~-~~~k~FCp~CG~~   94 (212)
                      .-+|..|++.+. .....+||.||.+
T Consensus         5 ~~~C~~Cg~~~~~~dDiVvCp~Cgap   30 (54)
T PF14446_consen    5 GCKCPVCGKKFKDGDDIVVCPECGAP   30 (54)
T ss_pred             CccChhhCCcccCCCCEEECCCCCCc
Confidence            358999998875 4458999999976


No 72 
>PF14369 zf-RING_3:  zinc-finger
Probab=79.07  E-value=1.5  Score=28.10  Aligned_cols=24  Identities=29%  Similarity=0.797  Sum_probs=17.2

Q ss_pred             EEccCccccccc----cCccccCCCCCC
Q 028198           71 LKCHACYTITAE----IGRIFCPKCGNG   94 (212)
Q Consensus        71 lrC~aC~k~~~~----~~k~FCp~CG~~   94 (212)
                      |.||.|.+....    ....+||.|++.
T Consensus         3 ywCh~C~~~V~~~~~~~~~~~CP~C~~g   30 (35)
T PF14369_consen    3 YWCHQCNRFVRIAPSPDSDVACPRCHGG   30 (35)
T ss_pred             EeCccCCCEeEeCcCCCCCcCCcCCCCc
Confidence            689999976542    223469999985


No 73 
>PRK14873 primosome assembly protein PriA; Provisional
Probab=78.95  E-value=1.5  Score=44.25  Aligned_cols=29  Identities=34%  Similarity=0.762  Sum_probs=20.7

Q ss_pred             EEEccCccccccccCccccCCCCCCCceeEEEE
Q 028198           70 ILKCHACYTITAEIGRIFCPKCGNGGTLRKVAV  102 (212)
Q Consensus        70 vlrC~aC~k~~~~~~k~FCp~CG~~~TL~Rvsv  102 (212)
                      .++||-|+....   -..||.||+. .|+-+-+
T Consensus       410 ~l~Ch~CG~~~~---p~~Cp~Cgs~-~l~~~g~  438 (665)
T PRK14873        410 TPRCRWCGRAAP---DWRCPRCGSD-RLRAVVV  438 (665)
T ss_pred             eeECCCCcCCCc---CccCCCCcCC-cceeeec
Confidence            588888886432   3589999997 6765544


No 74 
>TIGR02827 RNR_anaer_Bdell anaerobic ribonucleoside-triphosphate reductase. Members of this family belong to the class III anaerobic ribonucleoside-triphosphate reductases (RNR). These glycine-radical-containing enzymes are oxygen-sensitive and operate under anaerobic conditions. The genes for this family are pair with genes for an acitivating protein that creates a glycine radical. Members of this family, though related, fall outside the scope of TIGR02487, a functionally equivalent protein set; no genome has members in both familes. Identification as RNR is supported by gene pairing with the activating protein, lack of other anaerobic RNR, and presence of an upstream regulatory element strongly conserved upstream of most RNR operons.
Probab=78.67  E-value=1.8  Score=43.36  Aligned_cols=49  Identities=18%  Similarity=0.348  Sum_probs=30.1

Q ss_pred             HHHHHHHHHh---CceeecCCCCcceeeeeEEEEccCccccccccCccccCCCCCCCceeEE
Q 028198           42 YAMQNVILQM---GLRLLAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKV  100 (212)
Q Consensus        42 fAmQNVllqm---GL~~~s~~g~~I~~~k~wvlrC~aC~k~~~~~~k~FCp~CG~~~TL~Rv  100 (212)
                      -|+.+++..+   +|...++.        .=+-+|..|+.+.... ...||+||+. .+...
T Consensus       509 ea~~~lv~~~~~~~i~Y~tin--------~~~siC~~CGy~~g~~-~~~CP~CGs~-~~ev~  560 (586)
T TIGR02827       509 DGYRKLLRVAADTGCNYFCFN--------IKITICNDCHHIDKRT-LHRCPVCGSA-NIDYG  560 (586)
T ss_pred             HHHHHHHHHHHhcCCceEEeC--------CCCeecCCCCCcCCCc-CCcCcCCCCc-cceEE
Confidence            3666665554   55555544        2245799999854322 3689999986 54433


No 75 
>PF06676 DUF1178:  Protein of unknown function (DUF1178);  InterPro: IPR009562 This family consists of several hypothetical bacterial proteins of around 150 residues in length. The function of this family is unknown.
Probab=78.37  E-value=2.3  Score=35.63  Aligned_cols=33  Identities=24%  Similarity=0.446  Sum_probs=24.3

Q ss_pred             eeEEEEccCccccccc-------------cCccccCCCCCCCceeEEE
Q 028198           67 HRWILKCHACYTITAE-------------IGRIFCPKCGNGGTLRKVA  101 (212)
Q Consensus        67 k~wvlrC~aC~k~~~~-------------~~k~FCp~CG~~~TL~Rvs  101 (212)
                      +.|-|+|. |+..|.-             ....-||.||+. .+.|..
T Consensus         2 I~y~L~C~-~gH~FEgWF~ss~~fd~Q~~~glv~CP~Cgs~-~V~K~l   47 (148)
T PF06676_consen    2 IVYDLRCE-NGHEFEGWFRSSAAFDRQQARGLVSCPVCGST-EVSKAL   47 (148)
T ss_pred             eeEEEecC-CCCccceecCCHHHHHHHHHcCCccCCCCCCC-eEeeec
Confidence            57899998 7777641             345789999997 666544


No 76 
>TIGR00354 polC DNA polymerase, archaeal type II, large subunit. This model represents the large subunit, DP2, of a two subunit novel Archaeal replicative DNA polymerase first characterized for Pyrococcus furiosus. Structure of DP2 appears to be organized as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit.
Probab=78.05  E-value=1.9  Score=45.73  Aligned_cols=29  Identities=31%  Similarity=0.508  Sum_probs=23.7

Q ss_pred             eeeeEEEEccCccccccccCccccCCCCCCCce
Q 028198           65 QLHRWILKCHACYTITAEIGRIFCPKCGNGGTL   97 (212)
Q Consensus        65 ~~k~wvlrC~aC~k~~~~~~k~FCp~CG~~~TL   97 (212)
                      ++-.-..+|+.|++.+..   ..||.||.+ |.
T Consensus       620 ~vev~~RKCPkCG~yTlk---~rCP~CG~~-Te  648 (1095)
T TIGR00354       620 EVEIAIRKCPQCGKESFW---LKCPVCGEL-TE  648 (1095)
T ss_pred             EEEEEEEECCCCCccccc---ccCCCCCCc-cc
Confidence            566778999999998753   689999998 64


No 77 
>cd01675 RNR_III Class III ribonucleotide reductase. Ribonucleotide reductase (RNR) catalyzes the reductive synthesis of deoxyribonucleotides from their corresponding ribonucleotides. It provides the precursors necessary for DNA synthesis. RNRs are separated into three classes based on their metallocofactor usage. Class I RNRs, found in eukaryotes, bacteria, and bacteriophage, use a diiron-tyrosyl radical. Class II RNRs, found in bacteria, bacteriophage, algae and archaea, use coenzyme B12 (adenosylcobalamin, AdoCbl). Class III RNRs, found in strict or facultative anaerobic bacteria, bacteriophage, and archaea, use an FeS cluster and S-adenosylmethionine to generate a glycyl radical. Many organisms have more than one class of RNR present in their genomes. All three RNRs have a ten-stranded alpha-beta barrel domain that is structurally similar to the domain of PFL (pyruvate formate lyase). The class III enzyme from phage T4 consists of two subunits, this model covers the larger subunit w
Probab=77.40  E-value=1.9  Score=42.50  Aligned_cols=30  Identities=30%  Similarity=0.657  Sum_probs=20.5

Q ss_pred             EEEccCccccccccCccccCCCCCCCceeEEE
Q 028198           70 ILKCHACYTITAEIGRIFCPKCGNGGTLRKVA  101 (212)
Q Consensus        70 vlrC~aC~k~~~~~~k~FCp~CG~~~TL~Rvs  101 (212)
                      +.+|..|+.+... ....||+||+. -+..++
T Consensus       518 ~~~C~~CG~~~~~-~~~~CP~CGs~-~~~~~~  547 (555)
T cd01675         518 IDICNDCGYIGEG-EGFKCPKCGSE-DVEVIS  547 (555)
T ss_pred             CccCCCCCCCCcC-CCCCCcCCCCc-CceEEE
Confidence            3499999986632 24789999986 344333


No 78 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=77.24  E-value=2.7  Score=29.57  Aligned_cols=45  Identities=18%  Similarity=0.420  Sum_probs=29.2

Q ss_pred             HHHHHHHhCceeecCCCCcceeeeeEEEEccCccccccc--cC-ccccCCCCCC
Q 028198           44 MQNVILQMGLRLLAPGGMQIRQLHRWILKCHACYTITAE--IG-RIFCPKCGNG   94 (212)
Q Consensus        44 mQNVllqmGL~~~s~~g~~I~~~k~wvlrC~aC~k~~~~--~~-k~FCp~CG~~   94 (212)
                      |+-.+..-|+.|+.++-...      -..|+.|+.....  .. ...||.||..
T Consensus         8 L~yka~~~G~~v~~v~~~~T------Sq~C~~CG~~~~~~~~~r~~~C~~Cg~~   55 (69)
T PF07282_consen    8 LEYKAEEYGIQVVEVDEAYT------SQTCPRCGHRNKKRRSGRVFTCPNCGFE   55 (69)
T ss_pred             HHHHHHHhCCEEEEECCCCC------ccCccCcccccccccccceEEcCCCCCE
Confidence            55667777888876653322      2468888876654  22 4678888864


No 79 
>PRK05580 primosome assembly protein PriA; Validated
Probab=77.14  E-value=1.6  Score=43.79  Aligned_cols=28  Identities=36%  Similarity=0.693  Sum_probs=19.3

Q ss_pred             EEEccCccccccccCccccCCCCCCCceeEE
Q 028198           70 ILKCHACYTITAEIGRIFCPKCGNGGTLRKV  100 (212)
Q Consensus        70 vlrC~aC~k~~~~~~k~FCp~CG~~~TL~Rv  100 (212)
                      .++||-|+......  ..||.||+. .|.-.
T Consensus       408 ~l~Ch~Cg~~~~~~--~~Cp~Cg~~-~l~~~  435 (679)
T PRK05580        408 RLRCHHCGYQEPIP--KACPECGST-DLVPV  435 (679)
T ss_pred             eEECCCCcCCCCCC--CCCCCCcCC-eeEEe
Confidence            46788888665543  579999996 55543


No 80 
>PF14319 Zn_Tnp_IS91:  Transposase zinc-binding domain
Probab=77.13  E-value=1.7  Score=34.27  Aligned_cols=27  Identities=19%  Similarity=0.443  Sum_probs=19.5

Q ss_pred             eEEEEccCcccccc---ccCccccCCCCCC
Q 028198           68 RWILKCHACYTITA---EIGRIFCPKCGNG   94 (212)
Q Consensus        68 ~wvlrC~aC~k~~~---~~~k~FCp~CG~~   94 (212)
                      .-+++|..|+...-   ...-.|||.||..
T Consensus        40 ~~~~~C~~Cg~~~~~~~SCk~R~CP~C~~~   69 (111)
T PF14319_consen   40 FHRYRCEDCGHEKIVYNSCKNRHCPSCQAK   69 (111)
T ss_pred             cceeecCCCCceEEecCcccCcCCCCCCCh
Confidence            34689999997653   2234599999987


No 81 
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=76.61  E-value=1.5  Score=37.18  Aligned_cols=52  Identities=23%  Similarity=0.489  Sum_probs=32.3

Q ss_pred             HHHHHHh-CceeecCCCCcceee--eeEEEEccCcccccc-----ccCc----cccCCCCCCCceeE
Q 028198           45 QNVILQM-GLRLLAPGGMQIRQL--HRWILKCHACYTITA-----EIGR----IFCPKCGNGGTLRK   99 (212)
Q Consensus        45 QNVllqm-GL~~~s~~g~~I~~~--k~wvlrC~aC~k~~~-----~~~k----~FCp~CG~~~TL~R   99 (212)
                      |=+|.+. ||........-++++  .+|.|+|. |+..+-     +..+    ..|.+||.+  |..
T Consensus        89 k~lm~qV~~l~~~~~h~~~~~~v~~~~~~Y~C~-C~q~~l~~RRhn~~~~g~~YrC~~C~gk--L~~  152 (156)
T COG3091          89 KLLMQQVLGLRFCRTHQFEVQSVRRTTYPYRCQ-CQQHYLRIRRHNTVRRGEVYRCGKCGGK--LVF  152 (156)
T ss_pred             HHHHHHhCCCCCCccchHHHhhccccceeEEee-cCCccchhhhcccccccceEEeccCCce--EEe
Confidence            3344443 355544444444443  48999999 998763     2234    789999986  654


No 82 
>PF09151 DUF1936:  Domain of unknown function (DUF1936);  InterPro: IPR015234 This domain is found in a set of hypothetical archaeal proteins. Its exact function has not, as yet, been defined. ; PDB: 2QH1_B 1PVM_B.
Probab=76.36  E-value=4.2  Score=26.31  Aligned_cols=25  Identities=40%  Similarity=0.818  Sum_probs=14.9

Q ss_pred             cccCCCCCCCceeEEEEEeCCCceEEeec
Q 028198           86 IFCPKCGNGGTLRKVAVTVGENGIVLASR  114 (212)
Q Consensus        86 ~FCp~CG~~~TL~Rvsvsv~~~G~~~~~~  114 (212)
                      ..||+||-. .|.  +| .++.|++.+.+
T Consensus         2 hlcpkcgvg-vl~--pv-y~~kgeikvfr   26 (36)
T PF09151_consen    2 HLCPKCGVG-VLE--PV-YNQKGEIKVFR   26 (36)
T ss_dssp             -B-TTTSSS-BEE--EE-E-TTS-EEEEE
T ss_pred             ccCCccCce-EEE--Ee-ecCCCcEEEEE
Confidence            479999986 664  33 38889886654


No 83 
>PRK07111 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=75.54  E-value=1.9  Score=44.06  Aligned_cols=26  Identities=27%  Similarity=0.709  Sum_probs=18.6

Q ss_pred             EEEccCccccccccCccccCCCCCCCcee
Q 028198           70 ILKCHACYTITAEIGRIFCPKCGNGGTLR   98 (212)
Q Consensus        70 vlrC~aC~k~~~~~~k~FCp~CG~~~TL~   98 (212)
                      +-+|..|+.+...  ...||.||+. .+.
T Consensus       680 ~~~C~~CG~~~~~--~~~CP~CG~~-~~~  705 (735)
T PRK07111        680 VDRCPVCGYLGVI--EDKCPKCGST-NIQ  705 (735)
T ss_pred             CeecCCCCCCCCc--CccCcCCCCc-cce
Confidence            4589999954433  3789999985 443


No 84 
>PLN00209 ribosomal protein S27; Provisional
Probab=75.53  E-value=1.7  Score=33.53  Aligned_cols=25  Identities=28%  Similarity=0.701  Sum_probs=17.5

Q ss_pred             EEEccCccccccc----cCccccCCCCCC
Q 028198           70 ILKCHACYTITAE----IGRIFCPKCGNG   94 (212)
Q Consensus        70 vlrC~aC~k~~~~----~~k~FCp~CG~~   94 (212)
                      ..+|.+|+.+...    .+...|..||..
T Consensus        36 ~VkCp~C~n~q~VFShA~t~V~C~~Cg~~   64 (86)
T PLN00209         36 DVKCQGCFNITTVFSHSQTVVVCGSCQTV   64 (86)
T ss_pred             EEECCCCCCeeEEEecCceEEEccccCCE
Confidence            3679999877532    236789999874


No 85 
>PF07191 zinc-ribbons_6:  zinc-ribbons;  InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family 8 highly conserved cysteine residues. The function of the family is unknown.; PDB: 2JRP_A 2JNE_A.
Probab=75.50  E-value=2.4  Score=31.58  Aligned_cols=28  Identities=32%  Similarity=0.776  Sum_probs=18.2

Q ss_pred             EEEccCccccccccCccccCCCCCCCceeEEE
Q 028198           70 ILKCHACYTITAEIGRIFCPKCGNGGTLRKVA  101 (212)
Q Consensus        70 vlrC~aC~k~~~~~~k~FCp~CG~~~TL~Rvs  101 (212)
                      .+.|.+|.+-+..  .-+||.||.+  |.++.
T Consensus        17 ~~~C~~C~~~~~~--~a~CPdC~~~--Le~Lk   44 (70)
T PF07191_consen   17 HYHCEACQKDYKK--EAFCPDCGQP--LEVLK   44 (70)
T ss_dssp             EEEETTT--EEEE--EEE-TTT-SB---EEEE
T ss_pred             EEECcccccccee--cccCCCcccH--HHHHH
Confidence            5899999998765  4799999998  77654


No 86 
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=75.38  E-value=2.7  Score=28.77  Aligned_cols=25  Identities=24%  Similarity=0.574  Sum_probs=17.2

Q ss_pred             EEEccCccccccccCc------------------cccCCCCCC
Q 028198           70 ILKCHACYTITAEIGR------------------IFCPKCGNG   94 (212)
Q Consensus        70 vlrC~aC~k~~~~~~k------------------~FCp~CG~~   94 (212)
                      +++|..|+-+|....-                  --||.||..
T Consensus         1 ky~C~~CgyvYd~~~Gd~~~~i~pGt~F~~Lp~~w~CP~C~a~   43 (47)
T PF00301_consen    1 KYQCPVCGYVYDPEKGDPENGIPPGTPFEDLPDDWVCPVCGAP   43 (47)
T ss_dssp             EEEETTTSBEEETTTBBGGGTB-TT--GGGS-TT-B-TTTSSB
T ss_pred             CcCCCCCCEEEcCCcCCcccCcCCCCCHHHCCCCCcCcCCCCc
Confidence            4789999998864321                  269999964


No 87 
>PTZ00083 40S ribosomal protein S27; Provisional
Probab=74.90  E-value=1.8  Score=33.35  Aligned_cols=25  Identities=28%  Similarity=0.635  Sum_probs=17.7

Q ss_pred             EEEccCccccccc----cCccccCCCCCC
Q 028198           70 ILKCHACYTITAE----IGRIFCPKCGNG   94 (212)
Q Consensus        70 vlrC~aC~k~~~~----~~k~FCp~CG~~   94 (212)
                      ..+|.+|+.+...    .+...|..||..
T Consensus        35 ~VkCp~C~n~q~VFShA~t~V~C~~Cg~~   63 (85)
T PTZ00083         35 DVKCPGCSQITTVFSHAQTVVLCGGCSSQ   63 (85)
T ss_pred             EEECCCCCCeeEEEecCceEEEccccCCE
Confidence            3679999977632    236789999873


No 88 
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=74.84  E-value=3  Score=29.78  Aligned_cols=31  Identities=35%  Similarity=0.830  Sum_probs=21.3

Q ss_pred             eEEEEccCcccccc-----cc----CccccCCCCCCCceeEE
Q 028198           68 RWILKCHACYTITA-----EI----GRIFCPKCGNGGTLRKV  100 (212)
Q Consensus        68 ~wvlrC~aC~k~~~-----~~----~k~FCp~CG~~~TL~Rv  100 (212)
                      .| +.|+-|+..+.     |+    .-.|||+|-.. ||..|
T Consensus         3 ~W-i~CP~CgnKTR~kir~DT~LkNfPlyCpKCK~E-tlI~v   42 (55)
T PF14205_consen    3 EW-ILCPICGNKTRLKIREDTVLKNFPLYCPKCKQE-TLIDV   42 (55)
T ss_pred             eE-EECCCCCCccceeeecCceeccccccCCCCCce-EEEEe
Confidence            35 46999995552     21    24799999998 87544


No 89 
>PRK04023 DNA polymerase II large subunit; Validated
Probab=74.36  E-value=2.5  Score=45.05  Aligned_cols=34  Identities=29%  Similarity=0.552  Sum_probs=26.3

Q ss_pred             eEEEEccCccccccccC-ccccCCCCCCCceeEEEEEeCC
Q 028198           68 RWILKCHACYTITAEIG-RIFCPKCGNGGTLRKVAVTVGE  106 (212)
Q Consensus        68 ~wvlrC~aC~k~~~~~~-k~FCp~CG~~~TL~Rvsvsv~~  106 (212)
                      +=..||..|+..|.-++ ..-||+||++     |-.||.+
T Consensus      1035 rQ~fRC~kC~~kYRR~PL~G~C~kCGg~-----lilTVh~ 1069 (1121)
T PRK04023       1035 RQEFRCTKCGAKYRRPPLSGKCPKCGGN-----LILTVHK 1069 (1121)
T ss_pred             ccceeecccCcccccCCCCCcCccCCCe-----EEEEEec
Confidence            33589999999998777 6789999997     4445544


No 90 
>TIGR00354 polC DNA polymerase, archaeal type II, large subunit. This model represents the large subunit, DP2, of a two subunit novel Archaeal replicative DNA polymerase first characterized for Pyrococcus furiosus. Structure of DP2 appears to be organized as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit.
Probab=74.09  E-value=2.4  Score=44.94  Aligned_cols=27  Identities=37%  Similarity=0.621  Sum_probs=23.0

Q ss_pred             eEEEEccCccccccccC-ccccCCCCCC
Q 028198           68 RWILKCHACYTITAEIG-RIFCPKCGNG   94 (212)
Q Consensus        68 ~wvlrC~aC~k~~~~~~-k~FCp~CG~~   94 (212)
                      +=..||..|+..|.-++ ..-||+||++
T Consensus      1010 rQ~fRC~kC~~kYRR~PL~G~C~kCGg~ 1037 (1095)
T TIGR00354      1010 RQEVRCTKCNTKYRRIPLVGKCLKCGNN 1037 (1095)
T ss_pred             ccceeecccCCccccCCCCCcccccCCe
Confidence            33589999999998777 6789999997


No 91 
>COG1110 Reverse gyrase [DNA replication, recombination, and repair]
Probab=73.74  E-value=0.97  Score=48.14  Aligned_cols=25  Identities=28%  Similarity=0.671  Sum_probs=21.3

Q ss_pred             EEEEccCccccccccCccccCCCCCC
Q 028198           69 WILKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        69 wvlrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      -+.||..|+..+.+. ..+||.||+.
T Consensus       693 tIKrC~dcg~q~~~~-~~~cP~Cgs~  717 (1187)
T COG1110         693 TIKRCRDCGEQFVDS-EDKCPRCGSR  717 (1187)
T ss_pred             HHHHHhhcCceeccc-cccCCCCCCc
Confidence            348999999998876 6699999995


No 92 
>PRK11788 tetratricopeptide repeat protein; Provisional
Probab=73.64  E-value=2.1  Score=37.77  Aligned_cols=27  Identities=22%  Similarity=0.626  Sum_probs=22.0

Q ss_pred             EEccCccccccccCccccCCCCCCCcee
Q 028198           71 LKCHACYTITAEIGRIFCPKCGNGGTLR   98 (212)
Q Consensus        71 lrC~aC~k~~~~~~k~FCp~CG~~~TL~   98 (212)
                      ++|.-|+.+.... -..||.||.-+||+
T Consensus       355 ~~c~~cg~~~~~~-~~~c~~c~~~~~~~  381 (389)
T PRK11788        355 YRCRNCGFTARTL-YWHCPSCKAWETIK  381 (389)
T ss_pred             EECCCCCCCCccc-eeECcCCCCccCcC
Confidence            4599999988764 57899999887775


No 93 
>PRK02935 hypothetical protein; Provisional
Probab=73.53  E-value=2.5  Score=34.01  Aligned_cols=30  Identities=23%  Similarity=0.370  Sum_probs=24.2

Q ss_pred             eeEEEEccCccccccccC-ccccCCCCCCCc
Q 028198           67 HRWILKCHACYTITAEIG-RIFCPKCGNGGT   96 (212)
Q Consensus        67 k~wvlrC~aC~k~~~~~~-k~FCp~CG~~~T   96 (212)
                      +.-...|+.|.|.|+... -+-|.+|+.+=|
T Consensus        67 kavqV~CP~C~K~TKmLGrvD~CM~C~~PLT   97 (110)
T PRK02935         67 KAVQVICPSCEKPTKMLGRVDACMHCNQPLT   97 (110)
T ss_pred             cceeeECCCCCchhhhccceeecCcCCCcCC
Confidence            355569999999998766 478999999833


No 94 
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=73.34  E-value=1.6  Score=29.03  Aligned_cols=9  Identities=78%  Similarity=1.685  Sum_probs=7.7

Q ss_pred             cccCCCCCC
Q 028198           86 IFCPKCGNG   94 (212)
Q Consensus        86 ~FCp~CG~~   94 (212)
                      .|||.||+-
T Consensus         1 ~FCp~Cg~~    9 (52)
T smart00661        1 KFCPKCGNM    9 (52)
T ss_pred             CCCCCCCCc
Confidence            499999985


No 95 
>PF15017 AF1Q:  Drug resistance and apoptosis regulator
Probab=73.28  E-value=1.9  Score=33.36  Aligned_cols=16  Identities=13%  Similarity=0.341  Sum_probs=12.1

Q ss_pred             ccCCCcCCCCceeeec
Q 028198           14 SYVDDECSEQSWMLRS   29 (212)
Q Consensus        14 ~~~~d~~s~~~Wi~~~   29 (212)
                      ++.++++++++|||++
T Consensus        64 eee~~ddD~gGWITPs   79 (87)
T PF15017_consen   64 EEEEEDDDGGGWITPS   79 (87)
T ss_pred             ccccccCCCCccccch
Confidence            4455667789999988


No 96 
>PRK05978 hypothetical protein; Provisional
Probab=73.09  E-value=1.1  Score=37.46  Aligned_cols=32  Identities=19%  Similarity=0.456  Sum_probs=22.0

Q ss_pred             eeEEEEccCccc--ccccc--CccccCCCCCCCceeEE
Q 028198           67 HRWILKCHACYT--ITAEI--GRIFCPKCGNGGTLRKV  100 (212)
Q Consensus        67 k~wvlrC~aC~k--~~~~~--~k~FCp~CG~~~TL~Rv  100 (212)
                      +.+..||+.|++  ++...  ..+.||+||.+  +...
T Consensus        30 rGl~grCP~CG~G~LF~g~Lkv~~~C~~CG~~--~~~~   65 (148)
T PRK05978         30 RGFRGRCPACGEGKLFRAFLKPVDHCAACGED--FTHH   65 (148)
T ss_pred             HHHcCcCCCCCCCcccccccccCCCccccCCc--cccC
Confidence            356789999984  43321  25789999987  5543


No 97 
>TIGR02487 NrdD anaerobic ribonucleoside-triphosphate reductase. This model represents the oxygen-sensitive (anaerobic, class III) ribonucleotide reductase. The mechanism of the enzyme involves a glycine-centered radical, a C-terminal zinc binding site, and a set of conserved active site cysteines and asparagines. This enzyme requires an activating component, NrdG, a radical-SAM domain containing enzyme (TIGR02491). Together the two form an alpha-2/beta-2 heterodimer.
Probab=73.03  E-value=2  Score=42.54  Aligned_cols=44  Identities=20%  Similarity=0.376  Sum_probs=26.4

Q ss_pred             HHHHHHHHH---hCceeecCCCCcceeeeeEEEEccCccccccccCccccCCCCCC
Q 028198           42 YAMQNVILQ---MGLRLLAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        42 fAmQNVllq---mGL~~~s~~g~~I~~~k~wvlrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      =|+..|...   .|+...++.        .=+-+|..|+..... ....||+||+.
T Consensus       501 eal~~lv~~a~~~~i~Y~~~n--------~~~~~C~~CG~~g~~-~~~~CP~Cgs~  547 (579)
T TIGR02487       501 EALKDITKKAMKNGIGYFGIN--------PPVDVCEDCGYTGEG-LNDKCPKCGSH  547 (579)
T ss_pred             HHHHHHHHHHHhcCCceEEec--------cCCccCCCCCCCCCC-CCCcCcCCCCc
Confidence            456655544   344544443        223579999974332 23589999986


No 98 
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=72.83  E-value=2.4  Score=27.02  Aligned_cols=23  Identities=30%  Similarity=0.512  Sum_probs=16.3

Q ss_pred             EEccCcccc--c-cccCccccCCCCC
Q 028198           71 LKCHACYTI--T-AEIGRIFCPKCGN   93 (212)
Q Consensus        71 lrC~aC~k~--~-~~~~k~FCp~CG~   93 (212)
                      .+|..|+.-  . ++-...||+.||.
T Consensus         4 ~~C~~C~~~~i~~~~~~~~~C~~Cg~   29 (33)
T PF08792_consen    4 KKCSKCGGNGIVNKEDDYEVCIFCGS   29 (33)
T ss_pred             eEcCCCCCCeEEEecCCeEEcccCCc
Confidence            468888743  3 4455789999996


No 99 
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription]
Probab=72.75  E-value=3.5  Score=37.08  Aligned_cols=57  Identities=25%  Similarity=0.376  Sum_probs=35.3

Q ss_pred             eeeEecchHHHHHHHHHhCc-eeecCCCCcceeeeeEEEEccCcccccc-cc----Ccc----ccCCCCCCCceeE
Q 028198           34 TVACITGDYAMQNVILQMGL-RLLAPGGMQIRQLHRWILKCHACYTITA-EI----GRI----FCPKCGNGGTLRK   99 (212)
Q Consensus        34 ~vac~TdDfAmQNVllqmGL-~~~s~~g~~I~~~k~wvlrC~aC~k~~~-~~----~k~----FCp~CG~~~TL~R   99 (212)
                      .+.++|.-  +.|.-.+.|. +|+.++|.      -+..+|..|+..+. +.    ...    -||.||.+ -|+.
T Consensus        93 ~~~iiTQN--iD~Lhe~AGs~~Vi~lHGs------l~~~~C~~C~~~~~~~~~~~~~~~~~~p~C~~Cg~~-~lrP  159 (250)
T COG0846          93 LLRIITQN--IDGLHERAGSKNVIELHGS------LKRVRCSKCGNQYYDEDVIKFIEDGLIPRCPKCGGP-VLRP  159 (250)
T ss_pred             ceEEEecc--cchHHHHcCCCcEEEeccc------eeeeEeCCCcCccchhhhhhhcccCCCCcCccCCCc-cccC
Confidence            45677742  3455666664 44566665      67789999986664 11    122    39999995 3443


No 100
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=72.67  E-value=1.8  Score=43.82  Aligned_cols=23  Identities=35%  Similarity=0.788  Sum_probs=16.5

Q ss_pred             EEccCccccccccCccccCCCCCC
Q 028198           71 LKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        71 lrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      .+|+.|+...++.. .||+.||.+
T Consensus         2 ~~Cp~Cg~~n~~~a-kFC~~CG~~   24 (645)
T PRK14559          2 LICPQCQFENPNNN-RFCQKCGTS   24 (645)
T ss_pred             CcCCCCCCcCCCCC-ccccccCCC
Confidence            47888887766543 588888876


No 101
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=72.59  E-value=2.8  Score=45.49  Aligned_cols=34  Identities=32%  Similarity=0.540  Sum_probs=26.4

Q ss_pred             eEEEEccCccccccccC-ccccCCCCCCCceeEEEEEeCC
Q 028198           68 RWILKCHACYTITAEIG-RIFCPKCGNGGTLRKVAVTVGE  106 (212)
Q Consensus        68 ~wvlrC~aC~k~~~~~~-k~FCp~CG~~~TL~Rvsvsv~~  106 (212)
                      +=..||..|+..|.-|+ ..-||+||++     +-.||.+
T Consensus      1251 rQ~~RC~kC~~kyRR~PL~G~C~kCGg~-----iilTv~~ 1285 (1337)
T PRK14714       1251 RQEFRCLKCGTKYRRMPLAGKCRKCGGR-----IILTVHE 1285 (1337)
T ss_pred             ccceeecccCcccccCCCCCcccccCCe-----EEEEEec
Confidence            33589999999998877 6789999996     4445544


No 102
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=72.52  E-value=1.4  Score=32.14  Aligned_cols=8  Identities=63%  Similarity=1.389  Sum_probs=5.7

Q ss_pred             cccCCCCC
Q 028198           86 IFCPKCGN   93 (212)
Q Consensus        86 ~FCp~CG~   93 (212)
                      ..||+||-
T Consensus        51 Y~Cp~CGF   58 (61)
T COG2888          51 YRCPKCGF   58 (61)
T ss_pred             eECCCcCc
Confidence            46888874


No 103
>PF13597 NRDD:  Anaerobic ribonucleoside-triphosphate reductase; PDB: 1HK8_A 1H78_A 1H7A_A 1H79_A 1H7B_A.
Probab=72.50  E-value=1.9  Score=42.51  Aligned_cols=23  Identities=43%  Similarity=0.768  Sum_probs=11.8

Q ss_pred             EEEccCccccccccCccccCCCCCC
Q 028198           70 ILKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        70 vlrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      +-+|..|+.+...  ...||+||++
T Consensus       491 ~~~C~~CG~~~~~--~~~CP~CGs~  513 (546)
T PF13597_consen  491 IDICPDCGYIGGE--GDKCPKCGSE  513 (546)
T ss_dssp             EEEETTT---S----EEE-CCC---
T ss_pred             cccccCCCcCCCC--CCCCCCCCCc
Confidence            5689999987765  5789999997


No 104
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=72.05  E-value=2.2  Score=29.60  Aligned_cols=25  Identities=32%  Similarity=0.752  Sum_probs=18.4

Q ss_pred             EEEccCcccccccc------------------CccccCCCCCC
Q 028198           70 ILKCHACYTITAEI------------------GRIFCPKCGNG   94 (212)
Q Consensus        70 vlrC~aC~k~~~~~------------------~k~FCp~CG~~   94 (212)
                      +++|..|+-+|...                  .---||.||..
T Consensus         1 ~y~C~~CgyiYd~~~Gd~~~~i~pGt~f~~Lp~~w~CP~C~a~   43 (50)
T cd00730           1 KYECRICGYIYDPAEGDPDEGIPPGTPFEDLPDDWVCPVCGAG   43 (50)
T ss_pred             CcCCCCCCeEECCCCCCcccCcCCCCCHhHCCCCCCCCCCCCc
Confidence            37899999998741                  12279999975


No 105
>PF03119 DNA_ligase_ZBD:  NAD-dependent DNA ligase C4 zinc finger domain;  InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in NAD-dependent DNA ligases. DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor []. This domain is a small zinc binding motif that is presumably DNA binding. It is found only in NAD-dependent DNA ligases. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003911 DNA ligase (NAD+) activity, 0006260 DNA replication, 0006281 DNA repair; PDB: 1DGS_A 1V9P_B 2OWO_A.
Probab=72.04  E-value=2.2  Score=26.13  Aligned_cols=8  Identities=50%  Similarity=1.377  Sum_probs=4.4

Q ss_pred             ccCCCCCC
Q 028198           87 FCPKCGNG   94 (212)
Q Consensus        87 FCp~CG~~   94 (212)
                      +||.||++
T Consensus         1 ~CP~C~s~    8 (28)
T PF03119_consen    1 TCPVCGSK    8 (28)
T ss_dssp             B-TTT--B
T ss_pred             CcCCCCCE
Confidence            69999997


No 106
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=71.60  E-value=1.8  Score=31.26  Aligned_cols=22  Identities=36%  Similarity=0.914  Sum_probs=13.4

Q ss_pred             EEEccCccccccccCccccCCCCCC
Q 028198           70 ILKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        70 vlrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      +.||..|.+....   ..||+||-.
T Consensus        36 I~RC~~CRk~~~~---Y~CP~CGF~   57 (59)
T PRK14890         36 IYRCEKCRKQSNP---YTCPKCGFE   57 (59)
T ss_pred             EeechhHHhcCCc---eECCCCCCc
Confidence            4555555554433   469999853


No 107
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=71.49  E-value=1.8  Score=31.46  Aligned_cols=31  Identities=26%  Similarity=0.524  Sum_probs=22.4

Q ss_pred             EEEccCcccccc-c--cCccccCCCCCCCceeEEE
Q 028198           70 ILKCHACYTITA-E--IGRIFCPKCGNGGTLRKVA  101 (212)
Q Consensus        70 vlrC~aC~k~~~-~--~~k~FCp~CG~~~TL~Rvs  101 (212)
                      .-+|++|+..-. .  ..+--||.||+. ++.|.+
T Consensus         9 ~~~CtSCg~~i~p~e~~v~F~CPnCGe~-~I~Rc~   42 (61)
T COG2888           9 PPVCTSCGREIAPGETAVKFPCPNCGEV-EIYRCA   42 (61)
T ss_pred             CceeccCCCEeccCCceeEeeCCCCCce-eeehhh
Confidence            568999998762 2  225669999987 776654


No 108
>PF14353 CpXC:  CpXC protein
Probab=71.49  E-value=3.7  Score=32.26  Aligned_cols=9  Identities=44%  Similarity=1.339  Sum_probs=5.9

Q ss_pred             cccCCCCCC
Q 028198           86 IFCPKCGNG   94 (212)
Q Consensus        86 ~FCp~CG~~   94 (212)
                      ..||.||..
T Consensus        39 ~~CP~Cg~~   47 (128)
T PF14353_consen   39 FTCPSCGHK   47 (128)
T ss_pred             EECCCCCCc
Confidence            457777765


No 109
>PRK04023 DNA polymerase II large subunit; Validated
Probab=71.47  E-value=2.2  Score=45.49  Aligned_cols=10  Identities=40%  Similarity=0.468  Sum_probs=7.4

Q ss_pred             CCceecCCCC
Q 028198          139 KNLILREDQL  148 (212)
Q Consensus       139 ~~~IL~EDQ~  148 (212)
                      .+|+-.|||+
T Consensus       773 G~pL~~~dQi  782 (1121)
T PRK04023        773 GNPLESEDQI  782 (1121)
T ss_pred             CCCCCCccce
Confidence            3788888883


No 110
>PRK11823 DNA repair protein RadA; Provisional
Probab=71.42  E-value=3  Score=39.91  Aligned_cols=31  Identities=26%  Similarity=0.475  Sum_probs=25.4

Q ss_pred             eEEEEccCccccccccCccccCCCCCCCceeE
Q 028198           68 RWILKCHACYTITAEIGRIFCPKCGNGGTLRK   99 (212)
Q Consensus        68 ~wvlrC~aC~k~~~~~~k~FCp~CG~~~TL~R   99 (212)
                      +-.|+|..|+..+.. ..-.||.||.-+|+..
T Consensus         5 ~~~y~C~~Cg~~~~~-~~g~Cp~C~~w~t~~e   35 (446)
T PRK11823          5 KTAYVCQECGAESPK-WLGRCPECGAWNTLVE   35 (446)
T ss_pred             CCeEECCcCCCCCcc-cCeeCcCCCCccceee
Confidence            457999999987765 3567999999889976


No 111
>PRK07218 replication factor A; Provisional
Probab=71.40  E-value=5.8  Score=38.26  Aligned_cols=69  Identities=14%  Similarity=0.235  Sum_probs=42.1

Q ss_pred             hHHHHHHHHHhCceeecCCCC--cceeeeeEEEEccCccccccccCccccCCCCCC--CceeEEEEEeCCC-ceEEe
Q 028198           41 DYAMQNVILQMGLRLLAPGGM--QIRQLHRWILKCHACYTITAEIGRIFCPKCGNG--GTLRKVAVTVGEN-GIVLA  112 (212)
Q Consensus        41 DfAmQNVllqmGL~~~s~~g~--~I~~~k~wvlrC~aC~k~~~~~~k~FCp~CG~~--~TL~Rvsvsv~~~-G~~~~  112 (212)
                      ...+.+++-.-|.--+.+.|.  .|+.-...+.||+.|.++-..   -.||.||..  --..|+...+|+. |.+..
T Consensus       266 ~~~I~e~~~~~g~~~Vev~G~Iv~i~~gsgli~rCP~C~r~v~~---~~C~~hG~ve~~~dlrik~vLDDGtg~~~~  339 (423)
T PRK07218        266 RLKIREAVERGGIFDVELVGNIISVRDGSGLIERCPECGRVIQK---GQCRSHGAVEGEDDLRIKAILDDGTGSVTV  339 (423)
T ss_pred             ccchhhhhccCCcceEEEEEEEEEeccCCcceecCcCccccccC---CcCCCCCCcCCeeeeEEEEEEECCCCeEEE
Confidence            345555444433321333443  345667889999999997743   689999954  1246777777654 65544


No 112
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=71.05  E-value=3  Score=34.02  Aligned_cols=28  Identities=25%  Similarity=0.663  Sum_probs=20.5

Q ss_pred             eeEEEEccCccccccc--------cC-ccccCCCCCC
Q 028198           67 HRWILKCHACYTITAE--------IG-RIFCPKCGNG   94 (212)
Q Consensus        67 k~wvlrC~aC~k~~~~--------~~-k~FCp~CG~~   94 (212)
                      -.-.|.|+.|+..+..        ++ .-.||.||..
T Consensus        96 ~~~~Y~Cp~C~~~y~~~ea~~~~d~~~~f~Cp~Cg~~  132 (147)
T smart00531       96 NNAYYKCPNCQSKYTFLEANQLLDMDGTFTCPRCGEE  132 (147)
T ss_pred             CCcEEECcCCCCEeeHHHHHHhcCCCCcEECCCCCCE
Confidence            3558999999977742        11 2579999986


No 113
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=70.53  E-value=6.3  Score=32.11  Aligned_cols=43  Identities=23%  Similarity=0.529  Sum_probs=28.4

Q ss_pred             eeEEEEccCcccccccc--CccccCCCCCCCc-----eeEEEEEeC-CCceE
Q 028198           67 HRWILKCHACYTITAEI--GRIFCPKCGNGGT-----LRKVAVTVG-ENGIV  110 (212)
Q Consensus        67 k~wvlrC~aC~k~~~~~--~k~FCp~CG~~~T-----L~Rvsvsv~-~~G~~  110 (212)
                      .-|-..|+.|.+.....  ...+|++|+.. .     .-++.+.+. ..|.+
T Consensus        31 ~~~Y~aC~~C~kkv~~~~~~~~~C~~C~~~-~~~~~~ry~l~~~i~D~Tg~~   81 (166)
T cd04476          31 NWWYPACPGCNKKVVEEGNGTYRCEKCNKS-VPNPEYRYILSLNVADHTGEA   81 (166)
T ss_pred             CeEEccccccCcccEeCCCCcEECCCCCCc-CCCccEEEEEEEEEEeCCCCE
Confidence            35566799999765443  46899999984 2     345555554 44665


No 114
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=70.45  E-value=2.7  Score=30.44  Aligned_cols=31  Identities=26%  Similarity=0.607  Sum_probs=22.3

Q ss_pred             EEEccCccccccc---cCccccCCCCCCCceeEEE
Q 028198           70 ILKCHACYTITAE---IGRIFCPKCGNGGTLRKVA  101 (212)
Q Consensus        70 vlrC~aC~k~~~~---~~k~FCp~CG~~~TL~Rvs  101 (212)
                      ...|..|+..-..   ..+-.||.||.. +|.|.+
T Consensus         7 ~~~CtSCg~~i~~~~~~~~F~CPnCG~~-~I~RC~   40 (59)
T PRK14890          7 PPKCTSCGIEIAPREKAVKFLCPNCGEV-IIYRCE   40 (59)
T ss_pred             CccccCCCCcccCCCccCEeeCCCCCCe-eEeech
Confidence            3479999976553   236689999986 677754


No 115
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=70.28  E-value=2.3  Score=29.29  Aligned_cols=22  Identities=32%  Similarity=0.875  Sum_probs=16.2

Q ss_pred             EccCccccccc---------cCccccCCCCC
Q 028198           72 KCHACYTITAE---------IGRIFCPKCGN   93 (212)
Q Consensus        72 rC~aC~k~~~~---------~~k~FCp~CG~   93 (212)
                      .|.||+-.-+.         ....|||.||-
T Consensus        24 ~C~gC~~~l~~~~~~~i~~~~~i~~Cp~CgR   54 (56)
T PF02591_consen   24 TCSGCHMELPPQELNEIRKGDEIVFCPNCGR   54 (56)
T ss_pred             ccCCCCEEcCHHHHHHHHcCCCeEECcCCCc
Confidence            89999955432         23589999994


No 116
>COG1933 Archaeal DNA polymerase II, large subunit [DNA replication, recombination, and repair]
Probab=70.16  E-value=2.7  Score=38.15  Aligned_cols=27  Identities=30%  Similarity=0.535  Sum_probs=21.6

Q ss_pred             eEEEEccCccccccccC-ccccCCCCCC
Q 028198           68 RWILKCHACYTITAEIG-RIFCPKCGNG   94 (212)
Q Consensus        68 ~wvlrC~aC~k~~~~~~-k~FCp~CG~~   94 (212)
                      +-..||.+|.+.+.-++ ..-||+||+.
T Consensus       165 rq~~rc~~c~~k~rr~pl~g~c~kcg~~  192 (253)
T COG1933         165 RQEFRCVKCNTKFRRPPLDGKCPICGGK  192 (253)
T ss_pred             hheeehHhhhhhhcCCCccccccccCCe
Confidence            34589999999886544 5789999994


No 117
>PF13638 PIN_4:  PIN domain; PDB: 2HWW_C 2HWX_A 2DOK_B 2HWY_B 2WP8_J.
Probab=69.37  E-value=5  Score=30.86  Aligned_cols=27  Identities=15%  Similarity=0.137  Sum_probs=19.6

Q ss_pred             CceeeEecchHHHHHHHHHhCceeecC
Q 028198           32 ESTVACITGDYAMQNVILQMGLRLLAP   58 (212)
Q Consensus        32 ~~~vac~TdDfAmQNVllqmGL~~~s~   58 (212)
                      ...|+++|.|..|.+.|...||..+++
T Consensus       106 ~~~vvLvT~D~~l~~~A~~~gi~~~~~  132 (133)
T PF13638_consen  106 GRKVVLVTNDKNLRLKARAEGIPAVSY  132 (133)
T ss_dssp             CEEEEEEE--HHHHHHHHHTT--EE--
T ss_pred             CCeEEEEeCCHHHHHHHhhcccccccC
Confidence            568999999999999999999998765


No 118
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=69.14  E-value=3.7  Score=32.99  Aligned_cols=38  Identities=21%  Similarity=0.452  Sum_probs=25.2

Q ss_pred             EccCcccc--ccccCccccCCCCCCCceeEE--------EEEeCCCceEE
Q 028198           72 KCHACYTI--TAEIGRIFCPKCGNGGTLRKV--------AVTVGENGIVL  111 (212)
Q Consensus        72 rC~aC~k~--~~~~~k~FCp~CG~~~TL~Rv--------svsv~~~G~~~  111 (212)
                      .|+.|.-.  |.+.....||.||+.  -...        .+..|+||+++
T Consensus         4 ~CP~C~seytY~dg~~~iCpeC~~E--W~~~~~~~~~~~~~~kDsnG~~L   51 (109)
T TIGR00686         4 PCPKCNSEYTYHDGTQLICPSCLYE--WNENEVNDDDDELIVKDCNGNLL   51 (109)
T ss_pred             cCCcCCCcceEecCCeeECcccccc--ccccccccccCCceEEcCCCCCc
Confidence            58999854  445557889999986  2211        24568888753


No 119
>PRK08270 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=69.04  E-value=3.4  Score=41.77  Aligned_cols=43  Identities=23%  Similarity=0.431  Sum_probs=29.2

Q ss_pred             HHHHHHHHHh----CceeecCCCCcceeeeeEEEEccCccccccccCccccCCCCCC
Q 028198           42 YAMQNVILQM----GLRLLAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        42 fAmQNVllqm----GL~~~s~~g~~I~~~k~wvlrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      =|+.++...+    ++...+++        .=+-+|..|+.+...  ...||+||+.
T Consensus       602 ~a~~~lv~~~~~~~~i~Y~~in--------~~~~~C~~CG~~~g~--~~~CP~CG~~  648 (656)
T PRK08270        602 EACKKLVKKALENYRLPYITIT--------PTFSICPKHGYLSGE--HEFCPKCGEE  648 (656)
T ss_pred             HHHHHHHHHHHHhCCCceEEeC--------CCCcccCCCCCcCCC--CCCCcCCcCc
Confidence            5777777754    46665554        223479999975433  4789999975


No 120
>COG4031 Predicted metal-binding protein [General function prediction only]
Probab=68.55  E-value=3.6  Score=36.43  Aligned_cols=32  Identities=31%  Similarity=0.563  Sum_probs=21.3

Q ss_pred             EEccCccccccccCccccCCCCCCCceeEEEEEeCC
Q 028198           71 LKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGE  106 (212)
Q Consensus        71 lrC~aC~k~~~~~~k~FCp~CG~~~TL~Rvsvsv~~  106 (212)
                      ++| .|+..-+.+  .||+.||.+ ----+-|++++
T Consensus         1 ~~C-rCG~~l~~p--~~Cl~Cg~~-~av~~~vy~~~   32 (227)
T COG4031           1 LIC-RCGAELSSP--AFCLNCGRR-HAVGCGVYVSE   32 (227)
T ss_pred             Ccc-ccCCccccc--chhcccCCc-ceeEeeeeccc
Confidence            468 899766554  899999987 33334444443


No 121
>PRK14715 DNA polymerase II large subunit; Provisional
Probab=68.16  E-value=3.8  Score=45.00  Aligned_cols=25  Identities=28%  Similarity=0.679  Sum_probs=21.5

Q ss_pred             EEEEccCccccccccC-ccccCCCCCC
Q 028198           69 WILKCHACYTITAEIG-RIFCPKCGNG   94 (212)
Q Consensus        69 wvlrC~aC~k~~~~~~-k~FCp~CG~~   94 (212)
                      =..|| .|+..|.-++ ..-||+||++
T Consensus      1541 Q~~RC-kC~~kyRR~PL~G~C~kCGg~ 1566 (1627)
T PRK14715       1541 QEFRC-KCGAKYRRVPLKGKCPKCGSK 1566 (1627)
T ss_pred             cceee-cCCCccccCCCCCcCcccCCe
Confidence            35899 9999998776 6789999997


No 122
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=68.04  E-value=2.6  Score=39.58  Aligned_cols=28  Identities=29%  Similarity=0.580  Sum_probs=23.1

Q ss_pred             EEccCccccccccCccccCCCCCCCceeE
Q 028198           71 LKCHACYTITAEIGRIFCPKCGNGGTLRK   99 (212)
Q Consensus        71 lrC~aC~k~~~~~~k~FCp~CG~~~TL~R   99 (212)
                      |+|..|+..+.. ..-.||.||.=+||..
T Consensus         1 ~~c~~cg~~~~~-~~g~cp~c~~w~~~~e   28 (372)
T cd01121           1 YVCSECGYVSPK-WLGKCPECGEWNTLVE   28 (372)
T ss_pred             CCCCCCCCCCCC-ccEECcCCCCceeeee
Confidence            589999987765 4567999998889876


No 123
>PF12677 DUF3797:  Domain of unknown function (DUF3797);  InterPro: IPR024256 This presumed domain is functionally uncharacterised. This domain family is found in bacteria and viruses, and is approximately 50 amino acids in length. There is a conserved CGN sequence motif.
Probab=67.78  E-value=5.5  Score=27.88  Aligned_cols=21  Identities=43%  Similarity=0.835  Sum_probs=13.8

Q ss_pred             ccccCCCCCCCceeEEEEEeCCCceEEe
Q 028198           85 RIFCPKCGNGGTLRKVAVTVGENGIVLA  112 (212)
Q Consensus        85 k~FCp~CG~~~TL~Rvsvsv~~~G~~~~  112 (212)
                      ..+||.|||.    +|   .+..|++++
T Consensus        13 Y~~Cp~CGN~----~v---GngEG~liV   33 (49)
T PF12677_consen   13 YCKCPKCGND----KV---GNGEGTLIV   33 (49)
T ss_pred             hccCcccCCc----Ee---ecCcceEEE
Confidence            4689999997    22   255566543


No 124
>PRK08579 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=67.69  E-value=2.9  Score=42.15  Aligned_cols=46  Identities=22%  Similarity=0.411  Sum_probs=28.9

Q ss_pred             chHHHHHHHHHh---CceeecCCCCcceeeeeEEEEccCccccccccCccccCCCCCC
Q 028198           40 GDYAMQNVILQM---GLRLLAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        40 dDfAmQNVllqm---GL~~~s~~g~~I~~~k~wvlrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      +=-|+..+...+   ++...++.        .=+-+|..|+..+... ...||+||+.
T Consensus       543 n~~al~~lv~~~~~~~i~Y~~in--------p~~~~C~~CG~~~~g~-~~~CP~CGs~  591 (625)
T PRK08579        543 DPEALAKLTKRIMNTKLVYWSYT--------PAITVCNKCGRSTTGL-YTRCPRCGSE  591 (625)
T ss_pred             CHHHHHHHHHHHHhcCCceEEeC--------CCCccCCCCCCccCCC-CCcCcCCCCc
Confidence            446777777775   23333332        2245799999854332 5789999985


No 125
>PRK12366 replication factor A; Reviewed
Probab=67.64  E-value=6.8  Score=39.34  Aligned_cols=48  Identities=25%  Similarity=0.497  Sum_probs=30.0

Q ss_pred             ceeeeeEEEEccCccccccc-cCccccCCCCCCC--ceeEEEEEeCCC-ceE
Q 028198           63 IRQLHRWILKCHACYTITAE-IGRIFCPKCGNGG--TLRKVAVTVGEN-GIV  110 (212)
Q Consensus        63 I~~~k~wvlrC~aC~k~~~~-~~k~FCp~CG~~~--TL~Rvsvsv~~~-G~~  110 (212)
                      |+.-..|..+|+.|.|.-.. ...-.||.||...  -+-++++.+++. |.+
T Consensus       525 i~~~~~~y~aCp~CnkKv~~~~g~~~C~~c~~~~p~~~~~l~~~i~D~TG~~  576 (637)
T PRK12366        525 IRKQKIILYLCPNCRKRVEEVDGEYICEFCGEVEPNELLMLNFTLDDGTGTI  576 (637)
T ss_pred             EeCCCEEEecccccCeEeEcCCCcEECCCCCCCCCcEEEEEEEEEEcCCCCE
Confidence            34445688999999976543 2345799999731  223455666544 665


No 126
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=67.60  E-value=5  Score=35.98  Aligned_cols=40  Identities=33%  Similarity=0.401  Sum_probs=16.3

Q ss_pred             EEEEccCccccccccCccccCCCCCCCceeEEEEEeCCCce
Q 028198           69 WILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENGI  109 (212)
Q Consensus        69 wvlrC~aC~k~~~~~~k~FCp~CG~~~TL~Rvsvsv~~~G~  109 (212)
                      -.+.|.-|+....- .+.-||.|||..-.+-..+++++++.
T Consensus       196 R~L~Cs~C~t~W~~-~R~~Cp~Cg~~~~~~l~~~~~e~~~~  235 (290)
T PF04216_consen  196 RYLHCSLCGTEWRF-VRIKCPYCGNTDHEKLEYFTVEGEPA  235 (290)
T ss_dssp             EEEEETTT--EEE---TTS-TTT---SS-EEE--------S
T ss_pred             EEEEcCCCCCeeee-cCCCCcCCCCCCCcceeeEecCCCCc
Confidence            35889999987754 47889999997433333333444443


No 127
>cd01407 SIR2-fam SIR2 family of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose. Sir2 proteins, also known as sirtuins, are found in all eukaryotes and many archaea and prokaryotes and have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The oligomerization state of Sir2 appears to be organism-dependent, sometimes occurring as a monomer and sometimes as a multimer.
Probab=67.50  E-value=4.7  Score=34.54  Aligned_cols=41  Identities=22%  Similarity=0.397  Sum_probs=24.7

Q ss_pred             HHHhCce-eecCCCCcceeeeeEEEEccCcccccccc---------CccccCCCCCC
Q 028198           48 ILQMGLR-LLAPGGMQIRQLHRWILKCHACYTITAEI---------GRIFCPKCGNG   94 (212)
Q Consensus        48 llqmGL~-~~s~~g~~I~~~k~wvlrC~aC~k~~~~~---------~k~FCp~CG~~   94 (212)
                      ..+.|.+ |+.++|.      ...++|..|.+.+...         ...-||.||..
T Consensus        92 ~~~aG~~~v~elHG~------~~~~~C~~C~~~~~~~~~~~~~~~~~~p~C~~Cg~~  142 (218)
T cd01407          92 HQRAGSPKVIELHGS------LFRVRCTKCGKEYPRDELQADIDREEVPRCPKCGGL  142 (218)
T ss_pred             HHHcCCCCEEECcCC------cCcceeCCCcCCCcHHHHhHhhccCCCCcCCCCCCc
Confidence            4444543 5555554      4457899998765421         12469999874


No 128
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=67.50  E-value=2.2  Score=33.12  Aligned_cols=18  Identities=33%  Similarity=0.866  Sum_probs=14.8

Q ss_pred             ccccCCCCCCCceeEEEEE
Q 028198           85 RIFCPKCGNGGTLRKVAVT  103 (212)
Q Consensus        85 k~FCp~CG~~~TL~Rvsvs  103 (212)
                      +.+||.||.. +++|+++-
T Consensus        35 ky~Cp~Cgk~-~vkR~a~G   52 (90)
T PF01780_consen   35 KYTCPFCGKT-SVKRVATG   52 (90)
T ss_dssp             -BEESSSSSS-EEEEEETT
T ss_pred             CCcCCCCCCc-eeEEeeeE
Confidence            6789999998 89999863


No 129
>PRK00504 rpmG 50S ribosomal protein L33; Validated
Probab=66.73  E-value=6.4  Score=27.38  Aligned_cols=31  Identities=32%  Similarity=0.747  Sum_probs=21.5

Q ss_pred             eEEEEccCccccc-c---c--------cCccccCCCCCCCceeE
Q 028198           68 RWILKCHACYTIT-A---E--------IGRIFCPKCGNGGTLRK   99 (212)
Q Consensus        68 ~wvlrC~aC~k~~-~---~--------~~k~FCp~CG~~~TL~R   99 (212)
                      .-.|.|..|.... .   .        .-+.|||.|... ||-+
T Consensus         5 ~i~L~C~~c~~rnY~t~KNk~~~~~rLelkKycp~c~kh-tlhk   47 (50)
T PRK00504          5 KITLACTECKSRNYTTTKNKKNTPERLELKKFCPRCNKH-TLHK   47 (50)
T ss_pred             EEEEEEcCCCCccEeEcCCCCCCCceEEEECcCCCCCCe-Eeee
Confidence            5678999998432 1   0        126899999997 8753


No 130
>PRK08402 replication factor A; Reviewed
Probab=66.72  E-value=9.8  Score=35.85  Aligned_cols=45  Identities=13%  Similarity=0.299  Sum_probs=30.3

Q ss_pred             eeEEEEccCcccccc-c--cCccccCCCC--CCCceeEEEEEeCCC-ceEE
Q 028198           67 HRWILKCHACYTITA-E--IGRIFCPKCG--NGGTLRKVAVTVGEN-GIVL  111 (212)
Q Consensus        67 k~wvlrC~aC~k~~~-~--~~k~FCp~CG--~~~TL~Rvsvsv~~~-G~~~  111 (212)
                      ..|..+|+.|.|... +  ...-.|+.||  .+.-.-.+++.+++. |.+-
T Consensus       209 ~~~y~aCp~CnKkv~~~~~~~~~~Ce~~~~v~p~~ryil~~~l~D~TG~~~  259 (355)
T PRK08402        209 VLVYDACPECRRKVDYDPATDTWICPEHGEVEPIKITILDFGLDDGTGYIR  259 (355)
T ss_pred             CeeEecCCCCCeEEEEecCCCCEeCCCCCCcCcceeEEEEEEEEcCCCcEE
Confidence            348899999998764 2  2356899999  552334566666544 7663


No 131
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=66.68  E-value=3.5  Score=24.77  Aligned_cols=21  Identities=33%  Similarity=0.695  Sum_probs=12.5

Q ss_pred             ccCcccccccc---CccccCCCCC
Q 028198           73 CHACYTITAEI---GRIFCPKCGN   93 (212)
Q Consensus        73 C~aC~k~~~~~---~k~FCp~CG~   93 (212)
                      |..|+..-...   ..--||.||.
T Consensus         1 C~sC~~~i~~r~~~v~f~CPnCG~   24 (24)
T PF07754_consen    1 CTSCGRPIAPREQAVPFPCPNCGF   24 (24)
T ss_pred             CccCCCcccCcccCceEeCCCCCC
Confidence            67775443321   2456999983


No 132
>PRK10220 hypothetical protein; Provisional
Probab=66.65  E-value=4.6  Score=32.58  Aligned_cols=38  Identities=24%  Similarity=0.608  Sum_probs=24.8

Q ss_pred             EccCcccc--ccccCccccCCCCCCCceeEE--------EEEeCCCceEE
Q 028198           72 KCHACYTI--TAEIGRIFCPKCGNGGTLRKV--------AVTVGENGIVL  111 (212)
Q Consensus        72 rC~aC~k~--~~~~~k~FCp~CG~~~TL~Rv--------svsv~~~G~~~  111 (212)
                      .|+.|.-.  |.+.....||-||+.  -..-        .+..|++|+++
T Consensus         5 ~CP~C~seytY~d~~~~vCpeC~hE--W~~~~~~~~~~~~~vkDsnG~~L   52 (111)
T PRK10220          5 HCPKCNSEYTYEDNGMYICPECAHE--WNDAEPAQESDELIVKDANGNLL   52 (111)
T ss_pred             cCCCCCCcceEcCCCeEECCcccCc--CCccccccccCCceEEcCCCCCc
Confidence            58888844  455567899999975  2111        14568888753


No 133
>PRK03988 translation initiation factor IF-2 subunit beta; Validated
Probab=66.55  E-value=5.3  Score=32.98  Aligned_cols=48  Identities=23%  Similarity=0.446  Sum_probs=30.2

Q ss_pred             eeeEecchH---HHHHHHHHhCceee------cCCCCcceeeeeEEEEccCcccccc
Q 028198           34 TVACITGDY---AMQNVILQMGLRLL------APGGMQIRQLHRWILKCHACYTITA   81 (212)
Q Consensus        34 ~vac~TdDf---AmQNVllqmGL~~~------s~~g~~I~~~k~wvlrC~aC~k~~~   81 (212)
                      ...+++..|   -||++|...=-.+|      +++...|++-+.|.++|.||+...+
T Consensus        78 ~~lii~G~~~~~~i~~~L~~yI~~yVlC~~C~spdT~l~k~~r~~~l~C~ACGa~~~  134 (138)
T PRK03988         78 GRLILQGKFSPRVINEKIDRYVKEYVICPECGSPDTKLIKEGRIWVLKCEACGAETP  134 (138)
T ss_pred             CEEEEEEeeCHHHHHHHHHHHHHhcEECCCCCCCCcEEEEcCCeEEEEcccCCCCCc
Confidence            344555444   46777666433332      6777777777788888888886543


No 134
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=66.47  E-value=4.1  Score=26.11  Aligned_cols=24  Identities=29%  Similarity=0.725  Sum_probs=17.4

Q ss_pred             EEEccCccccccc--------cCccccCCCCC
Q 028198           70 ILKCHACYTITAE--------IGRIFCPKCGN   93 (212)
Q Consensus        70 vlrC~aC~k~~~~--------~~k~FCp~CG~   93 (212)
                      +..|..|.+.|..        ..+.-|++||+
T Consensus         2 ~i~Cp~C~~~y~i~d~~ip~~g~~v~C~~C~~   33 (36)
T PF13717_consen    2 IITCPNCQAKYEIDDEKIPPKGRKVRCSKCGH   33 (36)
T ss_pred             EEECCCCCCEEeCCHHHCCCCCcEEECCCCCC
Confidence            3579999887752        22578999997


No 135
>PLN02569 threonine synthase
Probab=66.28  E-value=5.7  Score=38.68  Aligned_cols=57  Identities=16%  Similarity=0.057  Sum_probs=36.5

Q ss_pred             eeEecchHHHHHHHHHhCceeecCCCCcceeeeeEEEEccCccccccccC-ccccCCCCCCCcee
Q 028198           35 VACITGDYAMQNVILQMGLRLLAPGGMQIRQLHRWILKCHACYTITAEIG-RIFCPKCGNGGTLR   98 (212)
Q Consensus        35 vac~TdDfAmQNVllqmGL~~~s~~g~~I~~~k~wvlrC~aC~k~~~~~~-k~FCp~CG~~~TL~   98 (212)
                      ..-.|.|-++|-++.+ +... +.+.  +.-...+-|+|..|++.|+... ...| .||..  |.
T Consensus        18 ~~~~~~~~~~~~~~~~-~~~~-~~~~--~~~~~~~~l~C~~Cg~~y~~~~~~~~C-~cgg~--l~   75 (484)
T PLN02569         18 ATKFTADENIRDEARR-GPPA-PPDE--FSAKYVPFLECPLTGEKYSLDEVVYRS-KSGGL--LD   75 (484)
T ss_pred             ccccCcchhhhhhhhh-cCCC-CCcc--cccccccccEeCCCCCcCCCccccccC-CCCCe--EE
Confidence            3457889999999988 2221 1122  2112233599999999997543 4679 69975  64


No 136
>PRK08329 threonine synthase; Validated
Probab=66.26  E-value=3.6  Score=37.78  Aligned_cols=25  Identities=32%  Similarity=0.695  Sum_probs=19.8

Q ss_pred             EEccCccccccccCccccCCCCCCCcee
Q 028198           71 LKCHACYTITAEIGRIFCPKCGNGGTLR   98 (212)
Q Consensus        71 lrC~aC~k~~~~~~k~FCp~CG~~~TL~   98 (212)
                      |+|..|++.++......| .||..  |.
T Consensus         2 l~C~~Cg~~~~~~~~~~C-~c~~~--l~   26 (347)
T PRK08329          2 LRCTKCGRTYEEKFKLRC-DCGGT--LL   26 (347)
T ss_pred             cCcCCCCCCcCCCCceec-CCCCc--EE
Confidence            799999999976445679 69975  64


No 137
>PRK05638 threonine synthase; Validated
Probab=66.21  E-value=3.7  Score=38.88  Aligned_cols=24  Identities=29%  Similarity=0.539  Sum_probs=19.2

Q ss_pred             EEEccCccccccccCccccCCCCCC
Q 028198           70 ILKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        70 vlrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      +|+|..|++.++......| .||..
T Consensus         1 ~l~C~~Cg~~~~~~~~~~C-~c~~~   24 (442)
T PRK05638          1 KMKCPKCGREYNSYIPPFC-ICGEL   24 (442)
T ss_pred             CeEeCCCCCCCCCCCceec-CCCCc
Confidence            4799999999975445679 89975


No 138
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=65.78  E-value=5.1  Score=25.67  Aligned_cols=24  Identities=33%  Similarity=0.744  Sum_probs=17.0

Q ss_pred             EEccCccccccc--------cCccccCCCCCC
Q 028198           71 LKCHACYTITAE--------IGRIFCPKCGNG   94 (212)
Q Consensus        71 lrC~aC~k~~~~--------~~k~FCp~CG~~   94 (212)
                      .+|+.|...|..        ..+.-||+||+.
T Consensus         3 i~CP~C~~~f~v~~~~l~~~~~~vrC~~C~~~   34 (37)
T PF13719_consen    3 ITCPNCQTRFRVPDDKLPAGGRKVRCPKCGHV   34 (37)
T ss_pred             EECCCCCceEEcCHHHcccCCcEEECCCCCcE
Confidence            578899877742        225779999873


No 139
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=65.55  E-value=2  Score=44.86  Aligned_cols=10  Identities=20%  Similarity=0.338  Sum_probs=0.0

Q ss_pred             CCceecCCCC
Q 028198          139 KNLILREDQL  148 (212)
Q Consensus       139 ~~~IL~EDQ~  148 (212)
                      .+|+-.+||+
T Consensus       802 G~pL~~~dQi  811 (900)
T PF03833_consen  802 GKPLESDDQI  811 (900)
T ss_dssp             ----------
T ss_pred             CCccCCccce
Confidence            3788899993


No 140
>COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis]
Probab=65.27  E-value=4  Score=35.59  Aligned_cols=33  Identities=30%  Similarity=0.633  Sum_probs=23.4

Q ss_pred             EEEccCccccc-cccCccccCCCCCCCceeEEEEE
Q 028198           70 ILKCHACYTIT-AEIGRIFCPKCGNGGTLRKVAVT  103 (212)
Q Consensus        70 vlrC~aC~k~~-~~~~k~FCp~CG~~~TL~Rvsvs  103 (212)
                      .-+|.-|...- ..-...-||.||+. -.+|+|.-
T Consensus       149 ~A~CsrC~~~L~~~~~~l~Cp~Cg~t-EkRKia~~  182 (188)
T COG1096         149 YARCSRCRAPLVKKGNMLKCPNCGNT-EKRKIAKD  182 (188)
T ss_pred             EEEccCCCcceEEcCcEEECCCCCCE-Eeeeeccc
Confidence            35899998543 22235789999996 78888854


No 141
>TIGR00311 aIF-2beta translation initiation factor aIF-2, beta subunit, putative.
Probab=64.88  E-value=7  Score=32.06  Aligned_cols=39  Identities=21%  Similarity=0.341  Sum_probs=24.9

Q ss_pred             HHHHHHHHHhCceee------cCCCCcceeeeeEEEEccCccccc
Q 028198           42 YAMQNVILQMGLRLL------APGGMQIRQLHRWILKCHACYTIT   80 (212)
Q Consensus        42 fAmQNVllqmGL~~~------s~~g~~I~~~k~wvlrC~aC~k~~   80 (212)
                      -.+|++|...=-.+|      +++...+++-+.|.++|.||+...
T Consensus        84 ~~i~~~L~~yI~~yVlC~~C~sPdT~l~k~~r~~~l~C~ACGa~~  128 (133)
T TIGR00311        84 FLLNERIEDYVRKYVICRECNRPDTRIIKEGRVSLLKCEACGAKA  128 (133)
T ss_pred             HHHHHHHHHHHhheEECCCCCCCCcEEEEeCCeEEEecccCCCCC
Confidence            346777766433332      566677776777777777777644


No 142
>TIGR01023 rpmG_bact ribosomal protein L33, bacterial type. This model describes bacterial ribosomal protein L33 and its chloroplast and mitochondrial equivalents.
Probab=64.81  E-value=8  Score=27.19  Aligned_cols=32  Identities=34%  Similarity=0.654  Sum_probs=22.0

Q ss_pred             eeEEEEccCcccccc----c-------c-CccccCCCCCCCceeE
Q 028198           67 HRWILKCHACYTITA----E-------I-GRIFCPKCGNGGTLRK   99 (212)
Q Consensus        67 k~wvlrC~aC~k~~~----~-------~-~k~FCp~CG~~~TL~R   99 (212)
                      ....|.|.+|...+.    .       + -+.|||.|+.. ||-+
T Consensus         8 ~~i~L~ct~c~~~nY~t~Kn~~~~~~kL~lkKycp~~~kh-tlhk   51 (54)
T TIGR01023         8 ELIRLVCTACTGINYTTTKNRRNKPEKLELRKYCPVCRKH-VLHK   51 (54)
T ss_pred             eEEEEEecCCCCCCEEEcCCCCCCCCceEEECcCCCCCCe-EeEE
Confidence            467899999963321    1       1 16899999997 7753


No 143
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=64.59  E-value=4.4  Score=38.99  Aligned_cols=31  Identities=19%  Similarity=0.406  Sum_probs=24.9

Q ss_pred             eEEEEccCccccccccCccccCCCCCCCceeE
Q 028198           68 RWILKCHACYTITAEIGRIFCPKCGNGGTLRK   99 (212)
Q Consensus        68 ~wvlrC~aC~k~~~~~~k~FCp~CG~~~TL~R   99 (212)
                      +-.|+|..|+..+.. ..-.||.||.=+|+.-
T Consensus         5 ~~~y~C~~Cg~~~~~-~~g~Cp~C~~w~t~~~   35 (454)
T TIGR00416         5 KSKFVCQHCGADSPK-WQGKCPACHAWNTITE   35 (454)
T ss_pred             CCeEECCcCCCCCcc-ccEECcCCCCccccch
Confidence            347999999987765 3567999999888875


No 144
>PRK08271 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=63.68  E-value=4  Score=41.21  Aligned_cols=44  Identities=23%  Similarity=0.408  Sum_probs=27.0

Q ss_pred             HHHHHHHHH---hCceeecCCCCcceeeeeEEEEccCccccccccCccccCCCCCC
Q 028198           42 YAMQNVILQ---MGLRLLAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        42 fAmQNVllq---mGL~~~s~~g~~I~~~k~wvlrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      =|+.+++..   .|+...++.        .=+-+|..|+.+... ....||+||+.
T Consensus       543 eal~~lv~~~~~~~i~Yf~in--------~~~~iC~~CG~~~~g-~~~~CP~CGs~  589 (623)
T PRK08271        543 EGYRKLLNIAAKTGCNYFAFN--------VKITICNDCHHIDKR-TGKRCPICGSE  589 (623)
T ss_pred             HHHHHHHHHHHHcCCceEEeC--------CCCccCCCCCCcCCC-CCcCCcCCCCc
Confidence            345554443   355555544        123479999976332 35789999986


No 145
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=63.65  E-value=4.2  Score=31.66  Aligned_cols=17  Identities=35%  Similarity=0.958  Sum_probs=13.6

Q ss_pred             ccccCCCCCCCceeEEEE
Q 028198           85 RIFCPKCGNGGTLRKVAV  102 (212)
Q Consensus        85 k~FCp~CG~~~TL~Rvsv  102 (212)
                      +..||.||.+ +++|++.
T Consensus        35 ~~~Cp~C~~~-~VkR~a~   51 (89)
T COG1997          35 KHVCPFCGRT-TVKRIAT   51 (89)
T ss_pred             CCcCCCCCCc-ceeeecc
Confidence            5678888887 8888875


No 146
>PRK08197 threonine synthase; Validated
Probab=63.11  E-value=5.8  Score=36.99  Aligned_cols=25  Identities=28%  Similarity=0.563  Sum_probs=19.6

Q ss_pred             EEEEccCccccccccC-ccccCCCCCC
Q 028198           69 WILKCHACYTITAEIG-RIFCPKCGNG   94 (212)
Q Consensus        69 wvlrC~aC~k~~~~~~-k~FCp~CG~~   94 (212)
                      +.|+|..|++.++... ...| .||..
T Consensus         6 ~~~~C~~Cg~~~~~~~~~~~C-~cg~~   31 (394)
T PRK08197          6 SHLECSKCGETYDADQVHNLC-KCGKP   31 (394)
T ss_pred             eEEEECCCCCCCCCCCcceec-CCCCe
Confidence            3599999999997543 3569 89976


No 147
>cd01413 SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group which includes Archaeoglobus fulgidus Sir2-Af2, Sulfolobus solfataricus ssSir2, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The Sir2 homolog from the archaea Sulfolobus solftaricus deacetylates the non-specific DNA protein Alba to mediate transcription repression.
Probab=62.74  E-value=5.2  Score=34.61  Aligned_cols=27  Identities=26%  Similarity=0.338  Sum_probs=17.0

Q ss_pred             eEEEEccCcccccccc--------CccccCCCCCC
Q 028198           68 RWILKCHACYTITAEI--------GRIFCPKCGNG   94 (212)
Q Consensus        68 ~wvlrC~aC~k~~~~~--------~k~FCp~CG~~   94 (212)
                      .+.++|..|.+.+...        ....||.||..
T Consensus       111 l~~~~C~~C~~~~~~~~~~~~~~~~~p~C~~Cgg~  145 (222)
T cd01413         111 LQTAYCVNCGSKYDLEEVKYAKKHEVPRCPKCGGI  145 (222)
T ss_pred             cCcceECCCCCCcchhHHHHhccCCCCcCCCCCCc
Confidence            3457788888766421        12458888864


No 148
>cd01408 SIRT1 SIRT1: Eukaryotic group (class1) which includes human sirtuins SIRT1-3 and yeast Hst1-4; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The nuclear SIRT1 has been shown to target the p53 tumor suppressor protein for deacetylation to suppress DNA damage, and the cytoplasmic SIRT2 homolog has been shown to target alpha-tubulin for deacetylation for the maintenance of cell integrity.
Probab=62.68  E-value=5.8  Score=34.69  Aligned_cols=34  Identities=21%  Similarity=0.380  Sum_probs=21.9

Q ss_pred             eecCCCCcceeeeeEEEEccCcccccccc---------CccccCCCCCC
Q 028198           55 LLAPGGMQIRQLHRWILKCHACYTITAEI---------GRIFCPKCGNG   94 (212)
Q Consensus        55 ~~s~~g~~I~~~k~wvlrC~aC~k~~~~~---------~k~FCp~CG~~   94 (212)
                      |+.++|.      .+.++|..|.+.+...         ...-||.||+.
T Consensus       107 V~elHG~------l~~~~C~~C~~~~~~~~~~~~~~~~~~p~C~~Cgg~  149 (235)
T cd01408         107 IIEAHGS------FATAHCIKCKHKYPGDWMREDIFNQEVPKCPRCGGL  149 (235)
T ss_pred             EEEeCcC------CCccccccCCCcCCHHHHHHHHhCCCCccCCCCCCC
Confidence            4555554      4557899999876421         12359999975


No 149
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism]
Probab=62.65  E-value=2.4  Score=39.25  Aligned_cols=73  Identities=23%  Similarity=0.352  Sum_probs=44.9

Q ss_pred             EEccCcccccc--c--cCccccCCCCCCCce---eEEEEEeCCCceEEeecCCccccccceeccCCCCCCCCCCCCCcee
Q 028198           71 LKCHACYTITA--E--IGRIFCPKCGNGGTL---RKVAVTVGENGIVLASRRPRITLRGTKFSLPMPQGGRDAITKNLIL  143 (212)
Q Consensus        71 lrC~aC~k~~~--~--~~k~FCp~CG~~~TL---~Rvsvsv~~~G~~~~~~k~~~n~RG~~ySlPkpkgGk~~~~~~~IL  143 (212)
                      ..|++|+.+..  +  .....||+||+...+   .|+..               +--.|.-..+..|.   ..  .||+-
T Consensus        29 ~KCp~c~~~~y~~eL~~n~~vcp~c~~h~ri~A~~Ri~~---------------llD~gsf~el~~~l---~~--~dPL~   88 (294)
T COG0777          29 TKCPSCGEMLYRKELESNLKVCPKCGHHMRISARERLEA---------------LLDEGSFEELDSPL---EP--KDPLK   88 (294)
T ss_pred             eECCCccceeeHHHHHhhhhcccccCcccccCHHHHHHH---------------hhCCCcceecccCC---Cc--CCccc
Confidence            57999998753  2  235789999997111   11122               22244444444442   22  48888


Q ss_pred             cCCCCcccccchhhhcccCC
Q 028198          144 REDQLPQKYLYPRNKKKVNK  163 (212)
Q Consensus       144 ~EDQ~~~~~~~~k~r~k~~~  163 (212)
                      ..|.+.|.-+.+++++++..
T Consensus        89 F~d~k~Y~~rL~~a~~~tg~  108 (294)
T COG0777          89 FPDSKKYKDRLEAARKKTGL  108 (294)
T ss_pred             CCcchhhHHHHHHHHhhcCC
Confidence            99988887777788877543


No 150
>PF02146 SIR2:  Sir2 family;  InterPro: IPR003000 These sequences represent the Sirtuin (Sir2-related) family of NAD+-dependent deacetylases. This family of enzymes is broadly conserved from bacteria to humans. In yeast, Sir2 proteins form complexes with other proteins to silence chromatin by accessing histones and deacetylating them. Sir2 proteins have been proposed to play a role in silencing, chromosome stability and ageing []. The bacterial enzyme CobB, an homologue of Sir2, is a phosphoribosyltransferase []. An in vitro ADP ribosyltransferase activity has also been associated with human members of this family []. Sir2-like enzymes employ NAD+ as a cosubstrate in deacetylation reactions [] and catalyse a reaction in which the cleavage of NAD(+)and histone and/or protein deacetylation are coupled to the formation of O-acetyl-ADP-ribose, a novel metabolite. The dependence of the reaction on both NAD(+) and the generation of this potential second messenger offers new clues to understanding the function and regulation of nuclear, cytoplasmic and mitochondrial Sir2-like enzymes []. Silent Information Regulator protein of Saccharomyces cerevisiae (Sir2) is one of several factors critical for silencing at least three loci. Among them, it is unique because it silences the rDNA as well as the mating type loci and telomeres []. Sir2 interacts in a complex with itself and with Sir3 and Sir4, two proteins that are able to interact with nucleosomes. In addition Sir2 also interacts with ubiquitination factors and/or complexes [].  Homologues of Sir2 share a core domain including the GAG and NID motifs and a putative C4 Zinc finger. The regions containing these three conserved motifs are individually essential for Sir2 silencing function, as are the four cysteins []. In addition, the conserved residues HG next to the putative Zn finger have been shown to be essential for the ADP ribosyltransferase activity []. ; GO: 0008270 zinc ion binding, 0070403 NAD+ binding, 0006476 protein deacetylation; PDB: 1S5P_A 3PKI_E 3PKJ_F 3K35_A 1ICI_A 1M2K_A 1M2G_A 1M2N_B 1M2H_A 1M2J_A ....
Probab=62.43  E-value=8.4  Score=31.76  Aligned_cols=27  Identities=30%  Similarity=0.567  Sum_probs=20.0

Q ss_pred             eEEEEccCccccccc---------cCccccCCCCCC
Q 028198           68 RWILKCHACYTITAE---------IGRIFCPKCGNG   94 (212)
Q Consensus        68 ~wvlrC~aC~k~~~~---------~~k~FCp~CG~~   94 (212)
                      .+..+|..|.+.+..         ....-||.||..
T Consensus       103 l~~~~C~~C~~~~~~~~~~~~~~~~~~~~C~~C~~~  138 (178)
T PF02146_consen  103 LFRLRCSKCGKEYDREDIVDSIDEEEPPRCPKCGGL  138 (178)
T ss_dssp             EEEEEETTTSBEEEGHHHHHHHHTTSSCBCTTTSCB
T ss_pred             hceeeecCCCccccchhhcccccccccccccccCcc
Confidence            677899999997742         123469999984


No 151
>PRK00595 rpmG 50S ribosomal protein L33; Validated
Probab=62.39  E-value=8.8  Score=26.81  Aligned_cols=32  Identities=13%  Similarity=0.017  Sum_probs=21.9

Q ss_pred             eeEEEEccCccccccc-----------c-CccccCCCCCCCceeE
Q 028198           67 HRWILKCHACYTITAE-----------I-GRIFCPKCGNGGTLRK   99 (212)
Q Consensus        67 k~wvlrC~aC~k~~~~-----------~-~k~FCp~CG~~~TL~R   99 (212)
                      ....|.|.+|......           + -+.|||.|+.. ||-+
T Consensus         7 ~~i~L~ct~c~~~nY~t~Kn~k~~~~rL~lkKycp~~~kh-tlhk   50 (53)
T PRK00595          7 VKIKLESTEGTGRFYTTTKNKRNTPEKLELKKYDPVLRKH-VLHK   50 (53)
T ss_pred             eEEEEEecCCCCEEEEEccCCCCCCCceEEECcCCCCCCE-EeEE
Confidence            3567999999843210           1 16899999997 7754


No 152
>smart00653 eIF2B_5 domain present in translation initiation factor eIF2B and eIF5.
Probab=62.38  E-value=6.7  Score=31.14  Aligned_cols=45  Identities=20%  Similarity=0.433  Sum_probs=28.5

Q ss_pred             eeeEecchH---HHHHHHHHhCceee------cCCCCcceeeeeEEEEccCccc
Q 028198           34 TVACITGDY---AMQNVILQMGLRLL------APGGMQIRQLHRWILKCHACYT   78 (212)
Q Consensus        34 ~vac~TdDf---AmQNVllqmGL~~~------s~~g~~I~~~k~wvlrC~aC~k   78 (212)
                      ..++++..|   .||++|...=-.+|      +++...+++-+.|.++|.||+.
T Consensus        56 ~rlii~G~~~~~~i~~~l~~yI~~yVlC~~C~spdT~l~k~~r~~~l~C~aCGa  109 (110)
T smart00653       56 GRLIVNGRFTPKKLQDLLRRYIKEYVLCPECGSPDTELIKENRLFFLKCEACGA  109 (110)
T ss_pred             CeEEEEEeeCHHHHHHHHHHHHHhcEECCCCCCCCcEEEEeCCeEEEEccccCC
Confidence            445555554   46676665433322      6677777777788888888874


No 153
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=62.20  E-value=3.5  Score=26.93  Aligned_cols=23  Identities=35%  Similarity=0.953  Sum_probs=11.5

Q ss_pred             EEccCccccc--cc--cCccccCCCCC
Q 028198           71 LKCHACYTIT--AE--IGRIFCPKCGN   93 (212)
Q Consensus        71 lrC~aC~k~~--~~--~~k~FCp~CG~   93 (212)
                      ++|+.|+...  .+  ....+|+.||.
T Consensus         1 m~Cp~Cg~~~~~~D~~~g~~vC~~CG~   27 (43)
T PF08271_consen    1 MKCPNCGSKEIVFDPERGELVCPNCGL   27 (43)
T ss_dssp             ESBTTTSSSEEEEETTTTEEEETTT-B
T ss_pred             CCCcCCcCCceEEcCCCCeEECCCCCC
Confidence            4566676532  11  22456777765


No 154
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional
Probab=61.94  E-value=6  Score=37.27  Aligned_cols=27  Identities=22%  Similarity=0.523  Sum_probs=19.6

Q ss_pred             eEEEEccCcccccccc--CccccCCCCCC
Q 028198           68 RWILKCHACYTITAEI--GRIFCPKCGNG   94 (212)
Q Consensus        68 ~wvlrC~aC~k~~~~~--~k~FCp~CG~~   94 (212)
                      .|++.|+.|.......  ....||.||.+
T Consensus       242 g~~~~C~~c~~~~~~~~~~~~~C~~c~~~  270 (382)
T PRK04338        242 GYVYYCPKCLYREEVEGLPPEECPVCGGK  270 (382)
T ss_pred             eeEEECCCCCcEEEecCCCCCCCCCCCCc
Confidence            6789999999754321  24579999986


No 155
>cd01410 SIRT7 SIRT7: Eukaryotic and prokaryotic group (class4) which includes human sirtuin SIRT6, SIRT7, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.
Probab=61.00  E-value=6.1  Score=33.93  Aligned_cols=27  Identities=22%  Similarity=0.379  Sum_probs=17.4

Q ss_pred             eEEEEccCcccccccc----------CccccCCCCCC
Q 028198           68 RWILKCHACYTITAEI----------GRIFCPKCGNG   94 (212)
Q Consensus        68 ~wvlrC~aC~k~~~~~----------~k~FCp~CG~~   94 (212)
                      -+.++|..|.+.+...          ....||.||+.
T Consensus        93 ~~~~~C~~C~~~~~~~~~~~~~~~~~~~p~C~~Cgg~  129 (206)
T cd01410          93 MFIEVCKSCGPEYVRDDVVETRGDKETGRRCHACGGI  129 (206)
T ss_pred             cCcccCCCCCCccchHHHHHHhhcCCCCCcCCCCcCc
Confidence            4567899999776421          12348999864


No 156
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=60.67  E-value=6.5  Score=27.09  Aligned_cols=8  Identities=63%  Similarity=1.900  Sum_probs=3.8

Q ss_pred             cccCCCCC
Q 028198           86 IFCPKCGN   93 (212)
Q Consensus        86 ~FCp~CG~   93 (212)
                      .|||.||+
T Consensus        21 ~fCP~Cg~   28 (50)
T PRK00432         21 KFCPRCGS   28 (50)
T ss_pred             CcCcCCCc
Confidence            34444444


No 157
>PRK00481 NAD-dependent deacetylase; Provisional
Probab=60.62  E-value=6.7  Score=34.16  Aligned_cols=27  Identities=26%  Similarity=0.420  Sum_probs=17.9

Q ss_pred             eEEEEccCcccccccc-----CccccCCCCCC
Q 028198           68 RWILKCHACYTITAEI-----GRIFCPKCGNG   94 (212)
Q Consensus        68 ~wvlrC~aC~k~~~~~-----~k~FCp~CG~~   94 (212)
                      ...++|..|.+.+...     ...-||.||..
T Consensus       120 ~~~~~C~~C~~~~~~~~~~~~~~p~C~~Cgg~  151 (242)
T PRK00481        120 LLRARCTKCGQTYDLDEYLKPEPPRCPKCGGI  151 (242)
T ss_pred             cCceeeCCCCCCcChhhhccCCCCCCCCCCCc
Confidence            4457899998877421     12239999975


No 158
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=60.62  E-value=3.9  Score=28.59  Aligned_cols=10  Identities=20%  Similarity=0.667  Sum_probs=4.4

Q ss_pred             ccCccccccc
Q 028198           73 CHACYTITAE   82 (212)
Q Consensus        73 C~aC~k~~~~   82 (212)
                      |+||.+.++.
T Consensus         2 CfgC~~~~~~   11 (51)
T PF07975_consen    2 CFGCQKPFPD   11 (51)
T ss_dssp             ETTTTEE-TT
T ss_pred             CccCCCCCCC
Confidence            4555544444


No 159
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=60.34  E-value=8.1  Score=30.04  Aligned_cols=20  Identities=35%  Similarity=0.948  Sum_probs=16.2

Q ss_pred             CccccCCCCCCCceeEEEEEe
Q 028198           84 GRIFCPKCGNGGTLRKVAVTV  104 (212)
Q Consensus        84 ~k~FCp~CG~~~TL~Rvsvsv  104 (212)
                      .+.+||.||.. .++|+++-+
T Consensus        35 a~y~CpfCgk~-~vkR~a~GI   54 (90)
T PTZ00255         35 AKYFCPFCGKH-AVKRQAVGI   54 (90)
T ss_pred             CCccCCCCCCC-ceeeeeeEE
Confidence            36789999987 899999743


No 160
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=60.30  E-value=2.9  Score=43.78  Aligned_cols=21  Identities=33%  Similarity=0.711  Sum_probs=0.0

Q ss_pred             EEccCccccccccCccccCCCCCC
Q 028198           71 LKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        71 lrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      .+|+.|++.+..   ..||.||..
T Consensus       656 r~Cp~Cg~~t~~---~~Cp~CG~~  676 (900)
T PF03833_consen  656 RRCPKCGKETFY---NRCPECGSH  676 (900)
T ss_dssp             ------------------------
T ss_pred             ccCcccCCcchh---hcCcccCCc
Confidence            456666654432   345555554


No 161
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=60.14  E-value=6.8  Score=26.26  Aligned_cols=23  Identities=17%  Similarity=0.371  Sum_probs=15.2

Q ss_pred             ccCCCCCCCceeEEEEEeCCCceE
Q 028198           87 FCPKCGNGGTLRKVAVTVGENGIV  110 (212)
Q Consensus        87 FCp~CG~~~TL~Rvsvsv~~~G~~  110 (212)
                      .||.||.+ ...|.+..+......
T Consensus         1 ~CP~Cg~~-a~ir~S~~~s~~~~~   23 (47)
T PF04606_consen    1 RCPHCGSK-ARIRTSRQLSPLTRE   23 (47)
T ss_pred             CcCCCCCe-eEEEEchhhCcceEE
Confidence            39999998 566666555554443


No 162
>CHL00104 rpl33 ribosomal protein L33
Probab=59.76  E-value=9  Score=28.13  Aligned_cols=32  Identities=31%  Similarity=0.594  Sum_probs=21.8

Q ss_pred             eeEEEEccCccccc--------------cc--------cCccccCCCCCCCceeE
Q 028198           67 HRWILKCHACYTIT--------------AE--------IGRIFCPKCGNGGTLRK   99 (212)
Q Consensus        67 k~wvlrC~aC~k~~--------------~~--------~~k~FCp~CG~~~TL~R   99 (212)
                      ....|.|..|..-.              ..        .-+.|||.|... ||-+
T Consensus         9 ~~I~L~Ct~c~~~n~~~~~~g~~rY~T~KNkkn~p~rLelkKycp~c~kH-tlhk   62 (66)
T CHL00104          9 VTVILECTSCVRNGVNKESTGISRYITQKNRHNTPNRLELKKFCPYCYKH-TIHK   62 (66)
T ss_pred             EEEEEEecCCcCCCccccCcccceEEECCCCCCCCceeEEECcCCCCCCE-eeEe
Confidence            35679999995332              11        125799999997 8754


No 163
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=59.75  E-value=6.3  Score=38.05  Aligned_cols=25  Identities=28%  Similarity=0.775  Sum_probs=18.9

Q ss_pred             EEEccCccccccccC------------------ccccCCCCCC
Q 028198           70 ILKCHACYTITAEIG------------------RIFCPKCGNG   94 (212)
Q Consensus        70 vlrC~aC~k~~~~~~------------------k~FCp~CG~~   94 (212)
                      .++|..|+.+|.+..                  ---||.||..
T Consensus       425 ~~~c~~c~~~yd~~~g~~~~~~~~gt~~~~lp~~~~cp~c~~~  467 (479)
T PRK05452        425 RMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLG  467 (479)
T ss_pred             eEEECCCCeEECCCCCCcccCCCCCCChhhCCCCCcCcCCCCc
Confidence            479999999997521                  1269999965


No 164
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis]
Probab=59.33  E-value=6  Score=37.88  Aligned_cols=28  Identities=29%  Similarity=0.636  Sum_probs=20.2

Q ss_pred             eeEEEEccCccccccc--cCccccCCCCCC
Q 028198           67 HRWILKCHACYTITAE--IGRIFCPKCGNG   94 (212)
Q Consensus        67 k~wvlrC~aC~k~~~~--~~k~FCp~CG~~   94 (212)
                      ..|++.|..|+++...  ..+.-||+||..
T Consensus       237 ~g~~~~c~~cg~~~~~~~~~~~~c~~Cg~~  266 (380)
T COG1867         237 LGYIYHCSRCGEIVGSFREVDEKCPHCGGK  266 (380)
T ss_pred             cCcEEEcccccceecccccccccCCccccc
Confidence            3577999999855432  236789999975


No 165
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=59.00  E-value=8.7  Score=29.94  Aligned_cols=19  Identities=26%  Similarity=0.793  Sum_probs=15.9

Q ss_pred             ccccCCCCCCCceeEEEEEe
Q 028198           85 RIFCPKCGNGGTLRKVAVTV  104 (212)
Q Consensus        85 k~FCp~CG~~~TL~Rvsvsv  104 (212)
                      +..||.||.. .++|+++-+
T Consensus        35 ~y~CpfCgk~-~vkR~a~GI   53 (91)
T TIGR00280        35 KYVCPFCGKK-TVKRGSTGI   53 (91)
T ss_pred             CccCCCCCCC-ceEEEeeEE
Confidence            6789999987 899999754


No 166
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. This enzyme is responsible for two methylations of a characteristic guanine of most tRNA molecules. The activity has been demonstrated for eukaryotic and archaeal proteins, which are active when expressed in E. coli, a species that lacks this enzyme. At least one Eubacterium, Aquifex aeolicus, has an ortholog, as do all completed archaeal genomes.
Probab=58.30  E-value=8  Score=36.46  Aligned_cols=27  Identities=19%  Similarity=0.527  Sum_probs=19.3

Q ss_pred             eEEEEccCccccccc----cCccccCCCCCC
Q 028198           68 RWILKCHACYTITAE----IGRIFCPKCGNG   94 (212)
Q Consensus        68 ~wvlrC~aC~k~~~~----~~k~FCp~CG~~   94 (212)
                      .|++.|+.|+.....    .....||.||.+
T Consensus       231 g~v~~C~~c~~~~~~~~~~~~~~~C~~c~~~  261 (374)
T TIGR00308       231 GYTYHCSRCLHNKPVNGISQRKGRCKECGGE  261 (374)
T ss_pred             eeEEECCCcccccccccccCCCCCCCCCCCc
Confidence            678999999865321    224579999986


No 167
>cd01411 SIR2H SIR2H: Uncharacterized prokaryotic Sir2 homologs from several gram positive bacterial species and Fusobacteria; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.
Probab=58.12  E-value=6.9  Score=33.97  Aligned_cols=26  Identities=19%  Similarity=0.411  Sum_probs=17.5

Q ss_pred             EEEEccCcccccccc---CccccCCCCCC
Q 028198           69 WILKCHACYTITAEI---GRIFCPKCGNG   94 (212)
Q Consensus        69 wvlrC~aC~k~~~~~---~k~FCp~CG~~   94 (212)
                      ..++|..|.+.+...   ....||.||..
T Consensus       117 ~~~~C~~C~~~~~~~~~~~~p~C~~Cgg~  145 (225)
T cd01411         117 YRIYCTVCGKTVDWEEYLKSPYHAKCGGV  145 (225)
T ss_pred             CeeEeCCCCCccchhhcCCCCCCCCCCCE
Confidence            447899998776421   12469999964


No 168
>PRK14704 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=58.03  E-value=6  Score=39.85  Aligned_cols=23  Identities=30%  Similarity=0.652  Sum_probs=16.5

Q ss_pred             EEEccCccccccccCccccCCCCCC
Q 028198           70 ILKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        70 vlrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      +-+|..|+... . -...||+||+.
T Consensus       559 ~~~C~~CGy~g-~-~~~~CP~CG~~  581 (618)
T PRK14704        559 VDRCKCCSYHG-V-IGNECPSCGNE  581 (618)
T ss_pred             CeecCCCCCCC-C-cCccCcCCCCC
Confidence            45799999632 2 13579999986


No 169
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=58.02  E-value=5  Score=34.53  Aligned_cols=22  Identities=27%  Similarity=0.585  Sum_probs=16.4

Q ss_pred             EEccCccccccccCccccCCCCCC
Q 028198           71 LKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        71 lrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      ..|+.|+.  ......+||.||..
T Consensus       310 ~~C~~cg~--~~~r~~~C~~cg~~  331 (364)
T COG0675         310 KTCPCCGH--LSGRLFKCPRCGFV  331 (364)
T ss_pred             ccccccCC--ccceeEECCCCCCe
Confidence            67999998  22234689999985


No 170
>PF01907 Ribosomal_L37e:  Ribosomal protein L37e;  InterPro: IPR001569 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaeal ribosomal proteins can be grouped on the basis of sequence similarities. One of these families consists of proteins of 56 to 96 amino-acid residues that share a highly conserved region located in the N-terminal part.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A19_A 4A1D_A 4A18_A 4A1B_A 1S1I_Y 3O5H_d 3IZS_l 3O58_d 2ZKR_2 3IZR_l ....
Probab=57.77  E-value=6.5  Score=28.10  Aligned_cols=24  Identities=25%  Similarity=0.571  Sum_probs=20.1

Q ss_pred             EEccCccccccccCccccCCCCCC
Q 028198           71 LKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        71 lrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      -.|.-|++.....-+..|..||.+
T Consensus        16 ~~CrRCG~~syH~qK~~CasCGyp   39 (55)
T PF01907_consen   16 TLCRRCGRRSYHIQKKTCASCGYP   39 (55)
T ss_dssp             EE-TTTSSEEEETTTTEETTTBTT
T ss_pred             eeecccCCeeeecCCCcccccCCC
Confidence            479999988877778999999988


No 171
>PTZ00408 NAD-dependent deacetylase; Provisional
Probab=57.52  E-value=7.4  Score=34.46  Aligned_cols=26  Identities=23%  Similarity=0.383  Sum_probs=16.7

Q ss_pred             eEEEEccCcccccccc-----CccccCCCCC
Q 028198           68 RWILKCHACYTITAEI-----GRIFCPKCGN   93 (212)
Q Consensus        68 ~wvlrC~aC~k~~~~~-----~k~FCp~CG~   93 (212)
                      -+.++|..|.+.+.-.     ....||.||.
T Consensus       115 ~~~~~C~~C~~~~~~~~~~~~~~p~C~~Cg~  145 (242)
T PTZ00408        115 LLKVRCTATGHVFDWTEDVVHGSSRCKCCGC  145 (242)
T ss_pred             cceEEECCCCcccCchhhhhcCCCccccCCC
Confidence            3447899999776421     1145999983


No 172
>PRK12336 translation initiation factor IF-2 subunit beta; Provisional
Probab=57.34  E-value=10  Score=32.74  Aligned_cols=47  Identities=19%  Similarity=0.330  Sum_probs=28.2

Q ss_pred             eeEecchH---HHHHHHHHhCceee------cCCCCcceeeeeEEEEccCcccccc
Q 028198           35 VACITGDY---AMQNVILQMGLRLL------APGGMQIRQLHRWILKCHACYTITA   81 (212)
Q Consensus        35 vac~TdDf---AmQNVllqmGL~~~------s~~g~~I~~~k~wvlrC~aC~k~~~   81 (212)
                      ..+++..|   -+|++|...=-.++      +++...+++-+.|.++|.||+...+
T Consensus        75 ~~ii~G~~~~~~i~~~l~~yi~~yV~C~~C~~pdT~l~k~~~~~~l~C~aCGa~~~  130 (201)
T PRK12336         75 RAVFNGKFTEEDIQAAIDAYVDEYVICSECGLPDTRLVKEDRVLMLRCDACGAHRP  130 (201)
T ss_pred             EEEEEeeeCHHHHHHHHHHHHHheEECCCCCCCCcEEEEcCCeEEEEcccCCCCcc
Confidence            34555544   46666655322222      5666667666777788888776554


No 173
>TIGR00155 pqiA_fam integral membrane protein, PqiA family. This family consists of uncharacterized predicted integral membrane proteins found, so far, only in the Proteobacteria. Of two members in E. coli, one is induced by paraquat and is designated PqiA, paraquat-inducible protein A.
Probab=57.15  E-value=6  Score=37.64  Aligned_cols=25  Identities=28%  Similarity=0.693  Sum_probs=19.6

Q ss_pred             EEEccCccccccccCccccCCCCCC
Q 028198           70 ILKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        70 vlrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      ...|+.|........+-.||.||..
T Consensus       215 ~~~C~~Cd~~~~~~~~a~CpRC~~~  239 (403)
T TIGR00155       215 LRSCSACHTTILPAQEPVCPRCSTP  239 (403)
T ss_pred             CCcCCCCCCccCCCCCcCCcCCCCc
Confidence            4469999986655556789999985


No 174
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=57.13  E-value=7.4  Score=33.07  Aligned_cols=63  Identities=13%  Similarity=0.081  Sum_probs=35.1

Q ss_pred             eeEecchHHHHHHHHHhCceeecCCCCcceeeeeEEEEccCccccccc---c-CccccCCCCCCCceeE
Q 028198           35 VACITGDYAMQNVILQMGLRLLAPGGMQIRQLHRWILKCHACYTITAE---I-GRIFCPKCGNGGTLRK   99 (212)
Q Consensus        35 vac~TdDfAmQNVllqmGL~~~s~~g~~I~~~k~wvlrC~aC~k~~~~---~-~k~FCp~CG~~~TL~R   99 (212)
                      .-.+|.+-+.+-+...+---+..+....-...-.=-|.|+.|+..++-   + .---||.||..  |.-
T Consensus        82 ~w~l~~~~i~d~ik~~~~~~~~klk~~l~~e~~~~~Y~Cp~C~~rytf~eA~~~~F~Cp~Cg~~--L~~  148 (178)
T PRK06266         82 TWKPELEKLPEIIKKKKMEELKKLKEQLEEEENNMFFFCPNCHIRFTFDEAMEYGFRCPQCGEM--LEE  148 (178)
T ss_pred             EEEeCHHHHHHHHHHHHHHHHHHHHHHhhhccCCCEEECCCCCcEEeHHHHhhcCCcCCCCCCC--Cee
Confidence            345777777777776653211111111111222346899999976641   1 23459999986  653


No 175
>PTZ00410 NAD-dependent SIR2; Provisional
Probab=56.59  E-value=11  Score=35.47  Aligned_cols=27  Identities=22%  Similarity=0.282  Sum_probs=18.6

Q ss_pred             eEEEEccCcccccccc---------CccccCCCCCC
Q 028198           68 RWILKCHACYTITAEI---------GRIFCPKCGNG   94 (212)
Q Consensus        68 ~wvlrC~aC~k~~~~~---------~k~FCp~CG~~   94 (212)
                      -+..+|..|.+.+...         ....||.||..
T Consensus       145 l~~~~C~~C~~~~~~~~~~~~~~~~~vP~C~~CgG~  180 (349)
T PTZ00410        145 FSAASCIECHTPYDIEQAYLEARSGKVPHCSTCGGI  180 (349)
T ss_pred             CCeeEeCCCCCCcchhHHHHHhhcCCCCCCCCCCCc
Confidence            4557899999876521         12369999974


No 176
>PHA00626 hypothetical protein
Probab=56.37  E-value=7.4  Score=28.12  Aligned_cols=14  Identities=50%  Similarity=1.158  Sum_probs=10.2

Q ss_pred             ccCCCCCCCceeEEE
Q 028198           87 FCPKCGNGGTLRKVA  101 (212)
Q Consensus        87 FCp~CG~~~TL~Rvs  101 (212)
                      .||.||+. ++.|..
T Consensus         2 ~CP~CGS~-~Ivrcg   15 (59)
T PHA00626          2 SCPKCGSG-NIAKEK   15 (59)
T ss_pred             CCCCCCCc-eeeeec
Confidence            69999986 666544


No 177
>PF06906 DUF1272:  Protein of unknown function (DUF1272);  InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length. This family contains a number of conserved cysteine residues and its function is unknown.
Probab=56.23  E-value=4.5  Score=29.09  Aligned_cols=29  Identities=21%  Similarity=0.504  Sum_probs=22.5

Q ss_pred             eeeEEEEccCccccccccCccccCCCCCC
Q 028198           66 LHRWILKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        66 ~k~wvlrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      .+.-.+.|+-|..-...+-...||.||..
T Consensus        22 A~ICSfECTFC~~C~e~~l~~~CPNCgGe   50 (57)
T PF06906_consen   22 AYICSFECTFCADCAETMLNGVCPNCGGE   50 (57)
T ss_pred             ceEEeEeCcccHHHHHHHhcCcCcCCCCc
Confidence            34555889999887766656889999986


No 178
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=56.20  E-value=11  Score=29.39  Aligned_cols=19  Identities=26%  Similarity=0.842  Sum_probs=15.9

Q ss_pred             ccccCCCCCCCceeEEEEEe
Q 028198           85 RIFCPKCGNGGTLRKVAVTV  104 (212)
Q Consensus        85 k~FCp~CG~~~TL~Rvsvsv  104 (212)
                      +..||.||.. .++|+++-+
T Consensus        36 ~y~CpfCgk~-~vkR~a~GI   54 (90)
T PRK03976         36 KHVCPVCGRP-KVKRVGTGI   54 (90)
T ss_pred             CccCCCCCCC-ceEEEEEEE
Confidence            6789999987 899999754


No 179
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=56.17  E-value=5.1  Score=34.32  Aligned_cols=23  Identities=13%  Similarity=0.278  Sum_probs=14.6

Q ss_pred             ceeeEecchHHHHHHHHHhCceee
Q 028198           33 STVACITGDYAMQNVILQMGLRLL   56 (212)
Q Consensus        33 ~~vac~TdDfAmQNVllqmGL~~~   56 (212)
                      .+-+++|.|+.|=-=+ .+|++.+
T Consensus        47 e~rIllTRDr~L~~r~-k~g~~~i   69 (165)
T COG1656          47 EGRILLTRDRELYKRA-KLGIKAI   69 (165)
T ss_pred             CCeEEEeccHHHHHHh-hccCceE
Confidence            4567788888775544 5665543


No 180
>PRK14138 NAD-dependent deacetylase; Provisional
Probab=54.89  E-value=10  Score=33.42  Aligned_cols=26  Identities=15%  Similarity=0.138  Sum_probs=16.4

Q ss_pred             EEEEccCcccccccc---------CccccCCCCCC
Q 028198           69 WILKCHACYTITAEI---------GRIFCPKCGNG   94 (212)
Q Consensus        69 wvlrC~aC~k~~~~~---------~k~FCp~CG~~   94 (212)
                      ..++|..|.+.+...         ...-||.||..
T Consensus       118 ~~~~C~~C~~~~~~~~~~~~~~~~~~p~Cp~Cgg~  152 (244)
T PRK14138        118 EEYYCVRCGKRYTVEDVIEKLEKSDVPRCDDCSGL  152 (244)
T ss_pred             CeeEECCCCCcccHHHHHHHHhcCCCCCCCCCCCe
Confidence            447788888776420         12348888864


No 181
>PRK09263 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=54.84  E-value=10  Score=38.71  Aligned_cols=25  Identities=36%  Similarity=0.627  Sum_probs=16.5

Q ss_pred             EEEccCccccccc---cCccccCCCCCC
Q 028198           70 ILKCHACYTITAE---IGRIFCPKCGNG   94 (212)
Q Consensus        70 vlrC~aC~k~~~~---~~k~FCp~CG~~   94 (212)
                      +-+|..|+.....   .....||.||+.
T Consensus       641 ~~~C~~CG~~Ge~~~~~~~~~CP~CG~~  668 (711)
T PRK09263        641 IDECYECGFTGEFECTEKGFTCPKCGNH  668 (711)
T ss_pred             CcccCCCCCCccccCCCCCCcCcCCCCC
Confidence            3589999973211   112579999985


No 182
>cd00296 SIR2 SIR2 superfamily of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose. Sir2 proteins, also known as sirtuins, are found in all eukaryotes and many archaea and prokaryotes and have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The oligomerization state of Sir2 appears to be organism-dependent, sometimes occurring as a monomer and sometimes as a multimer. Also included in this superfamily is a group of uncharacterized Sir2-like proteins which lack certain key catalytic
Probab=54.83  E-value=11  Score=31.73  Aligned_cols=53  Identities=23%  Similarity=0.343  Sum_probs=34.0

Q ss_pred             eeeEecchHHHHHHHHHhCce---eecCCCCcceeeeeEEEEccCcccccccc------CccccCCCCCC
Q 028198           34 TVACITGDYAMQNVILQMGLR---LLAPGGMQIRQLHRWILKCHACYTITAEI------GRIFCPKCGNG   94 (212)
Q Consensus        34 ~vac~TdDfAmQNVllqmGL~---~~s~~g~~I~~~k~wvlrC~aC~k~~~~~------~k~FCp~CG~~   94 (212)
                      .+.++|.-  +.+...+.|..   |+-++|.      ....+|..|.+.+...      ....||.||..
T Consensus        82 ~~~iiTqN--iD~L~~~ag~~~~~v~~lHG~------~~~~~C~~C~~~~~~~~~~~~~~~p~C~~C~~~  143 (222)
T cd00296          82 LKRIITQN--VDGLHERAGSRRNRVIELHGS------LDRVRCTSCGKEYPRDEVLEREKPPRCPKCGGL  143 (222)
T ss_pred             CceEEecC--hHHHHHHhCCCcCcEEEecCC------CCccEECCCCCCcchhhhhhccCCCCCCCCCCc
Confidence            34677764  35666777765   6667775      3446799998765321      13469999975


No 183
>PF05991 NYN_YacP:  YacP-like NYN domain;  InterPro: IPR010298 This family consists of several hypothetical bacterial proteins as well as some uncharacterised sequences from Arabidopsis thaliana. The function of this family is unknown.
Probab=54.62  E-value=13  Score=31.00  Aligned_cols=44  Identities=14%  Similarity=0.245  Sum_probs=32.8

Q ss_pred             CCCcCCCCceeeecC---C--CceeeEecchHHHHHHHHHhCceeecCC
Q 028198           16 VDDECSEQSWMLRSL---S--ESTVACITGDYAMQNVILQMGLRLLAPG   59 (212)
Q Consensus        16 ~~d~~s~~~Wi~~~l---~--~~~vac~TdDfAmQNVllqmGL~~~s~~   59 (212)
                      +.+..+-.+||..-+   .  ...|.++|+|.++|..+...|...++..
T Consensus        73 t~~~~tAD~~Ie~~v~~~~~~~~~v~VVTSD~~iq~~~~~~GA~~iss~  121 (166)
T PF05991_consen   73 TKEGETADDYIERLVRELKNRPRQVTVVTSDREIQRAARGRGAKRISSE  121 (166)
T ss_pred             CCCCCCHHHHHHHHHHHhccCCCeEEEEeCCHHHHHHHhhCCCEEEcHH
Confidence            334455566776432   2  4789999999999999999999988654


No 184
>PRK15103 paraquat-inducible membrane protein A; Provisional
Probab=54.33  E-value=6.4  Score=37.70  Aligned_cols=24  Identities=29%  Similarity=0.787  Sum_probs=18.7

Q ss_pred             EEccCcccccccc-----CccccCCCCCC
Q 028198           71 LKCHACYTITAEI-----GRIFCPKCGNG   94 (212)
Q Consensus        71 lrC~aC~k~~~~~-----~k~FCp~CG~~   94 (212)
                      ..|+.|..+....     .+-.||.||+.
T Consensus        11 ~~C~~Cd~l~~~~~l~~g~~a~CpRCg~~   39 (419)
T PRK15103         11 ILCPQCDMLVALPRLEHGQKAACPRCGTT   39 (419)
T ss_pred             ccCCCCCceeecCCCCCCCeeECCCCCCC
Confidence            5599999887532     25679999986


No 185
>COG2126 RPL37A Ribosomal protein L37E [Translation, ribosomal structure and biogenesis]
Probab=54.15  E-value=5.7  Score=28.87  Aligned_cols=27  Identities=22%  Similarity=0.733  Sum_probs=23.0

Q ss_pred             eEEEEccCccccccccCccccCCCCCC
Q 028198           68 RWILKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        68 ~wvlrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      .---+|..|++.....-+..|..||-+
T Consensus        14 ~tH~~CRRCGr~syhv~k~~CaaCGfg   40 (61)
T COG2126          14 KTHIRCRRCGRRSYHVRKKYCAACGFG   40 (61)
T ss_pred             cceehhhhccchheeeccceecccCCC
Confidence            455689999998877778999999986


No 186
>PRK09521 exosome complex RNA-binding protein Csl4; Provisional
Probab=53.58  E-value=7.7  Score=32.73  Aligned_cols=31  Identities=32%  Similarity=0.635  Sum_probs=22.2

Q ss_pred             EEEccCccccc-ccc-CccccCCCCCCCceeEEE
Q 028198           70 ILKCHACYTIT-AEI-GRIFCPKCGNGGTLRKVA  101 (212)
Q Consensus        70 vlrC~aC~k~~-~~~-~k~FCp~CG~~~TL~Rvs  101 (212)
                      .-+|..|+... +-. ....||.||+. -.+|||
T Consensus       149 ~a~~~~~g~~~~~~~~~~~~c~~~~~~-e~rkva  181 (189)
T PRK09521        149 YAMCSRCRTPLVKKGENELKCPNCGNI-ETRKLS  181 (189)
T ss_pred             EEEccccCCceEECCCCEEECCCCCCE-Eeeccc
Confidence            34788899743 322 35789999987 678887


No 187
>PRK14289 chaperone protein DnaJ; Provisional
Probab=53.38  E-value=51  Score=30.86  Aligned_cols=28  Identities=25%  Similarity=0.455  Sum_probs=18.5

Q ss_pred             EEEEccCccccccccCccccCCCCCCCce
Q 028198           69 WILKCHACYTITAEIGRIFCPKCGNGGTL   97 (212)
Q Consensus        69 wvlrC~aC~k~~~~~~k~FCp~CG~~~TL   97 (212)
                      ....|..|.-.... .+.+|+.|++.+++
T Consensus       196 ~~~~C~~C~G~G~~-~~~~C~~C~G~g~v  223 (386)
T PRK14289        196 TQSTCPTCNGEGKI-IKKKCKKCGGEGIV  223 (386)
T ss_pred             EEEecCCCCccccc-cCcCCCCCCCCcEE
Confidence            35678888755433 25689999987444


No 188
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=53.21  E-value=8.9  Score=31.85  Aligned_cols=27  Identities=19%  Similarity=0.424  Sum_probs=18.6

Q ss_pred             eEEEEccCccccccc---c-CccccCCCCCC
Q 028198           68 RWILKCHACYTITAE---I-GRIFCPKCGNG   94 (212)
Q Consensus        68 ~wvlrC~aC~k~~~~---~-~k~FCp~CG~~   94 (212)
                      .=-|.|+.|+..++-   + .---||.||..
T Consensus       107 ~~~Y~Cp~c~~r~tf~eA~~~~F~Cp~Cg~~  137 (158)
T TIGR00373       107 NMFFICPNMCVRFTFNEAMELNFTCPRCGAM  137 (158)
T ss_pred             CCeEECCCCCcEeeHHHHHHcCCcCCCCCCE
Confidence            345899999966641   1 12459999985


No 189
>COG2176 PolC DNA polymerase III, alpha subunit (gram-positive type) [DNA replication, recombination, and repair]
Probab=53.10  E-value=7.2  Score=42.56  Aligned_cols=24  Identities=29%  Similarity=0.686  Sum_probs=18.4

Q ss_pred             EEccCcccc--cc--------ccCccccCCCCCC
Q 028198           71 LKCHACYTI--TA--------EIGRIFCPKCGNG   94 (212)
Q Consensus        71 lrC~aC~k~--~~--------~~~k~FCp~CG~~   94 (212)
                      |+|+-|...  ..        |++-.-||+||.+
T Consensus       915 Y~Cp~Cky~Ef~~d~svgsGfDLpdK~CPkCg~p  948 (1444)
T COG2176         915 YLCPECKYSEFIDDGSVGSGFDLPDKDCPKCGTP  948 (1444)
T ss_pred             ccCCCCceeeeecCCCcCCCCCCCCCCCCcCCCc
Confidence            899999843  22        3556789999998


No 190
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=52.95  E-value=7.3  Score=35.71  Aligned_cols=25  Identities=32%  Similarity=0.768  Sum_probs=18.5

Q ss_pred             EEEccCccccccc--c--CccccCCCCCC
Q 028198           70 ILKCHACYTITAE--I--GRIFCPKCGNG   94 (212)
Q Consensus        70 vlrC~aC~k~~~~--~--~k~FCp~CG~~   94 (212)
                      -.+|..|+++...  .  ....||+||+.
T Consensus        27 ~~~c~~c~~~~~~~~l~~~~~vc~~c~~h   55 (292)
T PRK05654         27 WTKCPSCGQVLYRKELEANLNVCPKCGHH   55 (292)
T ss_pred             eeECCCccchhhHHHHHhcCCCCCCCCCC
Confidence            3589999987532  1  24689999997


No 191
>PF01783 Ribosomal_L32p:  Ribosomal L32p protein family;  InterPro: IPR002677 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L32p is part of the 50S ribosomal subunit. This family is found in both prokaryotes and eukaryotes. Ribosomal protein L32 of yeast binds to and regulates the splicing and the translation of the transcript of its own gene [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0015934 large ribosomal subunit; PDB: 3PYT_2 3F1F_5 3PYV_2 3D5B_5 3MRZ_2 3D5D_5 3F1H_5 1VSP_Y 3PYR_2 3MS1_2 ....
Probab=52.80  E-value=12  Score=26.07  Aligned_cols=21  Identities=33%  Similarity=0.816  Sum_probs=15.4

Q ss_pred             EEccCccccccccCccccCCCCC
Q 028198           71 LKCHACYTITAEIGRIFCPKCGN   93 (212)
Q Consensus        71 lrC~aC~k~~~~~~k~FCp~CG~   93 (212)
                      -.|..|+.+..  ....||.||.
T Consensus        27 ~~c~~cg~~~~--~H~vc~~cG~   47 (56)
T PF01783_consen   27 VKCPNCGEPKL--PHRVCPSCGY   47 (56)
T ss_dssp             EESSSSSSEES--TTSBCTTTBB
T ss_pred             eeeccCCCEec--ccEeeCCCCe
Confidence            57888986553  4578999984


No 192
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=52.53  E-value=7.6  Score=35.52  Aligned_cols=25  Identities=32%  Similarity=0.878  Sum_probs=18.6

Q ss_pred             EEEEccCccccccc--c--CccccCCCCCC
Q 028198           69 WILKCHACYTITAE--I--GRIFCPKCGNG   94 (212)
Q Consensus        69 wvlrC~aC~k~~~~--~--~k~FCp~CG~~   94 (212)
                      |. +|..|+++...  .  ....||+||++
T Consensus        26 ~~-~c~~c~~~~~~~~l~~~~~vc~~c~~h   54 (285)
T TIGR00515        26 WT-KCPKCGQVLYTKELERNLEVCPKCDHH   54 (285)
T ss_pred             ee-ECCCCcchhhHHHHHhhCCCCCCCCCc
Confidence            54 69999987532  1  34789999997


No 193
>PF14206 Cys_rich_CPCC:  Cysteine-rich CPCC
Probab=52.46  E-value=6.8  Score=29.60  Aligned_cols=23  Identities=30%  Similarity=0.462  Sum_probs=12.1

Q ss_pred             EEccCcccccccc----CccccCCCCC
Q 028198           71 LKCHACYTITAEI----GRIFCPKCGN   93 (212)
Q Consensus        71 lrC~aC~k~~~~~----~k~FCp~CG~   93 (212)
                      +.|+-|+..|-+.    +.+.||+|+=
T Consensus         2 ~~CPCCg~~Tl~~~~~~~ydIC~VC~W   28 (78)
T PF14206_consen    2 YPCPCCGYYTLEERGEGTYDICPVCFW   28 (78)
T ss_pred             ccCCCCCcEEeccCCCcCceECCCCCc
Confidence            4566666554321    1346666664


No 194
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=52.42  E-value=7.4  Score=36.00  Aligned_cols=25  Identities=28%  Similarity=0.963  Sum_probs=18.4

Q ss_pred             EEEEccCccccccc----cCccccCCCCCC
Q 028198           69 WILKCHACYTITAE----IGRIFCPKCGNG   94 (212)
Q Consensus        69 wvlrC~aC~k~~~~----~~k~FCp~CG~~   94 (212)
                      |. +|..|+++...    -....||+||+.
T Consensus        38 w~-kc~~C~~~~~~~~l~~~~~vcp~c~~h   66 (296)
T CHL00174         38 WV-QCENCYGLNYKKFLKSKMNICEQCGYH   66 (296)
T ss_pred             ee-ECCCccchhhHHHHHHcCCCCCCCCCC
Confidence            54 69999987532    224689999997


No 195
>COG1379 PHP family phosphoesterase with a Zn ribbon [General function prediction only]
Probab=52.33  E-value=4.7  Score=38.45  Aligned_cols=32  Identities=34%  Similarity=0.563  Sum_probs=23.0

Q ss_pred             ceeeeeEEEEccCcccccccc----CccccCCCCCC
Q 028198           63 IRQLHRWILKCHACYTITAEI----GRIFCPKCGNG   94 (212)
Q Consensus        63 I~~~k~wvlrC~aC~k~~~~~----~k~FCp~CG~~   94 (212)
                      .+--|-+.-.|..|++.|+-.    .+--||+||..
T Consensus       239 P~LGKY~~TAC~rC~t~y~le~A~~~~wrCpkCGg~  274 (403)
T COG1379         239 PRLGKYHLTACSRCYTRYSLEEAKSLRWRCPKCGGK  274 (403)
T ss_pred             ccccchhHHHHHHhhhccCcchhhhhcccCcccccc
Confidence            444456777899999887632    24679999985


No 196
>PRK04011 peptide chain release factor 1; Provisional
Probab=52.21  E-value=16  Score=34.93  Aligned_cols=27  Identities=37%  Similarity=0.728  Sum_probs=20.1

Q ss_pred             eEEEEccCcccccc-------ccCccccCCCCCC
Q 028198           68 RWILKCHACYTITA-------EIGRIFCPKCGNG   94 (212)
Q Consensus        68 ~wvlrC~aC~k~~~-------~~~k~FCp~CG~~   94 (212)
                      .+.++|..|+....       ......||.||..
T Consensus       326 r~~~~c~~c~~~~~~~~~~~~~~~~~~c~~~~~~  359 (411)
T PRK04011        326 RVTYKCPNCGYEEEKTVKRREELPEKTCPKCGSE  359 (411)
T ss_pred             eEEEEcCCCCcceeeecccccccccccCcccCcc
Confidence            57899999986532       1234689999986


No 197
>TIGR03826 YvyF flagellar operon protein TIGR03826. This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597.
Probab=52.11  E-value=4.6  Score=33.39  Aligned_cols=23  Identities=30%  Similarity=0.780  Sum_probs=19.9

Q ss_pred             EccCccccccccCccccCCCCCC
Q 028198           72 KCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        72 rC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      -|.-|+++|.......||.|...
T Consensus         5 nC~~CgklF~~~~~~iCp~C~~~   27 (137)
T TIGR03826         5 NCPKCGRLFVKTGRDVCPSCYEE   27 (137)
T ss_pred             cccccchhhhhcCCccCHHHhHH
Confidence            69999999987678899999963


No 198
>PRK14715 DNA polymerase II large subunit; Provisional
Probab=51.78  E-value=12  Score=41.36  Aligned_cols=27  Identities=26%  Similarity=0.634  Sum_probs=22.6

Q ss_pred             eeeeEEEEccCccccccccCccccCCCCCC
Q 028198           65 QLHRWILKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        65 ~~k~wvlrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      .+-.-..+|+.|++++..   ..||.||.+
T Consensus       669 ~vei~~~~Cp~Cg~~~~~---~~Cp~CG~~  695 (1627)
T PRK14715        669 DIEIAFFKCPKCGKVGLY---HVCPFCGTR  695 (1627)
T ss_pred             eEEEEeeeCCCCCCcccc---ccCcccCCc
Confidence            667778999999998764   579999976


No 199
>PRK04860 hypothetical protein; Provisional
Probab=51.74  E-value=20  Score=30.16  Aligned_cols=58  Identities=14%  Similarity=0.275  Sum_probs=34.5

Q ss_pred             hHHHHHHHHH-hCceeecCCCCccee--eeeEEEEccCcccccc----------ccCccccCCCCCCCceeEEE
Q 028198           41 DYAMQNVILQ-MGLRLLAPGGMQIRQ--LHRWILKCHACYTITA----------EIGRIFCPKCGNGGTLRKVA  101 (212)
Q Consensus        41 DfAmQNVllq-mGL~~~s~~g~~I~~--~k~wvlrC~aC~k~~~----------~~~k~FCp~CG~~~TL~Rvs  101 (212)
                      |-.-|-+|.+ +|+..-......|..  .+.|.|+|. |.+...          ...+..|..|+..  |..+.
T Consensus        87 g~ewk~lm~~v~g~~~r~~h~~~~~~~~~~~~~Y~C~-C~~~~~~~rrH~ri~~g~~~YrC~~C~~~--l~~~~  157 (160)
T PRK04860         87 GKEWQWMMESVLGVPARRTHQFEVQSVRGKTFPYRCK-CQEHQLTVRRHNRVVRGEAVYRCRRCGET--LVFKG  157 (160)
T ss_pred             CHHHHHHHHHhcCCCCcccCCCcCCccccCEEEEEcC-CCCeeCHHHHHHHHhcCCccEECCCCCce--eEEec
Confidence            5666777776 466332222122222  467999997 965332          1234789999985  76554


No 200
>COG3478 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=51.26  E-value=7.9  Score=28.72  Aligned_cols=7  Identities=86%  Similarity=2.048  Sum_probs=6.6

Q ss_pred             cCCCCCC
Q 028198           88 CPKCGNG   94 (212)
Q Consensus        88 Cp~CG~~   94 (212)
                      ||+||+.
T Consensus         7 CpKCgn~   13 (68)
T COG3478           7 CPKCGNT   13 (68)
T ss_pred             CCCcCCc
Confidence            9999996


No 201
>cd01409 SIRT4 SIRT4: Eukaryotic and prokaryotic group (class2) which includes human sirtuin SIRT4 and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.
Probab=51.12  E-value=12  Score=33.40  Aligned_cols=14  Identities=21%  Similarity=0.266  Sum_probs=9.7

Q ss_pred             eEEEEccCcccccc
Q 028198           68 RWILKCHACYTITA   81 (212)
Q Consensus        68 ~wvlrC~aC~k~~~   81 (212)
                      .+.++|..|.+.+.
T Consensus       116 ~~~~~C~~C~~~~~  129 (260)
T cd01409         116 LHRVVCLSCGFRTP  129 (260)
T ss_pred             cCEEEeCCCcCccC
Confidence            45577888887653


No 202
>PRK00448 polC DNA polymerase III PolC; Validated
Probab=50.93  E-value=9.2  Score=42.19  Aligned_cols=24  Identities=29%  Similarity=0.674  Sum_probs=18.4

Q ss_pred             EEccCcccccc----------ccCccccCCCCCC
Q 028198           71 LKCHACYTITA----------EIGRIFCPKCGNG   94 (212)
Q Consensus        71 lrC~aC~k~~~----------~~~k~FCp~CG~~   94 (212)
                      |+|+-|...-.          |++..-||+||.+
T Consensus       909 y~C~~C~~~ef~~~~~~~sG~Dlpdk~Cp~Cg~~  942 (1437)
T PRK00448        909 YVCPNCKYSEFFTDGSVGSGFDLPDKDCPKCGTK  942 (1437)
T ss_pred             ccCcccccccccccccccccccCccccCcccccc
Confidence            89999985432          4556789999987


No 203
>PF06221 zf-C2HC5:  Putative zinc finger motif, C2HC5-type;  InterPro: IPR009349 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This zinc finger appears to be common in activating signal cointegrator 1/thyroid receptor interacting protein 4. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=50.63  E-value=8.5  Score=27.50  Aligned_cols=32  Identities=31%  Similarity=0.557  Sum_probs=24.3

Q ss_pred             ceeeeeEEEEccCccccccc-cC-ccccCCCCCC
Q 028198           63 IRQLHRWILKCHACYTITAE-IG-RIFCPKCGNG   94 (212)
Q Consensus        63 I~~~k~wvlrC~aC~k~~~~-~~-k~FCp~CG~~   94 (212)
                      .+.+..|+--|..|+++.=. .. ..-|+.||++
T Consensus        11 ~H~L~~~~~NCl~CGkIiC~~Eg~~~pC~fCg~~   44 (57)
T PF06221_consen   11 RHPLFPYAPNCLNCGKIICEQEGPLGPCPFCGTP   44 (57)
T ss_pred             cCCCccccccccccChhhcccccCcCcCCCCCCc
Confidence            45566778899999999633 23 5789999987


No 204
>TIGR00155 pqiA_fam integral membrane protein, PqiA family. This family consists of uncharacterized predicted integral membrane proteins found, so far, only in the Proteobacteria. Of two members in E. coli, one is induced by paraquat and is designated PqiA, paraquat-inducible protein A.
Probab=50.40  E-value=10  Score=36.10  Aligned_cols=25  Identities=28%  Similarity=0.713  Sum_probs=18.9

Q ss_pred             EEEccCccccccc-----cCccccCCCCCC
Q 028198           70 ILKCHACYTITAE-----IGRIFCPKCGNG   94 (212)
Q Consensus        70 vlrC~aC~k~~~~-----~~k~FCp~CG~~   94 (212)
                      ...|+.|..+...     ..+-.||.||..
T Consensus        13 ~~~C~~Cd~l~~~~~l~~g~~a~CpRCg~~   42 (403)
T TIGR00155        13 HILCSQCDMLVALPRIESGQKAACPRCGTT   42 (403)
T ss_pred             eeeCCCCCCcccccCCCCCCeeECCCCCCC
Confidence            4579999988743     235679999986


No 205
>KOG3084 consensus NADH pyrophosphatase I of the Nudix family of hydrolases [Replication, recombination and repair]
Probab=50.14  E-value=7.1  Score=36.87  Aligned_cols=12  Identities=50%  Similarity=1.079  Sum_probs=10.1

Q ss_pred             ccccCCCCCCCce
Q 028198           85 RIFCPKCGNGGTL   97 (212)
Q Consensus        85 k~FCp~CG~~~TL   97 (212)
                      ..|||.||++ |.
T Consensus       150 ykFCp~CG~~-tk  161 (345)
T KOG3084|consen  150 YKFCPGCGSP-TK  161 (345)
T ss_pred             hccCcccCCC-cc
Confidence            4799999998 65


No 206
>PF09082 DUF1922:  Domain of unknown function (DUF1922);  InterPro: IPR015166 Members of this family consist of a beta-sheet region followed by an alpha-helix and an unstructured C terminus. The beta-sheet region contains a CXCX...XCXC sequence with Cys residues located in two proximal loops and pointing towards each other. This precise function of this set of bacterial proteins is, as yet, unknown []. ; PDB: 1GH9_A.
Probab=50.06  E-value=9.3  Score=28.38  Aligned_cols=24  Identities=29%  Similarity=0.661  Sum_probs=14.9

Q ss_pred             EEEEccCcccc-ccc--cCccccCCCCCC
Q 028198           69 WILKCHACYTI-TAE--IGRIFCPKCGNG   94 (212)
Q Consensus        69 wvlrC~aC~k~-~~~--~~k~FCp~CG~~   94 (212)
                      .+.|| .|++. +.+  ....-| .||..
T Consensus         2 lifrC-~Cgr~lya~e~~kTkkC-~CG~~   28 (68)
T PF09082_consen    2 LIFRC-DCGRYLYAKEGAKTKKC-VCGKT   28 (68)
T ss_dssp             EEEEE-TTS--EEEETT-SEEEE-TTTEE
T ss_pred             EEEEe-cCCCEEEecCCcceeEe-cCCCe
Confidence            47899 89975 332  224679 99984


No 207
>KOG1779 consensus 40s ribosomal protein S27 [Translation, ribosomal structure and biogenesis]
Probab=49.92  E-value=8  Score=29.70  Aligned_cols=24  Identities=29%  Similarity=0.747  Sum_probs=18.4

Q ss_pred             EEccCccccccc----cCccccCCCCCC
Q 028198           71 LKCHACYTITAE----IGRIFCPKCGNG   94 (212)
Q Consensus        71 lrC~aC~k~~~~----~~k~FCp~CG~~   94 (212)
                      .+|.+|++++.-    .+-..|+.|+.-
T Consensus        35 VkC~gc~~iT~vfSHaqtvVvc~~c~~i   62 (84)
T KOG1779|consen   35 VKCPGCFKITTVFSHAQTVVVCEGCSTI   62 (84)
T ss_pred             EEcCCceEEEEEeecCceEEEcCCCceE
Confidence            689999999853    235789999863


No 208
>cd01412 SIRT5_Af1_CobB SIRT5_Af1_CobB: Eukaryotic, archaeal and prokaryotic group (class3) which includes human sirtuin SIRT5, Archaeoglobus fulgidus Sir2-Af1, and E. coli CobB; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. CobB is a bacterial sirtuin that deacetylates acetyl-CoA synthetase at an active site lysine to stimulate its enzymatic activity.
Probab=49.64  E-value=11  Score=32.22  Aligned_cols=27  Identities=26%  Similarity=0.608  Sum_probs=18.6

Q ss_pred             eEEEEccCcccccccc------CccccCCCCCC
Q 028198           68 RWILKCHACYTITAEI------GRIFCPKCGNG   94 (212)
Q Consensus        68 ~wvlrC~aC~k~~~~~------~k~FCp~CG~~   94 (212)
                      ...++|..|.+.+...      ....||.||..
T Consensus       107 ~~~~~C~~C~~~~~~~~~~~~~~~p~C~~Cgg~  139 (224)
T cd01412         107 LFRVRCSSCGYVGENNEEIPEEELPRCPKCGGL  139 (224)
T ss_pred             cCccccCCCCCCCCcchhhhccCCCCCCCCCCc
Confidence            4457899999876531      12469999974


No 209
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=49.56  E-value=9.3  Score=26.94  Aligned_cols=24  Identities=29%  Similarity=0.778  Sum_probs=17.1

Q ss_pred             EEEccCcccccccc-----CccccCCCCC
Q 028198           70 ILKCHACYTITAEI-----GRIFCPKCGN   93 (212)
Q Consensus        70 vlrC~aC~k~~~~~-----~k~FCp~CG~   93 (212)
                      ..||..|.++-...     -..-||.||.
T Consensus         4 eiRC~~CnklLa~~g~~~~leIKCpRC~t   32 (51)
T PF10122_consen    4 EIRCGHCNKLLAKAGEVIELEIKCPRCKT   32 (51)
T ss_pred             ceeccchhHHHhhhcCccEEEEECCCCCc
Confidence            36999999875432     1356999995


No 210
>COG1328 NrdD Oxygen-sensitive ribonucleoside-triphosphate reductase [Nucleotide transport and metabolism]
Probab=49.28  E-value=9.5  Score=39.18  Aligned_cols=47  Identities=19%  Similarity=0.356  Sum_probs=29.0

Q ss_pred             cchHHHHHHHHH---hCceeecCCCCcceeeeeEEEEccCccccccccCccccCCCCCC
Q 028198           39 TGDYAMQNVILQ---MGLRLLAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        39 TdDfAmQNVllq---mGL~~~s~~g~~I~~~k~wvlrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      .+-=|+.++...   .++..++.. ..       +-.|..|+....-.... ||+||+.
T Consensus       615 ~~~eal~~l~k~~~~~ri~Y~~~n-~~-------i~~C~~cg~~~~~~~~~-Cp~CG~~  664 (700)
T COG1328         615 ADPEALMDLTKYIYKTRIGYWGYT-TP-------ISVCNRCGYSGEGLRTR-CPKCGSE  664 (700)
T ss_pred             CCHHHHHHHHHHHHhcCcceEecC-CC-------ceeeccCCccccccccc-CCCCCCc
Confidence            345677777663   355555554 22       34699999865422212 9999997


No 211
>PF04828 GFA:  Glutathione-dependent formaldehyde-activating enzyme;  InterPro: IPR006913 The GFA family consists mainly of glutathione-dependent formaldehyde-activating enzymes, but also includes centromere protein V and a fission yeast protein described as uncharacterised lyase. Glutathione-dependent formaldehyde-activating enzyme catalyse the condensation of formaldehyde and glutathione to S-hydroxymethylglutathione.  All known members of this family contain 5 strongly conserved cysteine residues.; GO: 0016846 carbon-sulfur lyase activity, 0008152 metabolic process; PDB: 3FAC_B 1XA8_A 1X6M_B.
Probab=49.26  E-value=5.6  Score=28.28  Aligned_cols=15  Identities=40%  Similarity=1.057  Sum_probs=9.9

Q ss_pred             ccccCccccCCCCCC
Q 028198           80 TAEIGRIFCPKCGNG   94 (212)
Q Consensus        80 ~~~~~k~FCp~CG~~   94 (212)
                      .....+.||+.||..
T Consensus        43 ~~~~~r~FC~~CGs~   57 (92)
T PF04828_consen   43 GKGVERYFCPTCGSP   57 (92)
T ss_dssp             TSSCEEEEETTT--E
T ss_pred             CCcCcCcccCCCCCe
Confidence            444568999999986


No 212
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=49.24  E-value=14  Score=26.94  Aligned_cols=19  Identities=37%  Similarity=0.677  Sum_probs=12.7

Q ss_pred             ccCCCCCCCceeEEEEEeCC
Q 028198           87 FCPKCGNGGTLRKVAVTVGE  106 (212)
Q Consensus        87 FCp~CG~~~TL~Rvsvsv~~  106 (212)
                      -||+||+. ...-=.|..+.
T Consensus         2 ~C~KCg~~-~~e~~~v~~tg   20 (64)
T PF09855_consen    2 KCPKCGNE-EYESGEVRATG   20 (64)
T ss_pred             CCCCCCCc-ceecceEEccC
Confidence            49999997 66555544433


No 213
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=48.86  E-value=7.3  Score=23.51  Aligned_cols=13  Identities=31%  Similarity=0.848  Sum_probs=5.5

Q ss_pred             ccCCCCCCCceeEEE
Q 028198           87 FCPKCGNGGTLRKVA  101 (212)
Q Consensus        87 FCp~CG~~~TL~Rvs  101 (212)
                      -||.||+.  +.++.
T Consensus         3 ~C~rC~~~--~~~~~   15 (30)
T PF06827_consen    3 KCPRCWNY--IEDIG   15 (30)
T ss_dssp             B-TTT--B--BEEEE
T ss_pred             cCccCCCc--ceEeE
Confidence            37777764  55444


No 214
>COG1631 RPL42A Ribosomal protein L44E [Translation, ribosomal structure and biogenesis]
Probab=48.78  E-value=12  Score=29.48  Aligned_cols=18  Identities=39%  Similarity=0.861  Sum_probs=14.7

Q ss_pred             ccccCCCCCCCceeEEEEE
Q 028198           85 RIFCPKCGNGGTLRKVAVT  103 (212)
Q Consensus        85 k~FCp~CG~~~TL~Rvsvs  103 (212)
                      +.|||.|... |+..|+-.
T Consensus         8 ~tyCp~Ckkh-T~H~V~~~   25 (94)
T COG1631           8 RTYCPYCKKH-TIHKVERV   25 (94)
T ss_pred             eecCcccccc-eeeeeeeh
Confidence            5699999997 98888743


No 215
>COG0498 ThrC Threonine synthase [Amino acid transport and metabolism]
Probab=48.60  E-value=10  Score=36.49  Aligned_cols=27  Identities=26%  Similarity=0.472  Sum_probs=21.9

Q ss_pred             eEEEEccCcccccccc-CccccCCCCCC
Q 028198           68 RWILKCHACYTITAEI-GRIFCPKCGNG   94 (212)
Q Consensus        68 ~wvlrC~aC~k~~~~~-~k~FCp~CG~~   94 (212)
                      -..+||..|++.+.+- -...||.||..
T Consensus         3 ~~~~rc~~cg~~f~~a~~~~~c~~cGl~   30 (411)
T COG0498           3 YVSLRCLKCGREFSQALLQGLCPDCGLF   30 (411)
T ss_pred             eeEeecCCCCcchhhHHhhCcCCcCCcc
Confidence            4679999999888743 35899999985


No 216
>PHA02942 putative transposase; Provisional
Probab=47.92  E-value=24  Score=33.37  Aligned_cols=42  Identities=24%  Similarity=0.426  Sum_probs=25.1

Q ss_pred             HHHHhCceeecCCCCcceeeeeEEEEccCccccccccC-c-cccCCCCCC
Q 028198           47 VILQMGLRLLAPGGMQIRQLHRWILKCHACYTITAEIG-R-IFCPKCGNG   94 (212)
Q Consensus        47 VllqmGL~~~s~~g~~I~~~k~wvlrC~aC~k~~~~~~-k-~FCp~CG~~   94 (212)
                      .+...|+.|+-++-.-      =-..|+.|+....... + -.||.||..
T Consensus       308 KA~~~G~~Vv~V~p~y------TSq~Cs~CG~~~~~l~~r~f~C~~CG~~  351 (383)
T PHA02942        308 QAKKHGMIVEFVNPSY------SSVSCPKCGHKMVEIAHRYFHCPSCGYE  351 (383)
T ss_pred             HHHHhCCEEEEECCCC------CCccCCCCCCccCcCCCCEEECCCCCCE
Confidence            4555677776554221      1267888987654322 2 458889875


No 217
>PRK15103 paraquat-inducible membrane protein A; Provisional
Probab=47.77  E-value=10  Score=36.30  Aligned_cols=24  Identities=25%  Similarity=0.779  Sum_probs=18.8

Q ss_pred             EEEccCccccccccCccccCCCCCC
Q 028198           70 ILKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        70 vlrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      ...|+.|..+.+. .+..||.||..
T Consensus       221 l~~C~~Cd~l~~~-~~a~CpRC~~~  244 (419)
T PRK15103        221 LRSCSCCTAILPA-DQPVCPRCHTK  244 (419)
T ss_pred             CCcCCCCCCCCCC-CCCCCCCCCCc
Confidence            4469999998754 45689999985


No 218
>TIGR01405 polC_Gram_pos DNA polymerase III, alpha chain, Gram-positive type. The N-terminal region of about 200 amino acids is rich in low-complexity sequence, poorly alignable, and not included n this model.
Probab=47.57  E-value=11  Score=40.78  Aligned_cols=24  Identities=29%  Similarity=0.650  Sum_probs=18.2

Q ss_pred             EEccCccccc----------cccCccccCCCCCC
Q 028198           71 LKCHACYTIT----------AEIGRIFCPKCGNG   94 (212)
Q Consensus        71 lrC~aC~k~~----------~~~~k~FCp~CG~~   94 (212)
                      |+|+-|....          .|++..-||+||.+
T Consensus       684 y~c~~c~~~ef~~~~~~~sg~dlp~k~cp~c~~~  717 (1213)
T TIGR01405       684 YLCPNCKYSEFITDGSVGSGFDLPDKDCPKCGAP  717 (1213)
T ss_pred             ccCcccccccccccccccccccCccccCcccccc
Confidence            8999998532          24556789999986


No 219
>cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, U=I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specifici
Probab=47.43  E-value=36  Score=26.07  Aligned_cols=24  Identities=33%  Similarity=0.350  Sum_probs=13.5

Q ss_pred             eCCCceEEeecCCccccccceeccC
Q 028198          104 VGENGIVLASRRPRITLRGTKFSLP  128 (212)
Q Consensus       104 v~~~G~~~~~~k~~~n~RG~~ySlP  128 (212)
                      +-.+|.+++.++.... +...|+||
T Consensus        20 i~~~~~vLL~kr~~~~-~~g~w~lP   43 (130)
T cd04511          20 PEWEGKVLLCRRAIEP-RHGFWTLP   43 (130)
T ss_pred             EecCCEEEEEEecCCC-CCCeEECC
Confidence            3445777666554322 33468877


No 220
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=46.66  E-value=15  Score=34.72  Aligned_cols=37  Identities=22%  Similarity=0.619  Sum_probs=14.3

Q ss_pred             EEccCccccc---cccCccccCCCCCCCceeEEEEEeCCCc
Q 028198           71 LKCHACYTIT---AEIGRIFCPKCGNGGTLRKVAVTVGENG  108 (212)
Q Consensus        71 lrC~aC~k~~---~~~~k~FCp~CG~~~TL~Rvsvsv~~~G  108 (212)
                      .+|..|+.-+   ..++..-|++||+. -..|+++.-...|
T Consensus       286 FkC~~C~~Rt~sl~r~P~~~C~~Cg~~-~wer~~M~~ek~~  325 (344)
T PF09332_consen  286 FKCKDCGNRTISLERLPKKHCSNCGSS-KWERTGMLKEKKG  325 (344)
T ss_dssp             EE-T-TS-EEEESSSS--S--TTT-S----EEE---SSS--
T ss_pred             EECCCCCCeeeecccCCCCCCCcCCcC-ceeehhhhhhhcc
Confidence            6899998532   23456789999986 7899887543334


No 221
>TIGR00340 zpr1_rel ZPR1-related zinc finger protein. A model ZPR1_znf (TIGR00310) has been created to describe the domain shared by this protein and ZPR1.
Probab=46.44  E-value=15  Score=31.06  Aligned_cols=12  Identities=58%  Similarity=1.320  Sum_probs=7.7

Q ss_pred             cCCCCCCCceeEE
Q 028198           88 CPKCGNGGTLRKV  100 (212)
Q Consensus        88 Cp~CG~~~TL~Rv  100 (212)
                      ||.||++ +++.+
T Consensus         1 CP~Cg~~-~~~~~   12 (163)
T TIGR00340         1 CPVCGSR-TLKAV   12 (163)
T ss_pred             CCCCCCc-ceEee
Confidence            7777765 56554


No 222
>COG1458 Predicted DNA-binding protein containing PIN domain [General function prediction only]
Probab=46.30  E-value=17  Score=32.45  Aligned_cols=28  Identities=21%  Similarity=0.398  Sum_probs=25.8

Q ss_pred             CCceeeEecchHHHHHHHHHhCceeecC
Q 028198           31 SESTVACITGDYAMQNVILQMGLRLLAP   58 (212)
Q Consensus        31 ~~~~vac~TdDfAmQNVllqmGL~~~s~   58 (212)
                      .++++++++.|.++.--+.+|||.++..
T Consensus       172 kELdaavVssD~Gir~WAe~LGlrfv~a  199 (221)
T COG1458         172 KELDAAVVSSDEGIRTWAEKLGLRFVDA  199 (221)
T ss_pred             HHhCceEEecchhHHHHHHHhCCeeeCH
Confidence            4789999999999999999999999865


No 223
>PF01667 Ribosomal_S27e:  Ribosomal protein S27;  InterPro: IPR000592 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaeal ribosomal proteins can be grouped on the basis of sequence similarities. One of these families include mammalian, yeast, Chlamydomonas reinhardtii and Entamoeba histolytica S27, and Methanocaldococcus jannaschii (Methanococcus jannaschii) MJ0250 []. These proteins have from 62 to 87 amino acids. They contain, in their central section, a putative zinc-finger region of the type C-x(2)-C-x(14)-C-x(2)-C.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 1QXF_A 3IZ6_X 2XZN_6 2XZM_6 3U5G_b 3IZB_X 3U5C_b.
Probab=46.22  E-value=13  Score=26.45  Aligned_cols=25  Identities=32%  Similarity=0.703  Sum_probs=14.2

Q ss_pred             EEEccCccccccc----cCccccCCCCCC
Q 028198           70 ILKCHACYTITAE----IGRIFCPKCGNG   94 (212)
Q Consensus        70 vlrC~aC~k~~~~----~~k~FCp~CG~~   94 (212)
                      ..+|.+|+++.-.    .+...|..||..
T Consensus         7 ~VkCp~C~~~q~vFSha~t~V~C~~Cg~~   35 (55)
T PF01667_consen    7 DVKCPGCYNIQTVFSHAQTVVKCVVCGTV   35 (55)
T ss_dssp             EEE-TTT-SEEEEETT-SS-EE-SSSTSE
T ss_pred             EEECCCCCCeeEEEecCCeEEEcccCCCE
Confidence            4679999976532    236789999973


No 224
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=45.76  E-value=10  Score=24.49  Aligned_cols=11  Identities=36%  Similarity=1.047  Sum_probs=8.8

Q ss_pred             cccCCCCCCCce
Q 028198           86 IFCPKCGNGGTL   97 (212)
Q Consensus        86 ~FCp~CG~~~TL   97 (212)
                      ..||.||+. ++
T Consensus         3 ~~Cp~Cg~~-~~   13 (47)
T PF14690_consen    3 PRCPHCGSP-SV   13 (47)
T ss_pred             ccCCCcCCC-ce
Confidence            479999998 54


No 225
>PF02005 TRM:  N2,N2-dimethylguanosine tRNA methyltransferase;  InterPro: IPR002905 This enzyme 2.1.1.32 from EC uses S-adenosyl-L-methionine to methylate tRNA:  S-AdoMet + tRNA = S-adenosyl-L-homocysteine + tRNA containing N2-methylguanine The TRM1 gene of Saccharomyces cerevisiae is necessary for the N2,N2-dimethylguanosine modification of both mitochondrial and cytoplasmic tRNAs []. The enzyme is found in both eukaryotes and archaea [].; GO: 0003723 RNA binding, 0004809 tRNA (guanine-N2-)-methyltransferase activity, 0008033 tRNA processing; PDB: 2YTZ_B 2DUL_A 2EJU_A 2EJT_A 3AXT_A 3AXS_A.
Probab=45.34  E-value=15  Score=34.63  Aligned_cols=28  Identities=21%  Similarity=0.635  Sum_probs=16.9

Q ss_pred             eeEEEEccCcccc--ccccC--ccccCCCCCC
Q 028198           67 HRWILKCHACYTI--TAEIG--RIFCPKCGNG   94 (212)
Q Consensus        67 k~wvlrC~aC~k~--~~~~~--k~FCp~CG~~   94 (212)
                      ..|++.|+.|...  .....  +..||.||.+
T Consensus       237 ~G~v~~C~~C~~~~~~~~~~~~~~~c~~cg~~  268 (377)
T PF02005_consen  237 LGYVYYCPSCGYREEVKGLQKLKSKCPECGSK  268 (377)
T ss_dssp             EEEEEEETTT--EECCT-GCC--CEETTT-SC
T ss_pred             eeEEEECCCccccccccCccccCCcCCCCCCc
Confidence            5799999999742  11111  3679999997


No 226
>PTZ00157 60S ribosomal protein L36a; Provisional
Probab=44.88  E-value=15  Score=28.30  Aligned_cols=19  Identities=37%  Similarity=0.744  Sum_probs=16.1

Q ss_pred             ccccCCCCCCCceeEEEEEe
Q 028198           85 RIFCPKCGNGGTLRKVAVTV  104 (212)
Q Consensus        85 k~FCp~CG~~~TL~Rvsvsv  104 (212)
                      +-|||.|+.. |+.+|+-.-
T Consensus         9 ~tyC~~C~kH-t~HkV~qyK   27 (84)
T PTZ00157          9 KTYCKKCGKH-TSHKVSQYK   27 (84)
T ss_pred             cccCcCCCCC-ccEEEEEec
Confidence            5799999998 999998653


No 227
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=44.75  E-value=23  Score=32.85  Aligned_cols=31  Identities=26%  Similarity=0.475  Sum_probs=21.7

Q ss_pred             EEEccCccccccccCccccCCCCCCCceeEEE
Q 028198           70 ILKCHACYTITAEIGRIFCPKCGNGGTLRKVA  101 (212)
Q Consensus        70 vlrC~aC~k~~~~~~k~FCp~CG~~~TL~Rvs  101 (212)
                      .+.|.-|.....- .+.-||.||+...|...+
T Consensus       210 yL~CslC~teW~~-~R~~C~~Cg~~~~l~y~~  240 (305)
T TIGR01562       210 YLSCSLCATEWHY-VRVKCSHCEESKHLAYLS  240 (305)
T ss_pred             EEEcCCCCCcccc-cCccCCCCCCCCceeeEe
Confidence            5788888876653 478899999864444443


No 228
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=44.57  E-value=20  Score=30.10  Aligned_cols=8  Identities=38%  Similarity=0.891  Sum_probs=4.3

Q ss_pred             cccCCCCC
Q 028198           86 IFCPKCGN   93 (212)
Q Consensus        86 ~FCp~CG~   93 (212)
                      .-||.||.
T Consensus        29 ~~c~~c~~   36 (154)
T PRK00464         29 RECLACGK   36 (154)
T ss_pred             eeccccCC
Confidence            34666653


No 229
>KOG3799 consensus Rab3 effector RIM1 and related proteins, contain Rab3a binding domain [Intracellular trafficking, secretion, and vesicular transport]
Probab=44.53  E-value=11  Score=31.93  Aligned_cols=16  Identities=38%  Similarity=0.858  Sum_probs=11.6

Q ss_pred             cCccccCCCCCCCcee
Q 028198           83 IGRIFCPKCGNGGTLR   98 (212)
Q Consensus        83 ~~k~FCp~CG~~~TL~   98 (212)
                      ....||..||.+.+|+
T Consensus        87 Cq~r~CARCGGrv~lr  102 (169)
T KOG3799|consen   87 CQTRFCARCGGRVSLR  102 (169)
T ss_pred             hhhhHHHhcCCeeeec
Confidence            3457999999984443


No 230
>KOG2906 consensus RNA polymerase III subunit C11 [Transcription]
Probab=43.94  E-value=10  Score=30.27  Aligned_cols=9  Identities=67%  Similarity=1.752  Sum_probs=8.0

Q ss_pred             cccCCCCCC
Q 028198           86 IFCPKCGNG   94 (212)
Q Consensus        86 ~FCp~CG~~   94 (212)
                      .|||.|||-
T Consensus         2 ~FCP~Cgn~   10 (105)
T KOG2906|consen    2 LFCPTCGNM   10 (105)
T ss_pred             cccCCCCCE
Confidence            599999995


No 231
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed
Probab=43.93  E-value=16  Score=25.93  Aligned_cols=9  Identities=44%  Similarity=1.350  Sum_probs=4.3

Q ss_pred             cccCCCCCC
Q 028198           86 IFCPKCGNG   94 (212)
Q Consensus        86 ~FCp~CG~~   94 (212)
                      ..||.||+.
T Consensus        28 ~~C~~CG~~   36 (57)
T PRK12286         28 VECPNCGEP   36 (57)
T ss_pred             eECCCCCCc
Confidence            345555544


No 232
>TIGR01031 rpmF_bact ribosomal protein L32. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus.
Probab=43.85  E-value=15  Score=25.81  Aligned_cols=19  Identities=32%  Similarity=0.871  Sum_probs=9.9

Q ss_pred             EccCccccccccCccccCCCC
Q 028198           72 KCHACYTITAEIGRIFCPKCG   92 (212)
Q Consensus        72 rC~aC~k~~~~~~k~FCp~CG   92 (212)
                      .|..|+....  .-..||.||
T Consensus        28 ~C~~cG~~~~--~H~vc~~cG   46 (55)
T TIGR01031        28 VCPNCGEFKL--PHRVCPSCG   46 (55)
T ss_pred             ECCCCCCccc--CeeECCccC
Confidence            4666665432  234566666


No 233
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=43.50  E-value=12  Score=29.57  Aligned_cols=26  Identities=23%  Similarity=0.475  Sum_probs=18.9

Q ss_pred             EEccCcccccccc--C-ccccCCCCCCCce
Q 028198           71 LKCHACYTITAEI--G-RIFCPKCGNGGTL   97 (212)
Q Consensus        71 lrC~aC~k~~~~~--~-k~FCp~CG~~~TL   97 (212)
                      -+|..|+.++.+.  . ---||.|-+. -+
T Consensus        59 a~CkkCGfef~~~~ik~pSRCP~CKSE-~I   87 (97)
T COG3357          59 ARCKKCGFEFRDDKIKKPSRCPKCKSE-WI   87 (97)
T ss_pred             hhhcccCccccccccCCcccCCcchhh-cc
Confidence            4799999888761  1 2469999986 44


No 234
>COG3791 Uncharacterized conserved protein [Function unknown]
Probab=43.22  E-value=13  Score=29.96  Aligned_cols=12  Identities=58%  Similarity=1.375  Sum_probs=9.9

Q ss_pred             cCccccCCCCCC
Q 028198           83 IGRIFCPKCGNG   94 (212)
Q Consensus        83 ~~k~FCp~CG~~   94 (212)
                      ..+.||+.||.+
T Consensus        67 ~~r~FC~~CGs~   78 (133)
T COG3791          67 AGRGFCPTCGSP   78 (133)
T ss_pred             CCCeecccCCCc
Confidence            346799999997


No 235
>PF00471 Ribosomal_L33:  Ribosomal protein L33;  InterPro: IPR001705 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L33 is one of the proteins from the large ribosomal subunit. In Escherichia coli, L33 has been shown to be on the surface of 50S subunit. L33 belongs to a family of ribosomal proteins which, on the basis of sequence similarities [, , ], groups:  Eubacterial L33. Algal and plant chloroplast L33. Cyanelle L33.   L33 is a small protein of 49 to 66 amino-acid residues.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 3PIO_1 3PIP_1 3PYT_3 3MS1_3 3F1F_6 3F1H_6 3MRZ_3 3PYO_3 3D5B_6 3D5D_6 ....
Probab=42.37  E-value=12  Score=25.69  Aligned_cols=30  Identities=27%  Similarity=0.644  Sum_probs=20.6

Q ss_pred             eEEEEccCcccccc-----------cc-CccccCCCCCCCcee
Q 028198           68 RWILKCHACYTITA-----------EI-GRIFCPKCGNGGTLR   98 (212)
Q Consensus        68 ~wvlrC~aC~k~~~-----------~~-~k~FCp~CG~~~TL~   98 (212)
                      .-.|.|.+|....-           -+ -+.|||.|+.. ||-
T Consensus         3 ~i~L~c~~c~~~nY~t~kn~~~~~~rL~lkKycp~~~kh-tlh   44 (48)
T PF00471_consen    3 KIKLVCTECGGRNYTTTKNKKNTPERLELKKYCPRCRKH-TLH   44 (48)
T ss_dssp             CEEEEEEESSSSEEEEEEETTTSSSSSEEEEEETSSSSE-EEE
T ss_pred             EEEEEEcCCCCeeEEEecCCCCCCceeeEeccCCCCCCE-ecE
Confidence            34688999975431           11 16899999997 774


No 236
>COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis]
Probab=42.11  E-value=15  Score=27.30  Aligned_cols=24  Identities=25%  Similarity=0.573  Sum_probs=16.0

Q ss_pred             EEEccCccccc---cc-cCccccCCCCC
Q 028198           70 ILKCHACYTIT---AE-IGRIFCPKCGN   93 (212)
Q Consensus        70 vlrC~aC~k~~---~~-~~k~FCp~CG~   93 (212)
                      .-+|..|+...   +. .+..-|..||.
T Consensus        19 ~VkCpdC~N~q~vFshast~V~C~~CG~   46 (67)
T COG2051          19 RVKCPDCGNEQVVFSHASTVVTCLICGT   46 (67)
T ss_pred             EEECCCCCCEEEEeccCceEEEeccccc
Confidence            45788888653   22 33677888886


No 237
>PF08646 Rep_fac-A_C:  Replication factor-A C terminal domain;  InterPro: IPR013955 Replication factor A (RP-A) binds and subsequently stabilises single-stranded DNA intermediates and thus prevents complementary DNA from reannealing. It also plays an essential role in several cellular processes in DNA metabolism including replication, recombination and repair of DNA []. Replication factor-A protein is also known as Replication protein A 70 kDa DNA-binding subunit.  This entry is found at the C terminus of Replication factor A.; PDB: 1L1O_F 3U50_C.
Probab=41.92  E-value=39  Score=26.94  Aligned_cols=44  Identities=18%  Similarity=0.450  Sum_probs=25.0

Q ss_pred             eEEEEcc--Ccccc-ccc-cCccccCCCCCC--Ccee--EEEEEe-CCCceEE
Q 028198           68 RWILKCH--ACYTI-TAE-IGRIFCPKCGNG--GTLR--KVAVTV-GENGIVL  111 (212)
Q Consensus        68 ~wvlrC~--aC~k~-~~~-~~k~FCp~CG~~--~TL~--Rvsvsv-~~~G~~~  111 (212)
                      -|=.-|+  .|.+. ... .+..+|++||..  ....  ++.+.| |..|++.
T Consensus        16 ~~Y~aC~~~~C~kKv~~~~~~~y~C~~C~~~~~~~~~ry~l~~~i~D~tg~~~   68 (146)
T PF08646_consen   16 WYYPACPNEKCNKKVTENGDGSYRCEKCNKTVENPKYRYRLSLKISDGTGSIW   68 (146)
T ss_dssp             TEEEE-TSTTTS-B-EEETTTEEEETTTTEEESS-EEEEEEEEEEEETTEEEE
T ss_pred             cEECCCCCccCCCEeecCCCcEEECCCCCCcCCCeeEEEEEEEEEEeCCCeEE
Confidence            4677899  99974 433 235699999964  1223  344444 4557653


No 238
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=41.72  E-value=16  Score=30.15  Aligned_cols=22  Identities=36%  Similarity=0.898  Sum_probs=16.4

Q ss_pred             EccCccccc--cccCccccCCCCCC
Q 028198           72 KCHACYTIT--AEIGRIFCPKCGNG   94 (212)
Q Consensus        72 rC~aC~k~~--~~~~k~FCp~CG~~   94 (212)
                      .| +|++++  .......||.||+.
T Consensus        91 ~C-~CGkl~Ci~g~~~~~CPwCg~~  114 (131)
T PF15616_consen   91 VC-GCGKLFCIDGEGEVTCPWCGNE  114 (131)
T ss_pred             Ee-cCCCEEEeCCCCCEECCCCCCe
Confidence            45 899886  33446889999986


No 239
>PRK12495 hypothetical protein; Provisional
Probab=41.55  E-value=16  Score=32.82  Aligned_cols=24  Identities=29%  Similarity=0.733  Sum_probs=17.2

Q ss_pred             EEccCccccc-cccCccccCCCCCC
Q 028198           71 LKCHACYTIT-AEIGRIFCPKCGNG   94 (212)
Q Consensus        71 lrC~aC~k~~-~~~~k~FCp~CG~~   94 (212)
                      +.|..|+.-. ......|||.|+..
T Consensus        43 ~hC~~CG~PIpa~pG~~~Cp~CQ~~   67 (226)
T PRK12495         43 AHCDECGDPIFRHDGQEFCPTCQQP   67 (226)
T ss_pred             hhcccccCcccCCCCeeECCCCCCc
Confidence            4588888543 33457899999975


No 240
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=41.37  E-value=30  Score=32.25  Aligned_cols=29  Identities=28%  Similarity=0.601  Sum_probs=20.6

Q ss_pred             EEEEccCccccccccCccccCCCCCCCcee
Q 028198           69 WILKCHACYTITAEIGRIFCPKCGNGGTLR   98 (212)
Q Consensus        69 wvlrC~aC~k~~~~~~k~FCp~CG~~~TL~   98 (212)
                      =.+.|.-|.....- .+.-||.||+...|.
T Consensus       211 RyL~CslC~teW~~-~R~~C~~Cg~~~~l~  239 (309)
T PRK03564        211 RYLHCNLCESEWHV-VRVKCSNCEQSGKLH  239 (309)
T ss_pred             eEEEcCCCCCcccc-cCccCCCCCCCCcee
Confidence            34788888876653 478899999864443


No 241
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional
Probab=41.29  E-value=14  Score=39.11  Aligned_cols=25  Identities=24%  Similarity=0.719  Sum_probs=19.8

Q ss_pred             EEEccCccccccc--cCccccCCCCCC
Q 028198           70 ILKCHACYTITAE--IGRIFCPKCGNG   94 (212)
Q Consensus        70 vlrC~aC~k~~~~--~~k~FCp~CG~~   94 (212)
                      -+||.-|++++.-  -+..-||.||.+
T Consensus       821 ~~~~~~~~~~~~~~~~~~~~~~~~~~~  847 (1006)
T PRK12775        821 QWRCDDCGKVSEGFAFPYGMCPACGGK  847 (1006)
T ss_pred             eeehhhhccccccccCCcCcCcccccc
Confidence            4899999999753  335779999986


No 242
>COG5270 PUA domain (predicted RNA-binding domain) [Translation, ribosomal structure and biogenesis]
Probab=41.29  E-value=22  Score=31.40  Aligned_cols=32  Identities=22%  Similarity=0.402  Sum_probs=23.1

Q ss_pred             eeEEEEccCccccccccCccccCCCCCCCceeEEEEE
Q 028198           67 HRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVT  103 (212)
Q Consensus        67 k~wvlrC~aC~k~~~~~~k~FCp~CG~~~TL~Rvsvs  103 (212)
                      +-|+|.|.-|.=...   -..|+.||..  ...+.+|
T Consensus        11 k~~iyWCe~cNlPl~---~~~c~~cg~~--~~~l~LT   42 (202)
T COG5270          11 KFPIYWCEKCNLPLL---GRRCSVCGSK--VEELRLT   42 (202)
T ss_pred             ccceeehhhCCCccc---cccccccCCc--ceEEEeC
Confidence            579999999985443   3579999976  4445444


No 243
>PRK05767 rpl44e 50S ribosomal protein L44e; Validated
Probab=41.17  E-value=22  Score=27.78  Aligned_cols=19  Identities=32%  Similarity=0.653  Sum_probs=16.1

Q ss_pred             ccccCCCCCCCceeEEEEEe
Q 028198           85 RIFCPKCGNGGTLRKVAVTV  104 (212)
Q Consensus        85 k~FCp~CG~~~TL~Rvsvsv  104 (212)
                      +-|||.|+.. |+.+|+-+-
T Consensus         8 ~tyCp~CkkH-t~HkV~qyK   26 (92)
T PRK05767          8 RTYCPYCKTH-TEHEVEKVK   26 (92)
T ss_pred             cccCcCCCCc-ccEEEEEEe
Confidence            5799999998 999998654


No 244
>PF01396 zf-C4_Topoisom:  Topoisomerase DNA binding C4 zinc finger;  InterPro: IPR013498 DNA topoisomerases regulate the number of topological links between two DNA strands (i.e. change the number of superhelical turns) by catalysing transient single- or double-strand breaks, crossing the strands through one another, then resealing the breaks []. These enzymes have several functions: to remove DNA supercoils during transcription and DNA replication; for strand breakage during recombination; for chromosome condensation; and to disentangle intertwined DNA during mitosis [, ]. DNA topoisomerases are divided into two classes: type I enzymes (5.99.1.2 from EC; topoisomerases I, III and V) break single-strand DNA, and type II enzymes (5.99.1.3 from EC; topoisomerases II, IV and VI) break double-strand DNA []. Type I topoisomerases are ATP-independent enzymes (except for reverse gyrase), and can be subdivided according to their structure and reaction mechanisms: type IA (bacterial and archaeal topoisomerase I, topoisomerase III and reverse gyrase) and type IB (eukaryotic topoisomerase I and topoisomerase V). These enzymes are primarily responsible for relaxing positively and/or negatively supercoiled DNA, except for reverse gyrase, which can introduce positive supercoils into DNA.  This entry represents the zinc-finger domain found in type IA topoisomerases, including bacterial and archaeal topoisomerase I and III enzymes, and in eukaryotic topoisomerase III enzymes. Escherichia coli topoisomerase I proteins contain five copies of a zinc-ribbon-like domain at their C terminus, two of which have lost their cysteine residues and are therefore probably not able to bind zinc []. This domain is still considered to be a member of the zinc-ribbon superfamily despite not being able to bind zinc. More information about this protein can be found at Protein of the Month: DNA Topoisomerase [].; GO: 0003677 DNA binding, 0003916 DNA topoisomerase activity, 0006265 DNA topological change, 0005694 chromosome
Probab=40.97  E-value=17  Score=23.63  Aligned_cols=25  Identities=32%  Similarity=0.668  Sum_probs=15.0

Q ss_pred             cccCCCCCCCceeEEEEEeCCCceEEeecC
Q 028198           86 IFCPKCGNGGTLRKVAVTVGENGIVLASRR  115 (212)
Q Consensus        86 ~FCp~CG~~~TL~Rvsvsv~~~G~~~~~~k  115 (212)
                      ..||.||+. .+.|-    ...|.++.-.+
T Consensus         2 ~~CP~Cg~~-lv~r~----~k~g~F~~Cs~   26 (39)
T PF01396_consen    2 EKCPKCGGP-LVLRR----GKKGKFLGCSN   26 (39)
T ss_pred             cCCCCCCce-eEEEE----CCCCCEEECCC
Confidence            469999976 33332    46676554444


No 245
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=40.78  E-value=21  Score=25.01  Aligned_cols=27  Identities=33%  Similarity=0.835  Sum_probs=19.0

Q ss_pred             eeEEEEccCcccccc-------ccCccccCCCCC
Q 028198           67 HRWILKCHACYTITA-------EIGRIFCPKCGN   93 (212)
Q Consensus        67 k~wvlrC~aC~k~~~-------~~~k~FCp~CG~   93 (212)
                      .++.+.|.-|+...-       +...-.||.||.
T Consensus        19 ~r~aLIC~~C~~hNGla~~~~~~~i~y~C~~Cg~   52 (54)
T PF10058_consen   19 NRYALICSKCFSHNGLAPKEEFEEIQYRCPYCGA   52 (54)
T ss_pred             CceeEECcccchhhcccccccCCceEEEcCCCCC
Confidence            478999999986431       122567999996


No 246
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=40.65  E-value=32  Score=21.74  Aligned_cols=21  Identities=19%  Similarity=0.659  Sum_probs=10.7

Q ss_pred             cCccccccccCccccCCCCCC
Q 028198           74 HACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        74 ~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      -+...+..+.+-.+|+.||..
T Consensus        21 ~~~~~~i~~vp~~~C~~CGE~   41 (46)
T TIGR03831        21 GGELIVIENVPALVCPQCGEE   41 (46)
T ss_pred             CCEEEEEeCCCccccccCCCE
Confidence            444444444444556666653


No 247
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=40.65  E-value=18  Score=29.19  Aligned_cols=19  Identities=37%  Similarity=0.903  Sum_probs=7.8

Q ss_pred             ccCccccccccCccccCCCC
Q 028198           73 CHACYTITAEIGRIFCPKCG   92 (212)
Q Consensus        73 C~aC~k~~~~~~k~FCp~CG   92 (212)
                      |+.|+.-... ++..|+.||
T Consensus         1 CPvCg~~l~v-t~l~C~~C~   19 (113)
T PF09862_consen    1 CPVCGGELVV-TRLKCPSCG   19 (113)
T ss_pred             CCCCCCceEE-EEEEcCCCC
Confidence            4444433222 234455554


No 248
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only]
Probab=40.64  E-value=16  Score=36.45  Aligned_cols=50  Identities=22%  Similarity=0.375  Sum_probs=33.0

Q ss_pred             eEecchHHHHHHHHHhCceeecCCCCcceeeeeEEEEccCccccccccCccccCCCCCC
Q 028198           36 ACITGDYAMQNVILQMGLRLLAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        36 ac~TdDfAmQNVllqmGL~~~s~~g~~I~~~k~wvlrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      |..-.||--=-=|.|.-        ..-++-+-=+.+|.-|+.+..-..+..| .||.+
T Consensus       104 a~ye~dfe~i~~leqyh--------yas~k~~va~w~c~~cg~~iean~kp~c-~cg~~  153 (593)
T COG2401         104 ATYEEDFEFIAELEQYH--------YASQKEKVALWRCEKCGTIIEANTKPEC-KCGSH  153 (593)
T ss_pred             hhHHHHHHHHHHHHHhh--------hccccceEEEEecchhchhhhhcCCccc-CCCCc
Confidence            56667776443344421        1122334556799999998877778899 99986


No 249
>PRK06386 replication factor A; Reviewed
Probab=40.60  E-value=18  Score=34.33  Aligned_cols=68  Identities=18%  Similarity=0.324  Sum_probs=38.3

Q ss_pred             cchHHHHHHHHHhC-ceeecCCCC--cceeeeeEEEEccCccccccccCccccCCCCCCC--ceeEEEEEeCC-CceEEe
Q 028198           39 TGDYAMQNVILQMG-LRLLAPGGM--QIRQLHRWILKCHACYTITAEIGRIFCPKCGNGG--TLRKVAVTVGE-NGIVLA  112 (212)
Q Consensus        39 TdDfAmQNVllqmG-L~~~s~~g~--~I~~~k~wvlrC~aC~k~~~~~~k~FCp~CG~~~--TL~Rvsvsv~~-~G~~~~  112 (212)
                      +..+.+..+.--+| +.+.   |.  .|++-..-+.||+.|.++-..   -+||.||...  -..|+-..+|+ .|.+..
T Consensus       205 ~~~~~I~di~~~~g~v~i~---G~iv~i~~gsgli~rCP~C~R~l~~---g~C~~HG~v~~~~dlr~k~vLDDGtg~~~~  278 (358)
T PRK06386        205 SRNIFIFEIKSPVGGITIM---GFIVSVGQGSRIFTKCSVCNKIIED---GVCKDHPDAPVYLDIFGYFTISDGTGFVTC  278 (358)
T ss_pred             ccccchhhhhccCCeEEEE---EEEEEEcCCcEeEecCcCCCeEccC---CcCCCCCCCCCeeEEEEEEEEECCCCeEEE
Confidence            34445555554443 3332   32  133345678999999998764   5899999541  12455444543 355543


No 250
>PRK00241 nudC NADH pyrophosphatase; Reviewed
Probab=40.18  E-value=13  Score=33.22  Aligned_cols=10  Identities=40%  Similarity=1.022  Sum_probs=9.0

Q ss_pred             ccccCCCCCC
Q 028198           85 RIFCPKCGNG   94 (212)
Q Consensus        85 k~FCp~CG~~   94 (212)
                      ..|||.||.+
T Consensus        99 ~~fC~~CG~~  108 (256)
T PRK00241         99 HRFCGYCGHP  108 (256)
T ss_pred             CccccccCCC
Confidence            5799999998


No 251
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=40.14  E-value=12  Score=29.68  Aligned_cols=9  Identities=67%  Similarity=1.534  Sum_probs=8.0

Q ss_pred             cccCCCCCC
Q 028198           86 IFCPKCGNG   94 (212)
Q Consensus        86 ~FCp~CG~~   94 (212)
                      .|||.||+-
T Consensus         3 ~FCp~Cgsl   11 (113)
T COG1594           3 RFCPKCGSL   11 (113)
T ss_pred             cccCCccCe
Confidence            699999984


No 252
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair]
Probab=40.07  E-value=32  Score=31.76  Aligned_cols=28  Identities=32%  Similarity=0.531  Sum_probs=18.1

Q ss_pred             EEccCccccccc---cCccccCCCCCCCceeE
Q 028198           71 LKCHACYTITAE---IGRIFCPKCGNGGTLRK   99 (212)
Q Consensus        71 lrC~aC~k~~~~---~~k~FCp~CG~~~TL~R   99 (212)
                      --|..|+..+..   -.+.-||+||+. ..=|
T Consensus       112 RFCg~CG~~~~~~~~g~~~~C~~cg~~-~fPR  142 (279)
T COG2816         112 RFCGRCGTKTYPREGGWARVCPKCGHE-HFPR  142 (279)
T ss_pred             cCCCCCCCcCccccCceeeeCCCCCCc-cCCC
Confidence            458888865532   236789999986 5443


No 253
>PRK07956 ligA NAD-dependent DNA ligase LigA; Validated
Probab=40.01  E-value=36  Score=34.65  Aligned_cols=47  Identities=19%  Similarity=0.329  Sum_probs=30.2

Q ss_pred             HHHHHhCcee-----ecCCCCcceeeeeEEEEccCccc-cccccCccccCCCCCC
Q 028198           46 NVILQMGLRL-----LAPGGMQIRQLHRWILKCHACYT-ITAEIGRIFCPKCGNG   94 (212)
Q Consensus        46 NVllqmGL~~-----~s~~g~~I~~~k~wvlrC~aC~k-~~~~~~k~FCp~CG~~   94 (212)
                      +-+.++||.+     +.-.|..|-++-.-+.....=.. .+..  -.+||.||++
T Consensus       361 ~~i~~~~i~iGD~V~V~raGdVIP~i~~vv~~~r~~~~~~~~~--P~~CP~Cgs~  413 (665)
T PRK07956        361 DEIERKDIRIGDTVVVRRAGDVIPEVVGVVLEKRPGDEREIVM--PTHCPVCGSE  413 (665)
T ss_pred             HHHHHcCCCCCCEEEEEECCCccceeeeeecccCCCCCccCcC--CCCCCCCCCE
Confidence            4467777776     44568999998887765443211 1222  2589999997


No 254
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=39.91  E-value=19  Score=29.29  Aligned_cols=13  Identities=54%  Similarity=1.086  Sum_probs=7.9

Q ss_pred             ccCCCCCCCceeEEE
Q 028198           87 FCPKCGNGGTLRKVA  101 (212)
Q Consensus        87 FCp~CG~~~TL~Rvs  101 (212)
                      -|+.|+..  |..|+
T Consensus        93 RC~~CN~~--L~~v~  105 (147)
T PF01927_consen   93 RCPKCNGP--LRPVS  105 (147)
T ss_pred             ccCCCCcE--eeech
Confidence            47777764  65554


No 255
>PTZ00073 60S ribosomal protein L37; Provisional
Probab=39.30  E-value=14  Score=28.82  Aligned_cols=24  Identities=21%  Similarity=0.548  Sum_probs=20.8

Q ss_pred             EEccCccccccccCccccCCCCCC
Q 028198           71 LKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        71 lrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      -.|..|++.....-+..|..||.+
T Consensus        17 tlCrRCG~~syH~qK~~CasCGyp   40 (91)
T PTZ00073         17 TLCRRCGKRSFHVQKKRCASCGYP   40 (91)
T ss_pred             chhcccCccccccccccchhcCCc
Confidence            469999988777778899999997


No 256
>KOG2324 consensus Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=39.29  E-value=84  Score=30.69  Aligned_cols=55  Identities=24%  Similarity=0.550  Sum_probs=33.8

Q ss_pred             HHHHHhCceeecC------CCCcceeee--------eEEEEccCcccccc----ccCc-cccCCCCCCCceeEEE
Q 028198           46 NVILQMGLRLLAP------GGMQIRQLH--------RWILKCHACYTITA----EIGR-IFCPKCGNGGTLRKVA  101 (212)
Q Consensus        46 NVllqmGL~~~s~------~g~~I~~~k--------~wvlrC~aC~k~~~----~~~k-~FCp~CG~~~TL~Rvs  101 (212)
                      -+.++|||.|+.+      .|--+.+-.        -.++-|..|+--..    +.++ .-||+|-.. +|+++.
T Consensus       189 ~iFkqL~~pfVkv~AdsG~iGG~vShEfhl~~~vgED~l~~C~~C~~s~n~e~~~~sk~~~Cp~C~~~-~L~~~~  262 (457)
T KOG2324|consen  189 RIFKQLGLPFVKVWADSGDIGGEVSHEFHLIHPVGEDTLMSCPSCGYSKNSEDLDLSKIASCPKCNEG-RLTKTK  262 (457)
T ss_pred             HHHHHcCCCeEEEeecccccCceeeeeEeccCccCccceeecCcCCccCchhhhcCCccccCCcccCC-Cccccc
Confidence            4568999999743      222233222        24589999963322    1222 689999985 787765


No 257
>PRK04179 rpl37e 50S ribosomal protein L37e; Reviewed
Probab=38.97  E-value=14  Score=27.08  Aligned_cols=24  Identities=21%  Similarity=0.754  Sum_probs=20.4

Q ss_pred             EEEccCccccccccCccccCCCCC
Q 028198           70 ILKCHACYTITAEIGRIFCPKCGN   93 (212)
Q Consensus        70 vlrC~aC~k~~~~~~k~FCp~CG~   93 (212)
                      --.|.-|++.....-+..|..||.
T Consensus        17 Ht~CrRCG~~syh~qK~~CasCGy   40 (62)
T PRK04179         17 HIRCRRCGRHSYNVRKKYCAACGF   40 (62)
T ss_pred             cchhcccCcccccccccchhhcCC
Confidence            357999998877777899999998


No 258
>PF01623 Carla_C4:  Carlavirus putative nucleic acid binding protein;  InterPro: IPR002568 This family of carlavirus nucleic acid binding proteins includes a motif for a potential C-4 type zinc finger this has four highly conserved cysteine residues and is a conserved feature of the carlaviruses 3' terminal ORF []. These proteins may function as viral transcriptional regulators. The carlavirus family includes Garlic latent virus and Potato virus S and Potato virus M, these viruses are positive strand, ssRNA with no DNA stage.; GO: 0003676 nucleic acid binding, 0006355 regulation of transcription, DNA-dependent
Probab=38.96  E-value=17  Score=28.45  Aligned_cols=25  Identities=32%  Similarity=0.825  Sum_probs=19.2

Q ss_pred             eEEEEccCccccccccCccccCCCCCC
Q 028198           68 RWILKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        68 ~wvlrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      +-+-|||-||++++..  .|=.+|-|+
T Consensus        51 ~sigRC~RCyRv~Ppf--~~t~rCDnk   75 (91)
T PF01623_consen   51 KSIGRCHRCYRVYPPF--YFTKRCDNK   75 (91)
T ss_pred             HHhCCCCCCeeecCCc--eeCccCCCC
Confidence            3467999999999863  455678887


No 259
>PRK05333 NAD-dependent deacetylase; Provisional
Probab=38.78  E-value=26  Score=31.44  Aligned_cols=13  Identities=15%  Similarity=0.225  Sum_probs=9.6

Q ss_pred             eEEEEccCccccc
Q 028198           68 RWILKCHACYTIT   80 (212)
Q Consensus        68 ~wvlrC~aC~k~~   80 (212)
                      ...++|..|.+.+
T Consensus       126 ~~~~~C~~C~~~~  138 (285)
T PRK05333        126 LDGVRCMGCGARH  138 (285)
T ss_pred             cCEEEECCCCCcC
Confidence            4458899999654


No 260
>TIGR03676 aRF1/eRF1 peptide chain release factor 1, archaeal and eukaryotic forms. Directs the termination of nascent peptide synthesis (translation) in response to the termination codons UAA, UAG and UGA. This model identifies both archaeal (aRF1) and eukaryotic (eRF1) of the protein. Also known as translation termination factor 1.
Probab=38.46  E-value=23  Score=33.73  Aligned_cols=27  Identities=33%  Similarity=0.632  Sum_probs=19.5

Q ss_pred             eEEEEccCccccccc-------cCccccCCCCCC
Q 028198           68 RWILKCHACYTITAE-------IGRIFCPKCGNG   94 (212)
Q Consensus        68 ~wvlrC~aC~k~~~~-------~~k~FCp~CG~~   94 (212)
                      ++.+||..|+.....       ....|||.||..
T Consensus       318 r~~~rc~~c~~~~~~~~~~~~~~~~~~~~~~~~~  351 (403)
T TIGR03676       318 RVTFKCPNCGYEEEKTVKPEEGDKSEACPKCGSE  351 (403)
T ss_pred             eEEEEcCCCCcceeeecccccccccccCcccCcc
Confidence            578999999865321       112689999986


No 261
>COG2995 PqiA Uncharacterized paraquat-inducible protein A [Function unknown]
Probab=38.06  E-value=15  Score=35.63  Aligned_cols=24  Identities=29%  Similarity=0.692  Sum_probs=19.4

Q ss_pred             EEccCccccccccCccccCCCCCC
Q 028198           71 LKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        71 lrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      --|++|..+...-.+.-||.||.+
T Consensus       221 ~~C~~C~~~~~~~~~~~CpRC~~~  244 (418)
T COG2995         221 RSCLCCHYILPHDAEPRCPRCGSK  244 (418)
T ss_pred             eecccccccCCHhhCCCCCCCCCh
Confidence            469999987765457889999997


No 262
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=37.81  E-value=23  Score=32.38  Aligned_cols=24  Identities=17%  Similarity=0.600  Sum_probs=18.7

Q ss_pred             EEEccCccccccccCccccCCCCCC
Q 028198           70 ILKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        70 vlrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      -|.|.-|.-++-+.+ ..||.||.+
T Consensus       255 GyvCs~Clsi~C~~p-~~C~~Cgt~  278 (279)
T TIGR00627       255 GFVCSVCLSVLCQYT-PICKTCKTA  278 (279)
T ss_pred             eEECCCccCCcCCCC-CCCCCCCCC
Confidence            489999998886654 489999964


No 263
>COG2995 PqiA Uncharacterized paraquat-inducible protein A [Function unknown]
Probab=37.43  E-value=19  Score=34.89  Aligned_cols=32  Identities=25%  Similarity=0.703  Sum_probs=23.0

Q ss_pred             eeEEEEccCcccccccc-----CccccCCCCCCCceeEE
Q 028198           67 HRWILKCHACYTITAEI-----GRIFCPKCGNGGTLRKV  100 (212)
Q Consensus        67 k~wvlrC~aC~k~~~~~-----~k~FCp~CG~~~TL~Rv  100 (212)
                      ..-..+|..|.-..+-+     ..-+||.||+  ||++.
T Consensus        15 ~~~~~~C~eCd~~~~~P~l~~~q~A~CPRC~~--~l~~~   51 (418)
T COG2995          15 PGHLILCPECDMLVSLPRLDSGQSAYCPRCGH--TLTRG   51 (418)
T ss_pred             ccceecCCCCCceeccccCCCCCcccCCCCCC--ccccC
Confidence            45678999999776532     2579999997  47643


No 264
>COG0384 Predicted epimerase, PhzC/PhzF homolog [General function prediction only]
Probab=37.27  E-value=31  Score=31.75  Aligned_cols=50  Identities=22%  Similarity=0.142  Sum_probs=28.5

Q ss_pred             cchHHHHHHHHHhCceeecCCCCcceeeeeEEEEccCccccccccCccccCCCCCCCcee
Q 028198           39 TGDYAMQNVILQMGLRLLAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLR   98 (212)
Q Consensus        39 TdDfAmQNVllqmGL~~~s~~g~~I~~~k~wvlrC~aC~k~~~~~~k~FCp~CG~~~TL~   98 (212)
                      =+|-.||+++.++|+.--..- .....-..|.+|=     .|+.   ..=|-||++ ||=
T Consensus        31 Lsd~~MQ~IA~e~n~SET~Fv-~~~~~~~~~rlR~-----FTP~---~Evpf~GHa-Tlg   80 (291)
T COG0384          31 LSDEQMQAIAREFNLSETAFV-LPPDDPADARLRI-----FTPT---TEVPFAGHA-TLG   80 (291)
T ss_pred             CCHHHHHHHHHHhCCceeEEE-cCCCCcCceEEEE-----eCCC---cccccCCCH-HHH
Confidence            378999999999998753211 0011112455551     1222   234559998 874


No 265
>COG1601 GCD7 Translation initiation factor 2, beta subunit (eIF-2beta)/eIF-5 N-terminal domain [Translation, ribosomal structure and biogenesis]
Probab=37.07  E-value=9.6  Score=32.07  Aligned_cols=42  Identities=26%  Similarity=0.376  Sum_probs=28.2

Q ss_pred             chHHHHHHHHHhCceee------cCCCCcceeeeeEEEEccCcccccc
Q 028198           40 GDYAMQNVILQMGLRLL------APGGMQIRQLHRWILKCHACYTITA   81 (212)
Q Consensus        40 dDfAmQNVllqmGL~~~------s~~g~~I~~~k~wvlrC~aC~k~~~   81 (212)
                      .|.-++|++....-.++      +++...++.-|.|.+.|-+|+...+
T Consensus        90 ~~~~i~~~i~~yi~~yv~C~~c~s~dt~l~~~~R~~~l~c~acGa~~p  137 (151)
T COG1601          90 SDSEIVNEIERYIAEYVKCKECGSPDTELIKEERLLFLKCEACGAIRP  137 (151)
T ss_pred             cHHHHHHHHHHHHHheeEeccCCCCchhhhhhhhhHhhHHHHhCCccc
Confidence            45567777766554443      5666667777888888888887655


No 266
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair]
Probab=36.72  E-value=16  Score=33.75  Aligned_cols=11  Identities=36%  Similarity=1.081  Sum_probs=9.5

Q ss_pred             CccccCCCCCC
Q 028198           84 GRIFCPKCGNG   94 (212)
Q Consensus        84 ~k~FCp~CG~~   94 (212)
                      +-.||+.||.+
T Consensus       110 ~~RFCg~CG~~  120 (279)
T COG2816         110 SHRFCGRCGTK  120 (279)
T ss_pred             hCcCCCCCCCc
Confidence            35799999998


No 267
>PF10609 ParA:  ParA/MinD ATPase like;  InterPro: IPR019591  This entry represents ATPases involved in plasmid partitioning []. It also contains cytosolic Fe-S cluster assembling factors, NBP35 and CFD1 which are required for biogenesis and export of both ribosomal subunits probably through assembling the ISCs in RLI1, a protein which performs rRNA processing and ribosome export [, , ].; PDB: 2PH1_A 3KB1_B.
Probab=36.61  E-value=15  Score=27.82  Aligned_cols=13  Identities=31%  Similarity=1.045  Sum_probs=6.2

Q ss_pred             ccCccccCCCCCC
Q 028198           82 EIGRIFCPKCGNG   94 (212)
Q Consensus        82 ~~~k~FCp~CG~~   94 (212)
                      .|+...||+||+.
T Consensus        62 NMs~~~Cp~Cg~~   74 (81)
T PF10609_consen   62 NMSYFVCPHCGER   74 (81)
T ss_dssp             CT-EEE-TTT--E
T ss_pred             CCCccCCCCCCCe
Confidence            4666678888864


No 268
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=36.52  E-value=30  Score=23.05  Aligned_cols=9  Identities=44%  Similarity=1.250  Sum_probs=5.9

Q ss_pred             cccCCCCCC
Q 028198           86 IFCPKCGNG   94 (212)
Q Consensus        86 ~FCp~CG~~   94 (212)
                      ..||.||.+
T Consensus        18 ~~Cp~C~~P   26 (41)
T PF06677_consen   18 EHCPDCGTP   26 (41)
T ss_pred             CccCCCCCe
Confidence            457777665


No 269
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]
Probab=36.13  E-value=27  Score=34.30  Aligned_cols=32  Identities=25%  Similarity=0.451  Sum_probs=24.5

Q ss_pred             EEEEccCccccccccCccccCCCCCCCceeEEE
Q 028198           69 WILKCHACYTITAEIGRIFCPKCGNGGTLRKVA  101 (212)
Q Consensus        69 wvlrC~aC~k~~~~~~k~FCp~CG~~~TL~Rvs  101 (212)
                      =.|.|..|+...+. +---||.||.=+||.-+.
T Consensus         6 t~f~C~~CG~~s~K-W~GkCp~Cg~Wns~vE~~   37 (456)
T COG1066           6 TAFVCQECGYVSPK-WLGKCPACGAWNTLVEEV   37 (456)
T ss_pred             cEEEcccCCCCCcc-ccccCCCCCCccceEEee
Confidence            56899999987765 456799999776775444


No 270
>PF13408 Zn_ribbon_recom:  Recombinase zinc beta ribbon domain
Probab=35.96  E-value=19  Score=23.88  Aligned_cols=14  Identities=29%  Similarity=0.897  Sum_probs=10.7

Q ss_pred             CccccCCCCCCCceeE
Q 028198           84 GRIFCPKCGNGGTLRK   99 (212)
Q Consensus        84 ~k~FCp~CG~~~TL~R   99 (212)
                      ...+|+.||.+  |..
T Consensus         4 g~l~C~~CG~~--m~~   17 (58)
T PF13408_consen    4 GLLRCGHCGSK--MTR   17 (58)
T ss_pred             CcEEcccCCcE--eEE
Confidence            35799999986  544


No 271
>PF01873 eIF-5_eIF-2B:  Domain found in IF2B/IF5;  InterPro: IPR002735 The beta subunit of archaeal and eukaryotic translation initiation factor 2 (IF2beta) and the N-terminal domain of translation initiation factor 5 (IF5) show significant sequence homology []. Archaeal IF2beta contains two independent structural domains: an N-terminal mixed alpha/beta core domain (topological similarity to the common core of ribosomal proteins L23 and L15e), and a C-terminal domain consisting of a zinc-binding C4 finger []. Archaeal IF2beta is a ribosome-dependent GTPase that stimulates the binding of initiator Met-tRNA(i)(Met) to the ribosomes, even in the absence of other factors []. The C-terminal domain of eukaryotic IF5 is involved in the formation of the multi-factor complex (MFC), an important intermediate for the 43S pre-initiation complex assembly []. IF5 interacts directly with IF1, IF2beta and IF3c, which together with IF2-bound Met-tRNA(i)(Met) form the MFC. This entry represents both the N-terminal and zinc-binding domains of IF2, as well as a domain in IF5.; GO: 0003743 translation initiation factor activity, 0006413 translational initiation; PDB: 2DCU_B 2D74_B 2E9H_A 2G2K_A 1NEE_A 3CW2_L 2QMU_C 3V11_C 2NXU_A 2QN6_C ....
Probab=35.93  E-value=14  Score=29.91  Aligned_cols=37  Identities=22%  Similarity=0.363  Sum_probs=24.2

Q ss_pred             HHHHHHHHhCceee------cCCCCcceeeeeEEEEccCcccc
Q 028198           43 AMQNVILQMGLRLL------APGGMQIRQLHRWILKCHACYTI   79 (212)
Q Consensus        43 AmQNVllqmGL~~~------s~~g~~I~~~k~wvlrC~aC~k~   79 (212)
                      .||++|...=-.+|      +++...+++-+.|.++|.||+..
T Consensus        81 ~i~~~L~~fI~~yVlC~~C~spdT~l~k~~r~~~l~C~aCGa~  123 (125)
T PF01873_consen   81 QIQDLLDKFIKEYVLCPECGSPDTELIKEGRLIFLKCKACGAS  123 (125)
T ss_dssp             HHHHHHHHHHCHHSSCTSTSSSSEEEEEETTCCEEEETTTSCE
T ss_pred             HHHHHHHHHHHHEEEcCCCCCCccEEEEcCCEEEEEecccCCc
Confidence            57777766422222      56666677778888888888753


No 272
>PTZ00409 Sir2 (Silent Information Regulator) protein; Provisional
Probab=35.92  E-value=23  Score=31.98  Aligned_cols=14  Identities=14%  Similarity=0.468  Sum_probs=9.8

Q ss_pred             eEEEEccCcccccc
Q 028198           68 RWILKCHACYTITA   81 (212)
Q Consensus        68 ~wvlrC~aC~k~~~   81 (212)
                      .+.++|..|.+.+.
T Consensus       135 l~~~~C~~C~~~~~  148 (271)
T PTZ00409        135 VFEARCCTCRKTIQ  148 (271)
T ss_pred             cCcceeCCCCCCcc
Confidence            45578888886654


No 273
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=35.66  E-value=30  Score=27.64  Aligned_cols=22  Identities=27%  Similarity=0.573  Sum_probs=15.1

Q ss_pred             ccccCCCCCCCceeEEEEEeCCCce
Q 028198           85 RIFCPKCGNGGTLRKVAVTVGENGI  109 (212)
Q Consensus        85 k~FCp~CG~~~TL~Rvsvsv~~~G~  109 (212)
                      .-.||.||+. +  -++++|+..+.
T Consensus        22 ~FtCp~Cghe-~--vs~ctvkk~~~   43 (104)
T COG4888          22 TFTCPRCGHE-K--VSSCTVKKTVN   43 (104)
T ss_pred             eEecCccCCe-e--eeEEEEEecCc
Confidence            3469999986 4  46677776544


No 274
>PF05876 Terminase_GpA:  Phage terminase large subunit (GpA);  InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry consists of several phage terminase large subunit proteins as well as related sequences from several bacterial species. The DNA packaging enzyme of bacteriophage lambda, terminase, is a heteromultimer composed of a small subunit, gpNu1, and a large subunit, gpA, products of the Nu1 and A genes, respectively. Terminase is involved in the site-specific binding and cutting of the DNA in the initial stages of packaging. It is now known that gpA is actively involved in late stages of packaging, including DNA translocation, and that this enzyme contains separate functional domains for its early and late packaging activities [].
Probab=34.96  E-value=24  Score=34.91  Aligned_cols=29  Identities=28%  Similarity=0.679  Sum_probs=22.2

Q ss_pred             eeeEEEEccCccccccc--------------cCccccCCCCCC
Q 028198           66 LHRWILKCHACYTITAE--------------IGRIFCPKCGNG   94 (212)
Q Consensus        66 ~k~wvlrC~aC~k~~~~--------------~~k~FCp~CG~~   94 (212)
                      .+.|-..|+.|+.....              ..+..||+||..
T Consensus       196 qr~~~vpCPhCg~~~~l~~~~l~w~~~~~~~~a~y~C~~Cg~~  238 (557)
T PF05876_consen  196 QRRYYVPCPHCGEEQVLEWENLKWDKGEAPETARYVCPHCGCE  238 (557)
T ss_pred             ceEEEccCCCCCCCccccccceeecCCCCccceEEECCCCcCC
Confidence            35899999999976531              246789999986


No 275
>COG1773 Rubredoxin [Energy production and conversion]
Probab=34.86  E-value=27  Score=24.93  Aligned_cols=12  Identities=17%  Similarity=0.487  Sum_probs=9.9

Q ss_pred             EEEccCcccccc
Q 028198           70 ILKCHACYTITA   81 (212)
Q Consensus        70 vlrC~aC~k~~~   81 (212)
                      .++|..|+-+|.
T Consensus         3 ~~~C~~CG~vYd   14 (55)
T COG1773           3 RWRCSVCGYVYD   14 (55)
T ss_pred             ceEecCCceEec
Confidence            478999998885


No 276
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=34.65  E-value=23  Score=23.43  Aligned_cols=9  Identities=44%  Similarity=1.431  Sum_probs=7.4

Q ss_pred             cccCCCCCC
Q 028198           86 IFCPKCGNG   94 (212)
Q Consensus        86 ~FCp~CG~~   94 (212)
                      ..||+||+.
T Consensus        19 ~~CP~Cg~~   27 (46)
T PF12760_consen   19 FVCPHCGST   27 (46)
T ss_pred             CCCCCCCCe
Confidence            469999984


No 277
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=34.54  E-value=18  Score=29.08  Aligned_cols=20  Identities=25%  Similarity=0.654  Sum_probs=12.4

Q ss_pred             cCCCCCCCceeEEEEEeCCCce
Q 028198           88 CPKCGNGGTLRKVAVTVGENGI  109 (212)
Q Consensus        88 Cp~CG~~~TL~Rvsvsv~~~G~  109 (212)
                      ||+||++-.++++.|  ..-|+
T Consensus         1 CPvCg~~l~vt~l~C--~~C~t   20 (113)
T PF09862_consen    1 CPVCGGELVVTRLKC--PSCGT   20 (113)
T ss_pred             CCCCCCceEEEEEEc--CCCCC
Confidence            999999833355554  34444


No 278
>TIGR00575 dnlj DNA ligase, NAD-dependent. The member of this family from Treponema pallidum differs in having three rather than just one copy of the BRCT (BRCA1 C Terminus) domain (pfam00533) at the C-terminus. It is included in the seed.
Probab=34.20  E-value=50  Score=33.52  Aligned_cols=48  Identities=21%  Similarity=0.430  Sum_probs=28.3

Q ss_pred             HHHHHhCcee-----ecCCCCcceeeeeEEEEccCccccccccCccccCCCCCC
Q 028198           46 NVILQMGLRL-----LAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        46 NVllqmGL~~-----~s~~g~~I~~~k~wvlrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      +-+.++||.+     +.-.|..|-++..-+..-..=......+ -..||.||++
T Consensus       349 ~~i~~~~i~iGD~V~V~raGdVIP~i~~vv~~~r~~~~~~~~~-P~~CP~C~s~  401 (652)
T TIGR00575       349 DEIEELDIRIGDTVVVRKAGDVIPKVVRVLLEKRTGSERPIRF-PTHCPSCGSP  401 (652)
T ss_pred             HHHHHcCCCCCCEEEEEecCCcCceeeeeccccCCCCCCCCCC-CCCCCCCCCE
Confidence            3467788776     4456888888877554322111111112 2589999997


No 279
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=33.98  E-value=27  Score=24.97  Aligned_cols=21  Identities=33%  Similarity=0.747  Sum_probs=15.3

Q ss_pred             EEccCccccccccCccccCCCCCC
Q 028198           71 LKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        71 lrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      +.|.+||-...-   -=||.||.+
T Consensus        28 ~I~~~~f~~~rY---ngCPfC~~~   48 (55)
T PF14447_consen   28 LICDNCFPGERY---NGCPFCGTP   48 (55)
T ss_pred             eeeccccChhhc---cCCCCCCCc
Confidence            678888865432   359999987


No 280
>COG4469 CoiA Competence protein CoiA-like family, contains a predicted nuclease    domain [General function prediction only]
Probab=33.94  E-value=20  Score=33.95  Aligned_cols=10  Identities=60%  Similarity=1.643  Sum_probs=8.7

Q ss_pred             ccccCCCCCC
Q 028198           85 RIFCPKCGNG   94 (212)
Q Consensus        85 k~FCp~CG~~   94 (212)
                      +-|||.||++
T Consensus        25 ~ffCPaC~~~   34 (342)
T COG4469          25 RFFCPACGSQ   34 (342)
T ss_pred             ccccCCCCCe
Confidence            4699999998


No 281
>KOG0402 consensus 60S ribosomal protein L37 [Translation, ribosomal structure and biogenesis]
Probab=33.51  E-value=13  Score=28.91  Aligned_cols=20  Identities=30%  Similarity=0.708  Sum_probs=15.4

Q ss_pred             CccccCCCCCCCceeEEEEEe
Q 028198           84 GRIFCPKCGNGGTLRKVAVTV  104 (212)
Q Consensus        84 ~k~FCp~CG~~~TL~Rvsvsv  104 (212)
                      .+.+|+-||.. |++|-+|-+
T Consensus        35 aky~CsfCGK~-~vKR~AvGi   54 (92)
T KOG0402|consen   35 AKYTCSFCGKK-TVKRKAVGI   54 (92)
T ss_pred             hhhhhhhcchh-hhhhhceeE
Confidence            46788888887 888887754


No 282
>KOG2768 consensus Translation initiation factor 2, beta subunit (eIF-2beta) [Translation, ribosomal structure and biogenesis]
Probab=33.06  E-value=24  Score=31.74  Aligned_cols=54  Identities=30%  Similarity=0.607  Sum_probs=34.5

Q ss_pred             chHHHHHHHHHhCceeecCCCCc------------ce-eeeeEE---EEccCcccccccc---Cc---cccCCCCCC
Q 028198           40 GDYAMQNVILQMGLRLLAPGGMQ------------IR-QLHRWI---LKCHACYTITAEI---GR---IFCPKCGNG   94 (212)
Q Consensus        40 dDfAmQNVllqmGL~~~s~~g~~------------I~-~~k~wv---lrC~aC~k~~~~~---~k---~FCp~CG~~   94 (212)
                      .|--||=.+.+||-.- |++|..            |. -+|+|+   ..|+.|.-.-...   ++   .-|..||+.
T Consensus       136 pdHv~~FLlAELgTsG-Sidg~~rLviKGrfq~kq~e~VLRrYI~eyV~C~~CkSpdt~L~kenRLfFL~C~~cgs~  211 (231)
T KOG2768|consen  136 PDHVMQFLLAELGTSG-SIDGQQRLVIKGRFQQKQFENVLRRYIKEYVTCKTCKSPDTILQKENRLFFLRCEKCGSR  211 (231)
T ss_pred             hHHHHHHHHHHhcccc-ccCCCceEEEeccccHHHHHHHHHHHHHHheEeeecCChhHHhhhhcceEEEEecCCCCe
Confidence            6777999999999764 444432            11 123444   5799998654321   22   459999985


No 283
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=32.84  E-value=31  Score=24.13  Aligned_cols=8  Identities=50%  Similarity=1.323  Sum_probs=6.8

Q ss_pred             ccCCCCCC
Q 028198           87 FCPKCGNG   94 (212)
Q Consensus        87 FCp~CG~~   94 (212)
                      .||.||..
T Consensus         2 ~CPyCge~    9 (52)
T PF14255_consen    2 QCPYCGEP    9 (52)
T ss_pred             CCCCCCCe
Confidence            59999986


No 284
>COG4640 Predicted membrane protein [Function unknown]
Probab=32.46  E-value=18  Score=35.22  Aligned_cols=23  Identities=30%  Similarity=0.660  Sum_probs=15.9

Q ss_pred             EEccCccccccccCccccCCCCCC
Q 028198           71 LKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        71 lrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      +-|+-|+.--.+- -.||+.||++
T Consensus         2 ~fC~kcG~qk~Ed-~~qC~qCG~~   24 (465)
T COG4640           2 KFCPKCGSQKAED-DVQCTQCGHK   24 (465)
T ss_pred             Ccccccccccccc-cccccccCCc
Confidence            4699999443332 2469999997


No 285
>COG4260 Membrane protease subunit, stomatin/prohibitin family [Amino acid    transport and metabolism]
Probab=32.04  E-value=20  Score=33.66  Aligned_cols=9  Identities=67%  Similarity=1.870  Sum_probs=5.8

Q ss_pred             cccCCCCCC
Q 028198           86 IFCPKCGNG   94 (212)
Q Consensus        86 ~FCp~CG~~   94 (212)
                      .|||.||.+
T Consensus       335 ~fcp~cgq~  343 (345)
T COG4260         335 KFCPECGQG  343 (345)
T ss_pred             hhChhhcCC
Confidence            577777654


No 286
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=31.59  E-value=22  Score=23.14  Aligned_cols=8  Identities=75%  Similarity=1.639  Sum_probs=7.0

Q ss_pred             ccCCCCCC
Q 028198           87 FCPKCGNG   94 (212)
Q Consensus        87 FCp~CG~~   94 (212)
                      -||+||+.
T Consensus         2 ~Cp~C~~~    9 (40)
T smart00440        2 PCPKCGNR    9 (40)
T ss_pred             cCCCCCCC
Confidence            49999987


No 287
>KOG3475 consensus 60S ribosomal protein L37 [Translation, ribosomal structure and biogenesis]
Probab=31.58  E-value=16  Score=28.48  Aligned_cols=23  Identities=26%  Similarity=0.621  Sum_probs=19.2

Q ss_pred             EccCccccccccCccccCCCCCC
Q 028198           72 KCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        72 rC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      .|..|++-....-+..|..||.+
T Consensus        18 lC~RCG~~syH~QKstC~~CGYp   40 (92)
T KOG3475|consen   18 LCRRCGRRSYHIQKSTCSSCGYP   40 (92)
T ss_pred             HHHHhCchhhhhhcccccccCCc
Confidence            48899987666668899999998


No 288
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=31.47  E-value=32  Score=22.15  Aligned_cols=13  Identities=46%  Similarity=1.229  Sum_probs=10.3

Q ss_pred             cCCCCCCCceeEEEE
Q 028198           88 CPKCGNGGTLRKVAV  102 (212)
Q Consensus        88 Cp~CG~~~TL~Rvsv  102 (212)
                      ||+|+..  |..+.+
T Consensus         2 CP~C~~~--l~~~~~   14 (41)
T PF13453_consen    2 CPRCGTE--LEPVRL   14 (41)
T ss_pred             cCCCCcc--cceEEE
Confidence            9999985  776665


No 289
>PRK14350 ligA NAD-dependent DNA ligase LigA; Provisional
Probab=31.33  E-value=47  Score=33.96  Aligned_cols=43  Identities=21%  Similarity=0.268  Sum_probs=28.1

Q ss_pred             HHHHHhCcee-----ecCCCCcceeeeeEEE--EccCccccccccCccccCCCCCC
Q 028198           46 NVILQMGLRL-----LAPGGMQIRQLHRWIL--KCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        46 NVllqmGL~~-----~s~~g~~I~~~k~wvl--rC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      +-+.++||.+     +.-.|..|-++-.-+.  |...    +..+  ..||.||++
T Consensus       358 ~~I~~~di~iGD~V~V~raGdVIP~I~~v~~~~r~~~----~~~P--~~CP~C~s~  407 (669)
T PRK14350        358 DYIDSIGLNVGDVVKISRRGDVIPAVELVIEKLSVGF----FKIP--DNCPSCKTA  407 (669)
T ss_pred             HHHHHcCCCCCCEEEEEecCCCCCceeeecccccCCC----CCCC--CCCCCCCCE
Confidence            4567788776     4456888988866444  4333    2222  479999987


No 290
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=31.32  E-value=27  Score=26.46  Aligned_cols=23  Identities=30%  Similarity=0.787  Sum_probs=14.3

Q ss_pred             EccCccccccc-cCccccCCCCCC
Q 028198           72 KCHACYTITAE-IGRIFCPKCGNG   94 (212)
Q Consensus        72 rC~aC~k~~~~-~~k~FCp~CG~~   94 (212)
                      .|+-|+.+... .....|+.||+.
T Consensus         2 fC~~Cg~~l~~~~~~~~C~~C~~~   25 (104)
T TIGR01384         2 FCPKCGSLMTPKNGVYVCPSCGYE   25 (104)
T ss_pred             CCcccCcccccCCCeEECcCCCCc
Confidence            37777766533 235678888864


No 291
>KOG4718 consensus Non-SMC (structural maintenance of chromosomes) element 1 protein (NSE1) [Chromatin structure and dynamics]
Probab=31.32  E-value=16  Score=32.85  Aligned_cols=30  Identities=27%  Similarity=0.538  Sum_probs=19.4

Q ss_pred             eeeeeEEEEccCcccccc-------ccCccccCCCCC
Q 028198           64 RQLHRWILKCHACYTITA-------EIGRIFCPKCGN   93 (212)
Q Consensus        64 ~~~k~wvlrC~aC~k~~~-------~~~k~FCp~CG~   93 (212)
                      +.+-.|..||-.|.--+.       -..+..||+||.
T Consensus       188 h~LvIqg~rCg~c~i~~h~~c~qty~q~~~~cphc~d  224 (235)
T KOG4718|consen  188 HCLVIQGIRCGSCNIQYHRGCIQTYLQRRDICPHCGD  224 (235)
T ss_pred             HHHhheeeccCcccchhhhHHHHHHhcccCcCCchhc
Confidence            455678899999932111       012678999985


No 292
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=31.12  E-value=24  Score=32.74  Aligned_cols=10  Identities=50%  Similarity=1.404  Sum_probs=8.4

Q ss_pred             ccccCCCCCC
Q 028198           85 RIFCPKCGNG   94 (212)
Q Consensus        85 k~FCp~CG~~   94 (212)
                      +.+||+||+.
T Consensus       184 ~~~CPvCGs~  193 (305)
T TIGR01562       184 RTLCPACGSP  193 (305)
T ss_pred             CCcCCCCCCh
Confidence            5689999987


No 293
>TIGR02820 formald_GSH S-(hydroxymethyl)glutathione synthase. The formation of S-(hydroxymethyl)glutathione synthase from glutathione and formaldehyde occurs naturally, but this enzyme speeds its formation in some species as part of a pathway of formaldehyde detoxification.
Probab=31.11  E-value=21  Score=30.80  Aligned_cols=12  Identities=42%  Similarity=0.838  Sum_probs=10.0

Q ss_pred             cCccccCCCCCC
Q 028198           83 IGRIFCPKCGNG   94 (212)
Q Consensus        83 ~~k~FCp~CG~~   94 (212)
                      ..+.||+.||..
T Consensus        87 ~~R~FC~~CGS~   98 (182)
T TIGR02820        87 IQRHACKGCGTH   98 (182)
T ss_pred             EEeecCCCCCCc
Confidence            347899999997


No 294
>PF14569 zf-UDP:  Zinc-binding RING-finger; PDB: 1WEO_A.
Probab=30.91  E-value=10  Score=29.00  Aligned_cols=24  Identities=29%  Similarity=0.837  Sum_probs=14.4

Q ss_pred             EEccCccccccccCccccCCCCCC
Q 028198           71 LKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        71 lrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      ..|..|+..-.....+-||.|+.+
T Consensus        37 PvCr~CyEYErkeg~q~CpqCkt~   60 (80)
T PF14569_consen   37 PVCRPCYEYERKEGNQVCPQCKTR   60 (80)
T ss_dssp             ---HHHHHHHHHTS-SB-TTT--B
T ss_pred             ccchhHHHHHhhcCcccccccCCC
Confidence            568888887777778999999976


No 295
>PRK05417 glutathione-dependent formaldehyde-activating enzyme; Provisional
Probab=30.81  E-value=20  Score=31.16  Aligned_cols=12  Identities=42%  Similarity=0.827  Sum_probs=10.0

Q ss_pred             cCccccCCCCCC
Q 028198           83 IGRIFCPKCGNG   94 (212)
Q Consensus        83 ~~k~FCp~CG~~   94 (212)
                      ..+.|||.||..
T Consensus        91 i~R~FC~~CGS~  102 (191)
T PRK05417         91 IQRHACKECGVH  102 (191)
T ss_pred             eEeeeCCCCCCc
Confidence            347899999997


No 296
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=30.55  E-value=50  Score=29.57  Aligned_cols=23  Identities=35%  Similarity=0.710  Sum_probs=8.5

Q ss_pred             ccccCCCCCCCceeEEEEEeCCC--ceE
Q 028198           85 RIFCPKCGNGGTLRKVAVTVGEN--GIV  110 (212)
Q Consensus        85 k~FCp~CG~~~TL~Rvsvsv~~~--G~~  110 (212)
                      +.+||+||+..   .+++-....  |.-
T Consensus       172 ~g~CPvCGs~P---~~s~l~~~~~~G~R  196 (290)
T PF04216_consen  172 RGYCPVCGSPP---VLSVLRGGEREGKR  196 (290)
T ss_dssp             -SS-TTT---E---EEEEEE------EE
T ss_pred             CCcCCCCCCcC---ceEEEecCCCCccE
Confidence            46899999873   344444444  753


No 297
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=30.46  E-value=25  Score=28.75  Aligned_cols=24  Identities=17%  Similarity=0.115  Sum_probs=17.1

Q ss_pred             EEccCccccccccCc--cccCCCCCC
Q 028198           71 LKCHACYTITAEIGR--IFCPKCGNG   94 (212)
Q Consensus        71 lrC~aC~k~~~~~~k--~FCp~CG~~   94 (212)
                      ..|+-|++.|.+..|  ..||.||..
T Consensus        10 ridPetg~KFYDLNrdPiVsPytG~s   35 (129)
T COG4530          10 RIDPETGKKFYDLNRDPIVSPYTGKS   35 (129)
T ss_pred             ccCccccchhhccCCCccccCccccc
Confidence            458888877766553  678888863


No 298
>PF15499 Peptidase_C98:  Ubiquitin-specific peptidase-like, SUMO isopeptidase
Probab=30.44  E-value=26  Score=32.25  Aligned_cols=83  Identities=12%  Similarity=0.271  Sum_probs=47.7

Q ss_pred             chHHHHHHHHHhCceeecCCCCcceeeeeEEEEccCccccccc---------------------cCccccCCCCCCCcee
Q 028198           40 GDYAMQNVILQMGLRLLAPGGMQIRQLHRWILKCHACYTITAE---------------------IGRIFCPKCGNGGTLR   98 (212)
Q Consensus        40 dDfAmQNVllqmGL~~~s~~g~~I~~~k~wvlrC~aC~k~~~~---------------------~~k~FCp~CG~~~TL~   98 (212)
                      .=||+..+| +|+-.+.    .......+|...|..|+..+.+                     ....-|+.|+++ .-+
T Consensus       109 PVFAlPLLL-k~d~~~E----~lF~~sf~WeFeC~~Cg~~~~~R~~K~L~TFtnv~pdwhPLnA~h~~pCn~C~~k-sQ~  182 (275)
T PF15499_consen  109 PVFALPLLL-KLDPWIE----KLFLYSFSWEFECSQCGHKYQNRCTKTLVTFTNVIPDWHPLNAVHFGPCNSCNSK-SQR  182 (275)
T ss_pred             cHHHhHHHH-hcchHHH----hHhheeeEEEEEccccCChhhhhheeeecccCCCCCCCCcccccccCCCcccCCh-HHh
Confidence            348988755 5543332    3345667999999999965532                     113459999998 444


Q ss_pred             EEEEEeCC----------CceEEeec-CCccccccceeccCC
Q 028198           99 KVAVTVGE----------NGIVLASR-RPRITLRGTKFSLPM  129 (212)
Q Consensus        99 Rvsvsv~~----------~G~~~~~~-k~~~n~RG~~ySlPk  129 (212)
                      |-.| ++.          .|--+..+ .+-++..|..|+|-.
T Consensus       183 rkMv-lekv~~vfmLHFVeGLP~ndl~~ysF~feg~~Y~Vt~  223 (275)
T PF15499_consen  183 RKMV-LEKVPPVFMLHFVEGLPHNDLQHYSFHFEGCLYQVTS  223 (275)
T ss_pred             Hhhh-hhcCchhhhhhhhccCCccCCCccceeecCeeEEEEE
Confidence            4333 222          22222222 234667777777654


No 299
>COG3058 FdhE Uncharacterized protein involved in formate dehydrogenase formation [Posttranslational modification, protein turnover, chaperones]
Probab=30.32  E-value=36  Score=31.83  Aligned_cols=11  Identities=45%  Similarity=1.247  Sum_probs=9.7

Q ss_pred             CccccCCCCCC
Q 028198           84 GRIFCPKCGNG   94 (212)
Q Consensus        84 ~k~FCp~CG~~   94 (212)
                      .+.+||.||+.
T Consensus       184 ~~~~CPvCGS~  194 (308)
T COG3058         184 SRQYCPVCGSM  194 (308)
T ss_pred             ccccCCCcCCC
Confidence            57899999997


No 300
>TIGR00375 conserved hypothetical protein TIGR00375. The member of this family from Methanococcus jannaschii, MJ0043, is considerably longer and appears to contain an intein N-terminal to the region of homology.
Probab=30.16  E-value=33  Score=32.70  Aligned_cols=50  Identities=20%  Similarity=0.336  Sum_probs=30.1

Q ss_pred             HHHHHHHhCce-eecCCCCcceeeeeEEEEccCcccccccc-Cc---cccCCCCCC
Q 028198           44 MQNVILQMGLR-LLAPGGMQIRQLHRWILKCHACYTITAEI-GR---IFCPKCGNG   94 (212)
Q Consensus        44 mQNVllqmGL~-~~s~~g~~I~~~k~wvlrC~aC~k~~~~~-~k---~FCp~CG~~   94 (212)
                      +..++..+.-. +...-|.-.+.=|-+.-.|..|+...... +.   .-|| ||.+
T Consensus       213 ~~~~l~ai~~~~i~~~~g~~P~~GKYh~~~c~~C~~~~~~~~~~~~~~~Cp-CG~~  267 (374)
T TIGR00375       213 FALALKAIDDRKIIANYGLDPLLGKYHQTACEACGEPAVSEDAETACANCP-CGGR  267 (374)
T ss_pred             HHHHHHHhhCCceEeeeeECcCCCccchhhhcccCCcCCchhhhhcCCCCC-CCCc
Confidence            56666654422 22223444555566677899998766532 12   5699 9986


No 301
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=30.07  E-value=29  Score=25.78  Aligned_cols=21  Identities=14%  Similarity=0.529  Sum_probs=13.7

Q ss_pred             cccCCCCCCCceeEEEEEeCCC
Q 028198           86 IFCPKCGNGGTLRKVAVTVGEN  107 (212)
Q Consensus        86 ~FCp~CG~~~TL~Rvsvsv~~~  107 (212)
                      ..||.||++ ...|-+-.+++.
T Consensus         2 m~CP~Cg~~-a~irtSr~~s~~   22 (72)
T PRK09678          2 FHCPLCQHA-AHARTSRYITDT   22 (72)
T ss_pred             ccCCCCCCc-cEEEEChhcChh
Confidence            479999998 455555555443


No 302
>PRK07225 DNA-directed RNA polymerase subunit B'; Validated
Probab=29.69  E-value=36  Score=34.42  Aligned_cols=32  Identities=31%  Similarity=0.669  Sum_probs=20.0

Q ss_pred             EEEccCccccccc---cCccccCCCCCCCceeEEE
Q 028198           70 ILKCHACYTITAE---IGRIFCPKCGNGGTLRKVA  101 (212)
Q Consensus        70 vlrC~aC~k~~~~---~~k~FCp~CG~~~TL~Rvs  101 (212)
                      ++.|..|+.+...   ....+|+.|++...+.+|.
T Consensus       544 ~~vC~~CG~~~~~~~~~~~~~C~~C~~~~~i~~v~  578 (605)
T PRK07225        544 IYVCAKCGMIAIYDKKRNRKYCPICGEETDIYPVE  578 (605)
T ss_pred             EEeecCcCcceehhcccCceeecccCCCCceeecc
Confidence            4669999887632   1245699998653455554


No 303
>PF01747 ATP-sulfurylase:  ATP-sulfurylase;  InterPro: IPR002650 This entry consists of sulphate adenylyltransferase or ATP-sulfurylase (2.7.7.4 from EC) some of which are part of a bifunctional polypeptide chain associated with adenosyl phosphosulphate (APS) kinase, IPR002891 from INTERPRO. Both enzymes are required for PAPS (phosphoadenosine-phosphosulphate) synthesis from inorganic sulphate []. ATP sulfurylase catalyses the synthesis of adenosine-phosphosulphate APS from ATP and inorganic sulphate [].; GO: 0004781 sulfate adenylyltransferase (ATP) activity, 0000103 sulfate assimilation; PDB: 3CR8_B 1M8P_C 1I2D_B 1JHD_A 1V47_B 1X6V_B 1XNJ_A 1XJQ_B 2QJF_A 2GKS_B ....
Probab=29.60  E-value=76  Score=27.91  Aligned_cols=51  Identities=16%  Similarity=0.313  Sum_probs=35.6

Q ss_pred             CceeeEecchHHHHHHHHH----hCceeecCCCCcceeeeeEEEEccCccccccccCccccCCCCCC
Q 028198           32 ESTVACITGDYAMQNVILQ----MGLRLLAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        32 ~~~vac~TdDfAmQNVllq----mGL~~~s~~g~~I~~~k~wvlrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      +..+..+=++|+.|.++..    +||.++.+         .+...|..|..+.+.   ..||+.-..
T Consensus       125 hAg~g~~Y~~~~a~~i~~~~~~el~I~~v~~---------~~~~Yc~~~~~~~~~---~~cp~~~~~  179 (215)
T PF01747_consen  125 HAGVGDFYDPYEAQEIFDEYAGELGIEPVPF---------PEMVYCPKCGQYVSA---KTCPHGKHH  179 (215)
T ss_dssp             TT-SCBSS-TTHHHHHHHHHHHHCTSEEEE------------EEEETTTTEEEEC---GGSSTTTGG
T ss_pred             CCCccccCCccHHHHHHHcCcccCCceEEec---------ceEEEEcCCCeEeec---cccCCCCCc
Confidence            4556678889999999877    67776655         355669999998764   579988775


No 304
>PRK07217 replication factor A; Reviewed
Probab=29.56  E-value=31  Score=32.25  Aligned_cols=44  Identities=11%  Similarity=0.223  Sum_probs=29.3

Q ss_pred             eeeeeEEEEccC--ccccccccCccccCCCCCCC--ceeEEEEEeCCC-ceE
Q 028198           64 RQLHRWILKCHA--CYTITAEIGRIFCPKCGNGG--TLRKVAVTVGEN-GIV  110 (212)
Q Consensus        64 ~~~k~wvlrC~a--C~k~~~~~~k~FCp~CG~~~--TL~Rvsvsv~~~-G~~  110 (212)
                      +.--..+.||+.  |.++-..   -.||.||...  -..|+-..+|+. |.+
T Consensus       182 ~~GsglI~rCP~~~C~Rvl~~---g~C~~HG~ve~~~DLrik~vlDDGt~~~  230 (311)
T PRK07217        182 QSGSGLIKRCPEEDCTRVLQN---GRCSEHGKVEGEFDLRIKGVLDDGEEVQ  230 (311)
T ss_pred             eCCCCCeecCCccccCccccC---CCCCCCCCcCCceeeEEEEEEECCCCeE
Confidence            344567899999  9998743   5899999531  135666666543 443


No 305
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=29.50  E-value=4.9  Score=34.21  Aligned_cols=15  Identities=40%  Similarity=0.939  Sum_probs=8.4

Q ss_pred             ccccCCCCCCCceeEE
Q 028198           85 RIFCPKCGNGGTLRKV  100 (212)
Q Consensus        85 k~FCp~CG~~~TL~Rv  100 (212)
                      ..||.+||.+ |+..+
T Consensus        28 ~~fC~kCG~~-tI~~C   42 (158)
T PF10083_consen   28 EKFCSKCGAK-TITSC   42 (158)
T ss_pred             HHHHHHhhHH-HHHHC
Confidence            4566666665 55544


No 306
>PF06044 DRP:  Dam-replacing family;  InterPro: IPR010324 Dam-replacing protein (DRP) is a restriction endonuclease that is flanked by pseudo-transposable small repeat elements. The replacement of Dam-methylase by DRP allows phase variation through slippage-like mechanisms in several pathogenic isolates of Neisseria meningitidis [].; PDB: 4ESJ_A.
Probab=29.47  E-value=26  Score=31.96  Aligned_cols=14  Identities=43%  Similarity=1.251  Sum_probs=5.8

Q ss_pred             cccCCCCCCCceeEE
Q 028198           86 IFCPKCGNGGTLRKV  100 (212)
Q Consensus        86 ~FCp~CG~~~TL~Rv  100 (212)
                      .+||.||+. -|.+.
T Consensus        32 ~yCP~Cg~~-~L~~f   45 (254)
T PF06044_consen   32 MYCPNCGSK-PLSKF   45 (254)
T ss_dssp             ---TTT--S-S-EE-
T ss_pred             CcCCCCCCh-hHhhc
Confidence            589999997 78765


No 307
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=29.36  E-value=39  Score=24.09  Aligned_cols=22  Identities=27%  Similarity=0.613  Sum_probs=13.0

Q ss_pred             ccCccccccccCccccCCCCCC
Q 028198           73 CHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        73 C~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      |+-|..-..-.....||.||-+
T Consensus         2 Cpv~~~~~~~~v~~~Cp~cGip   23 (55)
T PF13824_consen    2 CPVCKKDLPAHVNFECPDCGIP   23 (55)
T ss_pred             CCCCccccccccCCcCCCCCCc
Confidence            5555543322234579999987


No 308
>TIGR00108 eRF peptide chain release factor eRF/aRF, subunit 1. Alternative names include eRF1, SUP45, omnipotent suppressor protein 1.
Probab=28.91  E-value=44  Score=31.90  Aligned_cols=27  Identities=30%  Similarity=0.722  Sum_probs=18.5

Q ss_pred             eEEEEccCcccccc-------ccCccccCCCCCC
Q 028198           68 RWILKCHACYTITA-------EIGRIFCPKCGNG   94 (212)
Q Consensus        68 ~wvlrC~aC~k~~~-------~~~k~FCp~CG~~   94 (212)
                      ++.+||..|+.+-.       +.....||.||..
T Consensus       322 r~~~r~~~~~~~~~~~~~~~~~~~~~~c~~~~~~  355 (409)
T TIGR00108       322 RVTYKCAECGEVIEKTVRELKDKKFAICPACGQE  355 (409)
T ss_pred             eEEEEcCCCCceeecccccccccccccCcccCcc
Confidence            57899999985310       1112479999986


No 309
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=28.91  E-value=26  Score=34.13  Aligned_cols=19  Identities=37%  Similarity=0.868  Sum_probs=12.2

Q ss_pred             EEEccCccccccccCccccCCCCCC
Q 028198           70 ILKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        70 vlrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      .+.|..|+.+.      -||+|+..
T Consensus       213 ~~~C~~Cg~~~------~C~~C~~~  231 (505)
T TIGR00595       213 NLLCRSCGYIL------CCPNCDVS  231 (505)
T ss_pred             eeEhhhCcCcc------CCCCCCCc
Confidence            46888888643      36666654


No 310
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=28.62  E-value=47  Score=26.05  Aligned_cols=18  Identities=28%  Similarity=0.798  Sum_probs=10.8

Q ss_pred             ccccCCCCCCCceeEEEEEeCC
Q 028198           85 RIFCPKCGNGGTLRKVAVTVGE  106 (212)
Q Consensus        85 k~FCp~CG~~~TL~Rvsvsv~~  106 (212)
                      ...||.||+.    .|+|.++.
T Consensus        21 ~f~CP~Cge~----~v~v~~~k   38 (99)
T PRK14892         21 IFECPRCGKV----SISVKIKK   38 (99)
T ss_pred             EeECCCCCCe----EeeeecCC
Confidence            4557777753    45555555


No 311
>PF10601 zf-LITAF-like:  LITAF-like zinc ribbon domain;  InterPro: IPR006629 Members of this family display a conserved zinc ribbon structure [] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS). The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure []. 
Probab=28.55  E-value=52  Score=23.50  Aligned_cols=20  Identities=30%  Similarity=0.640  Sum_probs=14.9

Q ss_pred             cCccccCCCCCCCceeEEEEE
Q 028198           83 IGRIFCPKCGNGGTLRKVAVT  103 (212)
Q Consensus        83 ~~k~FCp~CG~~~TL~Rvsvs  103 (212)
                      +....||.||+. ...+|...
T Consensus         5 p~~~~CP~C~~~-~~T~v~~~   24 (73)
T PF10601_consen    5 PVRIYCPYCQQQ-VQTRVEYK   24 (73)
T ss_pred             ceeeECCCCCCE-EEEEEEEE
Confidence            346799999997 77777643


No 312
>PRK14873 primosome assembly protein PriA; Provisional
Probab=28.51  E-value=33  Score=34.85  Aligned_cols=11  Identities=36%  Similarity=0.501  Sum_probs=6.6

Q ss_pred             EEEEccCcccc
Q 028198           69 WILKCHACYTI   79 (212)
Q Consensus        69 wvlrC~aC~k~   79 (212)
                      -.+.|..|+.+
T Consensus       382 p~l~C~~Cg~~  392 (665)
T PRK14873        382 PSLACARCRTP  392 (665)
T ss_pred             CeeEhhhCcCe
Confidence            35666666654


No 313
>PF08273 Prim_Zn_Ribbon:  Zinc-binding domain of primase-helicase;  InterPro: IPR013237 This entry is represented by bacteriophage T7 Gp4. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry represents a zinc binding domain found in the N-terminal region of the bacteriophage T7 Gp4 and P4 alpha protein. P4 is a multifunctional protein with origin recognition, helicase and primase activities [, , ].; GO: 0003896 DNA primase activity, 0004386 helicase activity, 0008270 zinc ion binding; PDB: 1NUI_B.
Probab=28.50  E-value=23  Score=23.50  Aligned_cols=19  Identities=21%  Similarity=0.518  Sum_probs=8.5

Q ss_pred             cccCCCCCCCceeEEEEEeCCC
Q 028198           86 IFCPKCGNGGTLRKVAVTVGEN  107 (212)
Q Consensus        86 ~FCp~CG~~~TL~Rvsvsv~~~  107 (212)
                      .-||.||..   .|-.|..|.+
T Consensus         4 ~pCP~CGG~---DrFri~~d~~   22 (40)
T PF08273_consen    4 GPCPICGGK---DRFRIFDDKD   22 (40)
T ss_dssp             E--TTTT-T---TTEEEETT--
T ss_pred             CCCCCCcCc---cccccCcCcc
Confidence            359999987   3444444433


No 314
>KOG0806 consensus Carbon-nitrogen hydrolase [Amino acid transport and metabolism]
Probab=27.97  E-value=1.3e+02  Score=28.03  Aligned_cols=94  Identities=14%  Similarity=0.128  Sum_probs=59.4

Q ss_pred             hHHHHHHHHHhCceeecCCCCcceeeeeEEEEccCccccccccCccccCCCCCCCceeEEEEEeCCCceEEeecCCccc-
Q 028198           41 DYAMQNVILQMGLRLLAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENGIVLASRRPRIT-  119 (212)
Q Consensus        41 DfAmQNVllqmGL~~~s~~g~~I~~~k~wvlrC~aC~k~~~~~~k~FCp~CG~~~TL~Rvsvsv~~~G~~~~~~k~~~n-  119 (212)
                      =+.||||+.++.+.++  .|. |.+..       .|-+.+-....--||.=|-.  .-|-.+-.|.||......++... 
T Consensus        83 ~~~ls~va~~~~~~~i--~g~-i~~~~-------~~~k~yns~~~~~~~g~l~~--~yrk~hlFD~d~~~~~ry~e~~~~  150 (298)
T KOG0806|consen   83 RQGLSEVAERLSCYII--GGS-IEEEA-------LGDKLYNSCADSSCPGDGLA--KYRKNHLFDTDGPGVIRYRESHLL  150 (298)
T ss_pred             HHHhHHHHhhceEEEe--cCc-chhhc-------ccccccCcccccCCCcchhh--eeeeeEEeccCCccceeeeeeecc
Confidence            3679999999987765  333 33221       24444433334457766654  44555667888876554444333 


Q ss_pred             cccceeccCCCCCCCCCCCCCceecCCCCcc
Q 028198          120 LRGTKFSLPMPQGGRDAITKNLILREDQLPQ  150 (212)
Q Consensus       120 ~RG~~ySlPkpkgGk~~~~~~~IL~EDQ~~~  150 (212)
                      ..|..|.+|.+..||-|    .-.|=|++.+
T Consensus       151 ~~g~~f~~~~~~~gkfG----i~IC~Di~F~  177 (298)
T KOG0806|consen  151 SPGDQFTVVDTSYGKFG----IFICFDIRFY  177 (298)
T ss_pred             CCCcCCCcccCCCCceE----EEEEeccccc
Confidence            35999999999999875    5667777543


No 315
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=27.85  E-value=26  Score=32.17  Aligned_cols=25  Identities=24%  Similarity=0.764  Sum_probs=14.1

Q ss_pred             EEEccCccccccccC--------ccccCCCCCC
Q 028198           70 ILKCHACYTITAEIG--------RIFCPKCGNG   94 (212)
Q Consensus        70 vlrC~aC~k~~~~~~--------k~FCp~CG~~   94 (212)
                      +-||+.|.+-|...+        .--||.||+.
T Consensus       132 VSRCr~C~~rYDPVP~dkmwG~aef~C~~C~h~  164 (278)
T PF15135_consen  132 VSRCRKCRKRYDPVPCDKMWGIAEFHCPKCRHN  164 (278)
T ss_pred             cccccccccccCCCccccccceeeeeccccccc
Confidence            456777776664311        2347777763


No 316
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=27.85  E-value=28  Score=22.51  Aligned_cols=8  Identities=63%  Similarity=1.609  Sum_probs=4.7

Q ss_pred             ccCCCCCC
Q 028198           87 FCPKCGNG   94 (212)
Q Consensus        87 FCp~CG~~   94 (212)
                      .||.||++
T Consensus         2 ~Cp~Cg~~    9 (39)
T PF01096_consen    2 KCPKCGHN    9 (39)
T ss_dssp             --SSS-SS
T ss_pred             CCcCCCCC
Confidence            59999997


No 317
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=27.83  E-value=34  Score=33.32  Aligned_cols=33  Identities=33%  Similarity=0.642  Sum_probs=22.0

Q ss_pred             cceeeeeEEE---EccCccccccccCc--cccCCCCCC
Q 028198           62 QIRQLHRWIL---KCHACYTITAEIGR--IFCPKCGNG   94 (212)
Q Consensus        62 ~I~~~k~wvl---rC~aC~k~~~~~~k--~FCp~CG~~   94 (212)
                      +|.++-.|..   +|+-|+.......+  --||+||..
T Consensus       339 ~v~~l~~~~~~~p~Cp~Cg~~m~S~G~~g~rC~kCg~~  376 (421)
T COG1571         339 QVLKLARYERVNPVCPRCGGRMKSAGRNGFRCKKCGTR  376 (421)
T ss_pred             EEEEeeeeEEcCCCCCccCCchhhcCCCCccccccccc
Confidence            4555545654   79999987765443  459999975


No 318
>PRK14287 chaperone protein DnaJ; Provisional
Probab=27.68  E-value=1.3e+02  Score=28.15  Aligned_cols=24  Identities=25%  Similarity=0.495  Sum_probs=14.9

Q ss_pred             EEEccCccccccccCccccCCCCCC
Q 028198           70 ILKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        70 vlrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      ...|..|.-.... .+.-|+.|+..
T Consensus       181 ~~~C~~C~G~G~~-~~~~C~~C~G~  204 (371)
T PRK14287        181 RRVCHHCEGTGKI-IKQKCATCGGK  204 (371)
T ss_pred             EEeCCCCCCCCcc-ccccCCCCCCe
Confidence            3467777654433 24558888875


No 319
>cd03361 TOPRIM_TopoIA_RevGyr TopoIA_RevGyr : The topoisomerase-primase (TORPIM) domain found in members of the type IA family of DNA topoisomerases (Topo IA) similar to the ATP-dependent reverse gyrase found in archaea and thermophilic bacteria.   Type IA DNA topoisomerases remove (relax) negative supercoils in the DNA by: cleaving one strand of the DNA duplex, covalently linking to the 5' phosphoryl end of the DNA break and, allowing the other strand of the duplex to pass through the gap. Reverse gyrase is also able to insert positive supercoils in the presence of ATP and negative supercoils in the presence of AMPPNP. The TOPRIM domain has two conserved motifs, one of which centers at a conserved glutamate and the other one at two conserved aspartates (DxD).  For topoisomerases the conserved glutamate is believed to act as a general base in strand joining and, as a general acid in strand cleavage. The DXD motif may co-ordinate Mg2+, a cofactor required for full catalytic function.
Probab=27.61  E-value=46  Score=27.81  Aligned_cols=26  Identities=31%  Similarity=0.658  Sum_probs=19.5

Q ss_pred             eEEEEccCccccccccCccccCCCCCC
Q 028198           68 RWILKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        68 ~wvlrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      .+..+|.+|++.+.. ....||.||.+
T Consensus        75 ~~~~~c~pc~~lF~~-~~~~cp~c~~~  100 (170)
T cd03361          75 DSIKRCRDCGYQFTE-DSDKCPRCGSE  100 (170)
T ss_pred             eEeeccCCccccccc-ccccCCcCCCc
Confidence            345689999988853 34579999975


No 320
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=27.57  E-value=43  Score=22.82  Aligned_cols=9  Identities=44%  Similarity=1.087  Sum_probs=7.5

Q ss_pred             cccCCCCCC
Q 028198           86 IFCPKCGNG   94 (212)
Q Consensus        86 ~FCp~CG~~   94 (212)
                      .=||-||.+
T Consensus         4 kPCPFCG~~   12 (61)
T PF14354_consen    4 KPCPFCGSA   12 (61)
T ss_pred             cCCCCCCCc
Confidence            459999987


No 321
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=27.34  E-value=28  Score=21.79  Aligned_cols=21  Identities=29%  Similarity=0.814  Sum_probs=8.2

Q ss_pred             ccCccccc--cccCccccCCCCC
Q 028198           73 CHACYTIT--AEIGRIFCPKCGN   93 (212)
Q Consensus        73 C~aC~k~~--~~~~k~FCp~CG~   93 (212)
                      |.-|.-.+  .+.....||.||+
T Consensus         5 Cp~C~se~~y~D~~~~vCp~C~~   27 (30)
T PF08274_consen    5 CPLCGSEYTYEDGELLVCPECGH   27 (30)
T ss_dssp             -TTT-----EE-SSSEEETTTTE
T ss_pred             CCCCCCcceeccCCEEeCCcccc
Confidence            55555332  3334456666665


No 322
>COG2405 Predicted nucleic acid-binding protein, contains PIN domain [General function prediction only]
Probab=27.31  E-value=45  Score=28.39  Aligned_cols=30  Identities=23%  Similarity=0.337  Sum_probs=25.8

Q ss_pred             Ccee-eEecchHHHHHHHHHhCceeecCCCC
Q 028198           32 ESTV-ACITGDYAMQNVILQMGLRLLAPGGM   61 (212)
Q Consensus        32 ~~~v-ac~TdDfAmQNVllqmGL~~~s~~g~   61 (212)
                      +.++ -+++||+.=.|++..|||.+.++-|-
T Consensus        85 e~~ad~Ll~Ddr~aR~~A~~lgL~V~GtlGv  115 (157)
T COG2405          85 ELKADLLLMDDRDARNVAKSLGLKVTGTLGV  115 (157)
T ss_pred             HcCCCeeeeccHHHHHHHHHcCCeeeehhHH
Confidence            4566 78999999999999999999877654


No 323
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=27.22  E-value=22  Score=22.88  Aligned_cols=25  Identities=24%  Similarity=0.582  Sum_probs=14.4

Q ss_pred             EEEccCcccccc--ccCccccCCCCCC
Q 028198           70 ILKCHACYTITA--EIGRIFCPKCGNG   94 (212)
Q Consensus        70 vlrC~aC~k~~~--~~~k~FCp~CG~~   94 (212)
                      ..+|.-|.....  +-.+.+|-.||+.
T Consensus         8 ~~~C~~C~~~~~~~~dG~~yC~~cG~~   34 (36)
T PF11781_consen    8 NEPCPVCGSRWFYSDDGFYYCDRCGHQ   34 (36)
T ss_pred             CCcCCCCCCeEeEccCCEEEhhhCceE
Confidence            345777775432  2346677777763


No 324
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=27.16  E-value=54  Score=24.01  Aligned_cols=23  Identities=30%  Similarity=0.440  Sum_probs=16.1

Q ss_pred             cccCCCCCCCceeEEEEEeCCCceE
Q 028198           86 IFCPKCGNGGTLRKVAVTVGENGIV  110 (212)
Q Consensus        86 ~FCp~CG~~~TL~Rvsvsv~~~G~~  110 (212)
                      ..|+.||.+  |.--.+.+-.+|.+
T Consensus        79 ~~C~vC~k~--l~~~~f~~~p~~~v  101 (109)
T PF10367_consen   79 TKCSVCGKP--LGNSVFVVFPCGHV  101 (109)
T ss_pred             CCccCcCCc--CCCceEEEeCCCeE
Confidence            469999997  54455566777743


No 325
>COG5533 UBP5 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]
Probab=27.09  E-value=76  Score=30.45  Aligned_cols=60  Identities=20%  Similarity=0.401  Sum_probs=34.8

Q ss_pred             cccCCCCCCC-ceeEEEEEeCCCceEEeecCCccccccceeccCCCCCCCCCCCCCceecCC
Q 028198           86 IFCPKCGNGG-TLRKVAVTVGENGIVLASRRPRITLRGTKFSLPMPQGGRDAITKNLILRED  146 (212)
Q Consensus        86 ~FCp~CG~~~-TL~Rvsvsv~~~G~~~~~~k~~~n~RG~~ySlPkpkgGk~~~~~~~IL~ED  146 (212)
                      --||+||-+- .-+++.+++-.+--++.-.|+.+..-| +|+|-.|.|=+.-.....+..||
T Consensus       285 W~CpkC~~k~ss~K~~~I~~lP~~LII~i~RF~i~V~~-~~kiD~p~gw~~~~~~e~~v~~~  345 (415)
T COG5533         285 WRCPKCGRKESSRKRMEILVLPDVLIIHISRFHISVMG-RKKIDTPQGWKNTASVEVNVTLL  345 (415)
T ss_pred             ccCchhcccccchheEEEEecCceEEEEeeeeeEEeec-ccccCCCcchhccCCceeccccc
Confidence            3599999542 336677777776544444455544444 46777887765432233344444


No 326
>PF08996 zf-DNA_Pol:  DNA Polymerase alpha zinc finger;  InterPro: IPR015088 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The DNA Polymerase alpha zinc finger domain adopts an alpha-helix-like structure, followed by three turns, all of which involve proline. The resulting motif is a helix-turn-helix motif, in contrast to other zinc finger domains, which show anti-parallel sheet and helix conformation. Zinc binding occurs due to the presence of four cysteine residues positioned to bind the metal centre in a tetrahedral coordination geometry. The function of this domain is uncertain: it has been proposed that the zinc finger motif may be an essential part of the DNA binding domain [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0001882 nucleoside binding, 0003887 DNA-directed DNA polymerase activity, 0006260 DNA replication; PDB: 3FLO_D 1N5G_A 1K0P_A 1K18_A.
Probab=27.08  E-value=39  Score=28.62  Aligned_cols=36  Identities=19%  Similarity=0.400  Sum_probs=19.6

Q ss_pred             CCCcceeeeeEEEEccCccccccc------------cCccccCCCCCC
Q 028198           59 GGMQIRQLHRWILKCHACYTITAE------------IGRIFCPKCGNG   94 (212)
Q Consensus        59 ~g~~I~~~k~wvlrC~aC~k~~~~------------~~k~FCp~CG~~   94 (212)
                      +..+-+....+.++|+.|.+.+.-            .....||+|+..
T Consensus         7 d~erf~~c~~l~~~C~~C~~~~~f~g~~~~~~~~~~~~~~~C~~C~~~   54 (188)
T PF08996_consen    7 DEERFKDCEPLKLTCPSCGTEFEFPGVFEEDGDDVSPSGLQCPNCSTP   54 (188)
T ss_dssp             -TTTTTT---EEEE-TTT--EEEE-SSS--SSEEEETTEEEETTT--B
T ss_pred             HHHHhcCCCceEeECCCCCCCccccccccCCccccccCcCcCCCCCCc
Confidence            445677888999999999987631            224679999975


No 327
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=27.07  E-value=46  Score=31.03  Aligned_cols=12  Identities=50%  Similarity=1.112  Sum_probs=9.6

Q ss_pred             CccccCCCCCCC
Q 028198           84 GRIFCPKCGNGG   95 (212)
Q Consensus        84 ~k~FCp~CG~~~   95 (212)
                      .+.+||+||+..
T Consensus       186 ~~~~CPvCGs~P  197 (309)
T PRK03564        186 QRQFCPVCGSMP  197 (309)
T ss_pred             CCCCCCCCCCcc
Confidence            368999999873


No 328
>PF14949 ARF7EP_C:  ARF7 effector protein C-terminus
Probab=27.06  E-value=35  Score=27.11  Aligned_cols=16  Identities=44%  Similarity=1.092  Sum_probs=12.3

Q ss_pred             EEccCccccccccCccccCCCCCC
Q 028198           71 LKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        71 lrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      .-|.|||-        -||+||+.
T Consensus        68 ~~C~GC~~--------PC~~C~S~   83 (103)
T PF14949_consen   68 EDCPGCHY--------PCPKCGSR   83 (103)
T ss_pred             CCCCCccc--------cCCCCCCC
Confidence            45899983        39999985


No 329
>PF03243 MerB:  Alkylmercury lyase;  InterPro: IPR004927 Mercury is a highly toxic metal. Toxicity can result from three different mercurial forms: elemental, inorganic ion and organomercurial compounds. The ability of bacteria to detoxify mercurial compounds by reduction and volatilisation is conferred by the Mer genes, which are usually plasmid encoded (although chromosome resistance determinants have also occasionally been identified) []. Organomercurial lyase (MerB), also known as alkylmercury lyase, mediates the first of the two steps in the microbial detoxification of organomercurial salts (the other catalysed by mercuric reductase).  Organomercurial lyase catalyses the protonolysis of the C-Hg bond in a wide range of organomercurial salts (primary, secondary, tertiary, alkyl, vinyl, allyl and aryl) to Hg(II) and the respective organic compound []:  RHg(+) + H(+) = RH + Hg(2+)  Hg(II) is subsequently detoxified by mercuric reductase.  The enzyme has been purified to homogeneity in Escherichia coli and has been found to be a 22.4kDa monomer with no detectable cofactors or metal ions.; GO: 0018836 alkylmercury lyase activity, 0046413 organomercury catabolic process; PDB: 3FN8_B 3F2G_B 3F0P_A 3F2F_B 3F2H_A 3F0O_B 1S6L_A.
Probab=26.99  E-value=58  Score=25.98  Aligned_cols=37  Identities=27%  Similarity=0.442  Sum_probs=18.2

Q ss_pred             cccCCCCCCCceeEEEEEeCCCceEEeecCCccccccceeccCCCCCC
Q 028198           86 IFCPKCGNGGTLRKVAVTVGENGIVLASRRPRITLRGTKFSLPMPQGG  133 (212)
Q Consensus        86 ~FCp~CG~~~TL~Rvsvsv~~~G~~~~~~k~~~n~RG~~ySlPkpkgG  133 (212)
                      -.||.||.+     |.++|+.+|...      ++..+...|++.|..+
T Consensus        40 S~cp~tg~p-----I~l~v~~~~i~~------~~P~~~vV~~~~~~~~   76 (127)
T PF03243_consen   40 SRCPATGEP-----IRLTVDPGGITD------VEPATAVVSFVDPDAG   76 (127)
T ss_dssp             EE-TTT--E-----EEEEE-SSSEEE------EESTT-EEEE----TT
T ss_pred             EcCCCCCCe-----EEEEEeCCceee------cCCCCEEEEecCcccc
Confidence            369999987     778888877432      3445666677766555


No 330
>PRK14894 glycyl-tRNA synthetase; Provisional
Probab=26.75  E-value=40  Score=33.81  Aligned_cols=36  Identities=19%  Similarity=0.446  Sum_probs=24.4

Q ss_pred             ceeeeeEEEEccCccccccc-cCccccCCCCCCCceeE
Q 028198           63 IRQLHRWILKCHACYTITAE-IGRIFCPKCGNGGTLRK   99 (212)
Q Consensus        63 I~~~k~wvlrC~aC~k~~~~-~~k~FCp~CG~~~TL~R   99 (212)
                      +....-|+..|.-|++.+.- --...||.||+. .|..
T Consensus        81 ~~~F~DpmV~CkkCk~ryRaD~LiikCP~CGs~-dLTe  117 (539)
T PRK14894         81 EETFNDPLVDCRDCKMRWRADHIQGVCPNCGSR-DLTE  117 (539)
T ss_pred             CCCCCCceeECCCCCccccCccceeeCCCCCCc-CCCc
Confidence            44555678999999988752 113469999974 4543


No 331
>PF02639 DUF188:  Uncharacterized BCR, YaiI/YqxD family COG1671;  InterPro: IPR003791 This entry describes proteins of unknown function.
Probab=26.71  E-value=73  Score=25.86  Aligned_cols=30  Identities=27%  Similarity=0.419  Sum_probs=26.3

Q ss_pred             eeeEecchHHHHHHHHHhCceeecCCCCcc
Q 028198           34 TVACITGDYAMQNVILQMGLRLLAPGGMQI   63 (212)
Q Consensus        34 ~vac~TdDfAmQNVllqmGL~~~s~~g~~I   63 (212)
                      .=.++|.||.|-..++.-|..+++..|...
T Consensus        52 gDiVITqDigLA~~~l~Kga~vl~~rG~~y   81 (130)
T PF02639_consen   52 GDIVITQDIGLASLLLAKGAYVLNPRGKEY   81 (130)
T ss_pred             CCEEEECCHHHHHHHHHCCCEEECCCCCCC
Confidence            346899999999999999999999998743


No 332
>smart00714 LITAF Possible membrane-associated motif in LPS-induced tumor necrosis factor alpha factor (LITAF), also known as PIG7, and other animal proteins.
Probab=26.48  E-value=62  Score=22.75  Aligned_cols=18  Identities=33%  Similarity=0.968  Sum_probs=14.3

Q ss_pred             ccccCCCCCCCceeEEEEE
Q 028198           85 RIFCPKCGNGGTLRKVAVT  103 (212)
Q Consensus        85 k~FCp~CG~~~TL~Rvsvs  103 (212)
                      ..+||.|++. ..++|...
T Consensus         3 ~i~Cp~C~~~-~~T~v~~~   20 (67)
T smart00714        3 QLFCPRCQNN-VTTRVETE   20 (67)
T ss_pred             ceECCCCCCE-EEEEEEEE
Confidence            4689999997 77777754


No 333
>TIGR02159 PA_CoA_Oxy4 phenylacetate-CoA oxygenase, PaaJ subunit. Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA.
Probab=26.39  E-value=31  Score=28.54  Aligned_cols=11  Identities=45%  Similarity=1.343  Sum_probs=9.0

Q ss_pred             cccCCCCCCCc
Q 028198           86 IFCPKCGNGGT   96 (212)
Q Consensus        86 ~FCp~CG~~~T   96 (212)
                      .-||.||+..|
T Consensus       106 ~~cp~c~s~~t  116 (146)
T TIGR02159       106 VQCPRCGSADT  116 (146)
T ss_pred             CcCCCCCCCCc
Confidence            68999999744


No 334
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=26.28  E-value=42  Score=25.16  Aligned_cols=22  Identities=32%  Similarity=0.745  Sum_probs=10.3

Q ss_pred             ccccCCCCCCCceeEEEEEeCCC-ce
Q 028198           85 RIFCPKCGNGGTLRKVAVTVGEN-GI  109 (212)
Q Consensus        85 k~FCp~CG~~~TL~Rvsvsv~~~-G~  109 (212)
                      .--||.||+.   .-|.|.++.. |.
T Consensus        22 ~F~CPfC~~~---~sV~v~idkk~~~   44 (81)
T PF05129_consen   22 VFDCPFCNHE---KSVSVKIDKKEGI   44 (81)
T ss_dssp             ----TTT--S---S-EEEEEETTTTE
T ss_pred             eEcCCcCCCC---CeEEEEEEccCCE
Confidence            3459999976   2477777754 44


No 335
>smart00532 LIGANc Ligase N family.
Probab=25.92  E-value=81  Score=30.61  Aligned_cols=46  Identities=17%  Similarity=0.307  Sum_probs=27.7

Q ss_pred             HHHHHhCcee-----ecCCCCcceeeeeEEEEccCccc--cccccCccccCCCCCC
Q 028198           46 NVILQMGLRL-----LAPGGMQIRQLHRWILKCHACYT--ITAEIGRIFCPKCGNG   94 (212)
Q Consensus        46 NVllqmGL~~-----~s~~g~~I~~~k~wvlrC~aC~k--~~~~~~k~FCp~CG~~   94 (212)
                      +-+.++||.+     +.-.|..|-++-.-+. ......  .+. + -.+||.||++
T Consensus       356 ~~i~~~~i~iGd~V~V~raGdVIP~I~~vv~-~~r~~~~~~~~-~-P~~CP~C~s~  408 (441)
T smart00532      356 DEIEEKDIRIGDTVVVRKAGDVIPKVVGVVK-EKRPGDEREIE-M-PTHCPSCGSE  408 (441)
T ss_pred             HHHHHcCCCCCCEEEEEECCCcCcceeeccc-ccCCCCCccCc-C-CCCCCCCCCE
Confidence            4467788876     4456888888766443 111111  111 1 2689999997


No 336
>PRK14301 chaperone protein DnaJ; Provisional
Probab=25.72  E-value=2.6e+02  Score=26.18  Aligned_cols=9  Identities=44%  Similarity=1.018  Sum_probs=5.2

Q ss_pred             cccCCCCCC
Q 028198           86 IFCPKCGNG   94 (212)
Q Consensus        86 ~FCp~CG~~   94 (212)
                      ..|+.|.+.
T Consensus       198 ~~C~~C~G~  206 (373)
T PRK14301        198 HPCPKCKGS  206 (373)
T ss_pred             CCCCCCCCC
Confidence            346666654


No 337
>KOG3022 consensus Predicted ATPase, nucleotide-binding [Cell cycle control, cell division, chromosome partitioning]
Probab=25.57  E-value=71  Score=29.87  Aligned_cols=46  Identities=24%  Similarity=0.527  Sum_probs=28.5

Q ss_pred             eeeEecc--hHHHHHHHHHhCceeecCCCCcceeeeeEEEEccCccccccccCccccCCCCCC
Q 028198           34 TVACITG--DYAMQNVILQMGLRLLAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        34 ~vac~Td--DfAmQNVllqmGL~~~s~~g~~I~~~k~wvlrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      .++++||  ++|+|-|.+.+++=-  =.+  |           .+..+-.+|..-.||+||+.
T Consensus       184 gAviVTTPQ~vAl~Dv~K~i~fc~--K~~--I-----------~ilGvVENMs~f~Cp~C~~~  231 (300)
T KOG3022|consen  184 GAVIVTTPQEVALQDVRKEIDFCR--KAG--I-----------PILGVVENMSGFVCPKCGHS  231 (300)
T ss_pred             ceEEEeCchhhhhHHHHhhhhhhh--hcC--C-----------ceEEEEeccccccCCCCCCc
Confidence            3567776  789999888765210  000  0           11223456778889999997


No 338
>PRK00566 DNA-directed RNA polymerase subunit beta'; Provisional
Probab=25.42  E-value=33  Score=37.27  Aligned_cols=29  Identities=31%  Similarity=0.527  Sum_probs=17.7

Q ss_pred             EEccCccccccccC-ccccCCCCCCCceeEE
Q 028198           71 LKCHACYTITAEIG-RIFCPKCGNGGTLRKV  100 (212)
Q Consensus        71 lrC~aC~k~~~~~~-k~FCp~CG~~~TL~Rv  100 (212)
                      +.| +|+|...... -.+|+.||-.-|..+|
T Consensus        58 ~eC-~Cgkyk~~~~~~~~C~~cgve~~~~~v   87 (1156)
T PRK00566         58 YEC-LCGKYKRVRYKGIICERCGVEVTRSKV   87 (1156)
T ss_pred             cEE-eCccccccCcCCcCCCCCCceeeechh
Confidence            467 7887443211 3799999987333333


No 339
>PRK14283 chaperone protein DnaJ; Provisional
Probab=25.23  E-value=2.7e+02  Score=26.07  Aligned_cols=27  Identities=19%  Similarity=0.373  Sum_probs=16.8

Q ss_pred             EEEEccCccccccccCccccCCCCCCCc
Q 028198           69 WILKCHACYTITAEIGRIFCPKCGNGGT   96 (212)
Q Consensus        69 wvlrC~aC~k~~~~~~k~FCp~CG~~~T   96 (212)
                      ....|..|.-.... .+..|..|.+.++
T Consensus       188 ~~~~C~~C~G~G~~-~~~~C~~C~G~g~  214 (378)
T PRK14283        188 NVTTCPDCQGEGKI-VEKPCSNCHGKGV  214 (378)
T ss_pred             EEEECCCCCcccee-cCCCCCCCCCcee
Confidence            34577777654433 2456999988633


No 340
>PF00628 PHD:  PHD-finger;  InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the PHD (homeodomain) zinc finger domain [,], which is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in chromatin-mediated transcriptional regulation. The PHD finger motif is reminiscent of, but distinct from the C3HC4 type RING finger. The function of this domain is not yet known but in analogy with the LIM domain it could be involved in protein-protein interaction and be important for the assembly or activity of multicomponent complexes involved in transcriptional activation or repression. Alternatively, the interactions could be intra-molecular and be important in maintaining the structural integrity of the protein. In similarity to the RING finger and the LIM domain, the PHD finger is thought to bind two zinc ions. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005515 protein binding; PDB: 3ZVY_A 2LGG_A 3SOW_A 3SOU_B 3ASL_A 3ASK_A 3ZVZ_B 3T6R_A 2LGK_A 3SOX_B ....
Probab=25.12  E-value=56  Score=21.21  Aligned_cols=22  Identities=23%  Similarity=0.530  Sum_probs=14.5

Q ss_pred             EccCccccccccCccccCCCCC
Q 028198           72 KCHACYTITAEIGRIFCPKCGN   93 (212)
Q Consensus        72 rC~aC~k~~~~~~k~FCp~CG~   93 (212)
                      +|.-|++...+....+|..|+.
T Consensus         1 ~C~vC~~~~~~~~~i~C~~C~~   22 (51)
T PF00628_consen    1 YCPVCGQSDDDGDMIQCDSCNR   22 (51)
T ss_dssp             EBTTTTSSCTTSSEEEBSTTSC
T ss_pred             eCcCCCCcCCCCCeEEcCCCCh
Confidence            4777777554445677877775


No 341
>COG1040 ComFC Predicted amidophosphoribosyltransferases [General function prediction only]
Probab=24.74  E-value=18  Score=31.61  Aligned_cols=27  Identities=33%  Similarity=0.659  Sum_probs=20.7

Q ss_pred             EEccCccccccccCccccCCCCCCCceeEE
Q 028198           71 LKCHACYTITAEIGRIFCPKCGNGGTLRKV  100 (212)
Q Consensus        71 lrC~aC~k~~~~~~k~FCp~CG~~~TL~Rv  100 (212)
                      ..|.+|++-...... +|+.||.+  |...
T Consensus        25 ~~C~~C~~~~~~~~~-~C~~C~~~--l~~~   51 (225)
T COG1040          25 GLCSGCQADLPLIGN-LCPLCGLP--LSSH   51 (225)
T ss_pred             CcChhhhhchhHHHh-hhHhhhCh--hccc
Confidence            579999987765433 89999997  5544


No 342
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=24.67  E-value=39  Score=23.48  Aligned_cols=22  Identities=27%  Similarity=0.667  Sum_probs=7.1

Q ss_pred             EccCccccccccC-ccccCCCCC
Q 028198           72 KCHACYTITAEIG-RIFCPKCGN   93 (212)
Q Consensus        72 rC~aC~k~~~~~~-k~FCp~CG~   93 (212)
                      .|..|.+.+.-.. +..|..||.
T Consensus        11 ~C~~C~~~F~~~~rrhhCr~CG~   33 (69)
T PF01363_consen   11 NCMICGKKFSLFRRRHHCRNCGR   33 (69)
T ss_dssp             B-TTT--B-BSSS-EEE-TTT--
T ss_pred             cCcCcCCcCCCceeeEccCCCCC
Confidence            4555655554322 455555554


No 343
>PRK14296 chaperone protein DnaJ; Provisional
Probab=24.60  E-value=1.9e+02  Score=27.17  Aligned_cols=9  Identities=22%  Similarity=0.567  Sum_probs=5.8

Q ss_pred             cccCCCCCC
Q 028198           86 IFCPKCGNG   94 (212)
Q Consensus        86 ~FCp~CG~~   94 (212)
                      ..|+.|.+.
T Consensus       207 ~~C~~C~G~  215 (372)
T PRK14296        207 NKCKNCKGK  215 (372)
T ss_pred             ccccCCCCc
Confidence            447777765


No 344
>PF12674 Zn_ribbon_2:  Putative zinc ribbon domain
Probab=24.48  E-value=31  Score=25.95  Aligned_cols=23  Identities=30%  Similarity=0.554  Sum_probs=14.8

Q ss_pred             cccCCCCCCCceeEEE-EEeCCCceE
Q 028198           86 IFCPKCGNGGTLRKVA-VTVGENGIV  110 (212)
Q Consensus        86 ~FCp~CG~~~TL~Rvs-vsv~~~G~~  110 (212)
                      +||-+||-+  |..-. ...++||..
T Consensus         1 k~CQSCGMP--l~~~~~~Gte~dGs~   24 (81)
T PF12674_consen    1 KFCQSCGMP--LSKDEDFGTEADGSK   24 (81)
T ss_pred             CcCCcCcCc--cCCccccccccCCCC
Confidence            489999998  65444 334455643


No 345
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]
Probab=24.40  E-value=23  Score=33.99  Aligned_cols=36  Identities=25%  Similarity=0.582  Sum_probs=25.6

Q ss_pred             CCcceeeeeEEEEccCccccccccCccccCCCCCCCcee
Q 028198           60 GMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLR   98 (212)
Q Consensus        60 g~~I~~~k~wvlrC~aC~k~~~~~~k~FCp~CG~~~TL~   98 (212)
                      |.+|++  +-.|||+-|+...... .--||.|-.=.|++
T Consensus       346 ge~l~~--~~~YRC~~CGF~a~~l-~W~CPsC~~W~Tik  381 (389)
T COG2956         346 GEQLRR--KPRYRCQNCGFTAHTL-YWHCPSCRAWETIK  381 (389)
T ss_pred             HHHHhh--cCCceecccCCcceee-eeeCCCcccccccC
Confidence            455555  7889999999665443 35699998765654


No 346
>PHA02325 hypothetical protein
Probab=24.34  E-value=35  Score=25.42  Aligned_cols=11  Identities=45%  Similarity=1.147  Sum_probs=8.7

Q ss_pred             CccccCCCCCC
Q 028198           84 GRIFCPKCGNG   94 (212)
Q Consensus        84 ~k~FCp~CG~~   94 (212)
                      ....||+||..
T Consensus         2 ~~k~CPkC~A~   12 (72)
T PHA02325          2 DTKICPKCGAR   12 (72)
T ss_pred             CccccCccCCE
Confidence            45689999975


No 347
>COG3880 Modulator of heat shock repressor CtsR, McsA [Signal transduction    mechanisms]
Probab=24.22  E-value=17  Score=31.45  Aligned_cols=50  Identities=24%  Similarity=0.417  Sum_probs=29.5

Q ss_pred             hHHHHHHHHHhCceeecC-CCCcceeeeeEEEEccCccccccc---cCccccCCCCC
Q 028198           41 DYAMQNVILQMGLRLLAP-GGMQIRQLHRWILKCHACYTITAE---IGRIFCPKCGN   93 (212)
Q Consensus        41 DfAmQNVllqmGL~~~s~-~g~~I~~~k~wvlrC~aC~k~~~~---~~k~FCp~CG~   93 (212)
                      =|+|+|||..+ |..+.. .+...... . .++|+-|+.+|.+   ..+.=|..|=.
T Consensus        47 ~fs~~~~ls~~-l~~~~t~~~~~~~~~-e-~l~C~~C~~Tfk~f~~~g~fGCaeCY~  100 (176)
T COG3880          47 VFSIHNVLSGE-LDNLKTKWQIEQEDE-E-LLGCHNCGMTFKEFIQSGLFGCAECYK  100 (176)
T ss_pred             chhHHHHHHHH-HhccccccchhhhHH-H-HhcCccccccHHHHHHhcccchHHHHH
Confidence            48999998765 333322 12111221 2 7899999988875   22333888864


No 348
>TIGR03670 rpoB_arch DNA-directed RNA polymerase subunit B. This model represents the archaeal version of DNA-directed RNA polymerase subunit B (rpoB) and is observed in all archaeal genomes.
Probab=24.21  E-value=54  Score=33.09  Aligned_cols=31  Identities=35%  Similarity=0.867  Sum_probs=18.7

Q ss_pred             EEEccCccccccc---cCccccCCCCCCCceeEE
Q 028198           70 ILKCHACYTITAE---IGRIFCPKCGNGGTLRKV  100 (212)
Q Consensus        70 vlrC~aC~k~~~~---~~k~FCp~CG~~~TL~Rv  100 (212)
                      ++.|..|+.+...   ....+|..|++.+.+.+|
T Consensus       538 ~~vC~~CG~~~~~~~~~~~~~C~~c~~~~~i~~v  571 (599)
T TIGR03670       538 VYVCENCGHIAWEDKRKGTAYCPVCGETGDISPV  571 (599)
T ss_pred             EEeecccCceeehhcccCceeccccCCCCceeee
Confidence            3568888877532   124568888875334444


No 349
>PRK14285 chaperone protein DnaJ; Provisional
Probab=23.97  E-value=3.2e+02  Score=25.49  Aligned_cols=9  Identities=22%  Similarity=0.523  Sum_probs=5.1

Q ss_pred             cccCCCCCC
Q 028198           86 IFCPKCGNG   94 (212)
Q Consensus        86 ~FCp~CG~~   94 (212)
                      ..|+.|.+.
T Consensus       200 ~~C~~C~G~  208 (365)
T PRK14285        200 NPCKSCKGK  208 (365)
T ss_pred             CCCCCCCCC
Confidence            346666655


No 350
>COG0143 MetG Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=23.92  E-value=48  Score=33.22  Aligned_cols=30  Identities=30%  Similarity=0.442  Sum_probs=23.5

Q ss_pred             ceeeeeEEEEccCccccccccC-ccccCCCC
Q 028198           63 IRQLHRWILKCHACYTITAEIG-RIFCPKCG   92 (212)
Q Consensus        63 I~~~k~wvlrC~aC~k~~~~~~-k~FCp~CG   92 (212)
                      |..-..=.+.|..|.+..++.. ...||.||
T Consensus       119 I~~~~~~~~Yc~~~e~fl~dr~v~g~cp~cg  149 (558)
T COG0143         119 IYLREYEGLYCVSCERFLPDRYVEGTCPKCG  149 (558)
T ss_pred             EeccceeeeEcccccccccchheeccCCCcC
Confidence            5444455689999999988755 78899999


No 351
>PF04032 Rpr2:  RNAse P Rpr2/Rpp21/SNM1 subunit domain;  InterPro: IPR007175 This family contains a ribonuclease P subunit of human and yeast. Other members of the family include the probable archaeal homologues. This subunit possibly binds the precursor tRNA [].; PDB: 2K3R_A 2KI7_B 2ZAE_B 1X0T_A.
Probab=23.78  E-value=40  Score=24.23  Aligned_cols=13  Identities=54%  Similarity=1.032  Sum_probs=6.9

Q ss_pred             ccCccccCCCCCC
Q 028198           82 EIGRIFCPKCGNG   94 (212)
Q Consensus        82 ~~~k~FCp~CG~~   94 (212)
                      +..+.||..||..
T Consensus        43 ~~kr~~Ck~C~~~   55 (85)
T PF04032_consen   43 EIKRTICKKCGSL   55 (85)
T ss_dssp             TCCCTB-TTT--B
T ss_pred             HHhcccccCCCCE
Confidence            3456799999974


No 352
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=23.68  E-value=30  Score=23.46  Aligned_cols=8  Identities=50%  Similarity=1.373  Sum_probs=4.3

Q ss_pred             ccCCCCCC
Q 028198           87 FCPKCGNG   94 (212)
Q Consensus        87 FCp~CG~~   94 (212)
                      -||.||.+
T Consensus        22 ~CPlC~r~   29 (54)
T PF04423_consen   22 CCPLCGRP   29 (54)
T ss_dssp             E-TTT--E
T ss_pred             cCCCCCCC
Confidence            79999986


No 353
>PRK14284 chaperone protein DnaJ; Provisional
Probab=23.66  E-value=2.7e+02  Score=26.21  Aligned_cols=11  Identities=27%  Similarity=0.323  Sum_probs=5.3

Q ss_pred             CceecCCCCcc
Q 028198          140 NLILREDQLPQ  150 (212)
Q Consensus       140 ~~IL~EDQ~~~  150 (212)
                      ++|+.=.+.++
T Consensus       260 DL~v~i~v~~h  270 (391)
T PRK14284        260 DLYVFIDVEPH  270 (391)
T ss_pred             CEEEEEEEecC
Confidence            55554444443


No 354
>COG5319 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.52  E-value=37  Score=28.38  Aligned_cols=32  Identities=31%  Similarity=0.693  Sum_probs=19.6

Q ss_pred             eeEEEEccCccccc------------cccCccccCCCCCCCceeE
Q 028198           67 HRWILKCHACYTIT------------AEIGRIFCPKCGNGGTLRK   99 (212)
Q Consensus        67 k~wvlrC~aC~k~~------------~~~~k~FCp~CG~~~TL~R   99 (212)
                      +.|-|+|---.++.            ..+....||.||+. ++.|
T Consensus         2 i~y~L~Cd~~HeFEGWF~ssaDfd~Q~~rgLv~CPvCgs~-~VsK   45 (142)
T COG5319           2 IRYALRCDKGHEFEGWFGSSADFDRQRERGLVTCPVCGST-EVSK   45 (142)
T ss_pred             ceeeeeccCCCcccccccCchhHHHHHHcCceeCCCCCcH-HHHH
Confidence            45677775443321            12456789999996 5543


No 355
>PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional
Probab=23.43  E-value=1.4e+02  Score=22.58  Aligned_cols=35  Identities=23%  Similarity=0.494  Sum_probs=23.6

Q ss_pred             eeEEEEEeCCCceEEeecCCccccccceeccCCCCCCC
Q 028198           97 LRKVAVTVGENGIVLASRRPRITLRGTKFSLPMPQGGR  134 (212)
Q Consensus        97 L~Rvsvsv~~~G~~~~~~k~~~n~RG~~ySlPkpkgGk  134 (212)
                      +..|++-+..+|.+++.+|+.-..-+..|++|   ||+
T Consensus         4 ~~~~~~ii~~~~~vLL~~R~~~~~~~g~w~~P---gG~   38 (135)
T PRK10546          4 IDVVAAIIERDGKILLAQRPAHSDQAGLWEFA---GGK   38 (135)
T ss_pred             EEEEEEEEecCCEEEEEEccCCCCCCCcEECC---ccc
Confidence            55666667778888777665333456788888   554


No 356
>PF03854 zf-P11:  P-11 zinc finger;  InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The RING-finger is a specialised type of Zn-finger of 40 to 60 residues that binds two atoms of zinc, and is probably involved in mediating protein-protein interactions [, , ]. There are two different variants, the C3HC4-type and a C3H2C3-type, which is clearly related despite the different cysteine/histidine pattern. The latter type is sometimes referred to as 'RING-H2 finger'. The RING domain is a protein interaction domain which has been implicated in a range of diverse biological processes. Several 3D-structures for RING-fingers are known [, ]. The 3D structure of the zinc ligation system is unique to the RING domain and is referred to as the 'cross-brace' motif. The spacing of the cysteines in such a domain is:  C-x(2)-C-x(9 to 39)-C-x(1 to 3)-H-x(2 to 3)-C-x(2)-C-x(4 to 48)-C-x(2)-C  Metal ligand pairs one and three co-ordinate to bind one zinc ion, whilst pairs two and four bind the second. This entry represents RING finger protein Z, a small polypeptide found in some negative-strand RNA viruses including Lassa fever virus, which plays a crucial role in virion assembly and budding. RING finger Z has been shown to interact with several host proteins, including promyelocytic leukemia protein and the eukaryotic translation initiation factor 4E [, ]. It is sufficient in the absence of any other viral proteins to release virus-like particles from the infected cell []. This protein is also responsible for arenavirus superinfection exclusion; expression of this protein in a host cell strongly and specifically inhibits areanavirus transcription and replication []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003723 RNA binding, 0008270 zinc ion binding; PDB: 2KO5_A.
Probab=23.31  E-value=19  Score=25.24  Aligned_cols=23  Identities=30%  Similarity=0.683  Sum_probs=15.2

Q ss_pred             EEccCccccccccCccccCCCCCC
Q 028198           71 LKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        71 lrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      |-|..|-.+--.. -++||.||.+
T Consensus        22 YLCl~CLt~ml~~-s~~C~iC~~~   44 (50)
T PF03854_consen   22 YLCLNCLTLMLSR-SDRCPICGKP   44 (50)
T ss_dssp             EEEHHHHHHT-SS-SSEETTTTEE
T ss_pred             hHHHHHHHHHhcc-ccCCCcccCc
Confidence            5667776554332 4799999986


No 357
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=23.18  E-value=72  Score=20.83  Aligned_cols=20  Identities=35%  Similarity=0.589  Sum_probs=8.6

Q ss_pred             cccCCCCCCCceeEEEEEeCCCceE
Q 028198           86 IFCPKCGNGGTLRKVAVTVGENGIV  110 (212)
Q Consensus        86 ~FCp~CG~~~TL~Rvsvsv~~~G~~  110 (212)
                      ..|.+|||-     |.|..+..|.+
T Consensus         7 YkC~~CGni-----Vev~~~g~g~l   26 (36)
T PF06397_consen    7 YKCEHCGNI-----VEVVHDGGGPL   26 (36)
T ss_dssp             EE-TTT--E-----EEEEE--SS-E
T ss_pred             EEccCCCCE-----EEEEECCCCCE
Confidence            458899984     55555555544


No 358
>CHL00018 rpoC1 RNA polymerase beta' subunit
Probab=23.16  E-value=30  Score=35.53  Aligned_cols=32  Identities=28%  Similarity=0.456  Sum_probs=17.8

Q ss_pred             eeeEEEEccCccccccc----cCccccCCCCCCCceeEE
Q 028198           66 LHRWILKCHACYTITAE----IGRIFCPKCGNGGTLRKV  100 (212)
Q Consensus        66 ~k~wvlrC~aC~k~~~~----~~k~FCp~CG~~~TL~Rv  100 (212)
                      ++.|  .| +|++.-..    ....||+.||-.=|..||
T Consensus        64 ~k~~--~C-~CGkyk~~~~~~~~~~~C~~CgVE~t~s~v   99 (663)
T CHL00018         64 IKSG--IC-ACGNYRVIGDEKEDPKFCEQCGVEFTDSRV   99 (663)
T ss_pred             CcCC--EE-eCCCccccCccccCCCccCCcCCEechhhh
Confidence            3444  45 66653321    124699999976344443


No 359
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=23.12  E-value=77  Score=28.06  Aligned_cols=12  Identities=25%  Similarity=0.241  Sum_probs=8.0

Q ss_pred             eeEEEEEeCCCc
Q 028198           97 LRKVAVTVGENG  108 (212)
Q Consensus        97 L~Rvsvsv~~~G  108 (212)
                      +.+|.|.|+..+
T Consensus        49 ~~~v~viVS~~~   60 (201)
T COG1326          49 PVRVRVIVSRHE   60 (201)
T ss_pred             cceEEEEEecCC
Confidence            466777777665


No 360
>PRK14293 chaperone protein DnaJ; Provisional
Probab=22.99  E-value=2.8e+02  Score=25.91  Aligned_cols=26  Identities=23%  Similarity=0.529  Sum_probs=16.9

Q ss_pred             EEEccCccccccccCccccCCCCCCCc
Q 028198           70 ILKCHACYTITAEIGRIFCPKCGNGGT   96 (212)
Q Consensus        70 vlrC~aC~k~~~~~~k~FCp~CG~~~T   96 (212)
                      ...|..|.=.... .+..|+.|.+.++
T Consensus       186 ~~~C~~C~G~G~~-~~~~C~~C~G~g~  211 (374)
T PRK14293        186 VSECPTCNGTGQV-IEDPCDACGGQGV  211 (374)
T ss_pred             EeeCCCCCcceeE-eccCCCCCCCCcc
Confidence            4678888654443 2456999988633


No 361
>COG4311 SoxD Sarcosine oxidase delta subunit [Amino acid transport and metabolism]
Probab=22.81  E-value=38  Score=26.76  Aligned_cols=11  Identities=45%  Similarity=0.866  Sum_probs=9.0

Q ss_pred             CccccCCCCCC
Q 028198           84 GRIFCPKCGNG   94 (212)
Q Consensus        84 ~k~FCp~CG~~   94 (212)
                      ...+||.||-+
T Consensus         2 lLI~CP~Cg~R   12 (97)
T COG4311           2 LLIPCPYCGER   12 (97)
T ss_pred             ceecCCCCCCC
Confidence            35789999986


No 362
>PRK10445 endonuclease VIII; Provisional
Probab=22.27  E-value=56  Score=29.15  Aligned_cols=16  Identities=25%  Similarity=0.636  Sum_probs=12.5

Q ss_pred             ccccCCCCCCCceeEEEE
Q 028198           85 RIFCPKCGNGGTLRKVAV  102 (212)
Q Consensus        85 k~FCp~CG~~~TL~Rvsv  102 (212)
                      ..-||.||.+  |.++.+
T Consensus       235 g~~Cp~Cg~~--I~~~~~  250 (263)
T PRK10445        235 GEACERCGGI--IEKTTL  250 (263)
T ss_pred             CCCCCCCCCE--eEEEEE
Confidence            4679999985  887775


No 363
>PF02132 RecR:  RecR protein;  InterPro: IPR023628 The bacterial protein RecR seems to play a role in a recombinational process of DNA repair []. It may act with RecF and RecO.  RecR's structure consists of a N-terminal helix-hairpin-helix (HhH) motif, followed by a Cys4 zinc-finger motif, a Toprim domain and a Walker B motif []. This entry represents the C4-type zinc finger.; PDB: 1VDD_D 2V1C_B.
Probab=22.25  E-value=7.2  Score=25.49  Aligned_cols=29  Identities=21%  Similarity=0.486  Sum_probs=16.6

Q ss_pred             ceeeeeEEEEccCccccccccCccccCCCCCC
Q 028198           63 IRQLHRWILKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        63 I~~~k~wvlrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      |..++.-+..|.-|+.++..   ..|+.|-++
T Consensus        10 l~~~~~~i~~C~~C~nlse~---~~C~IC~d~   38 (41)
T PF02132_consen   10 LKEAKENIKFCSICGNLSEE---DPCEICSDP   38 (41)
T ss_dssp             HHHHHHH-EE-SSS--EESS---SS-HHHH-T
T ss_pred             HHHHHHcCCccCCCCCcCCC---CcCcCCCCC
Confidence            44556667889999988875   579998764


No 364
>PRK14810 formamidopyrimidine-DNA glycosylase; Provisional
Probab=22.24  E-value=57  Score=29.23  Aligned_cols=16  Identities=31%  Similarity=0.603  Sum_probs=12.2

Q ss_pred             ccccCCCCCCCceeEEEE
Q 028198           85 RIFCPKCGNGGTLRKVAV  102 (212)
Q Consensus        85 k~FCp~CG~~~TL~Rvsv  102 (212)
                      ..-||.||.+  |.++.+
T Consensus       244 g~pCprCG~~--I~~~~~  259 (272)
T PRK14810        244 GEPCLNCKTP--IRRVVV  259 (272)
T ss_pred             CCcCCCCCCe--eEEEEE
Confidence            3579999975  877764


No 365
>PF03367 zf-ZPR1:  ZPR1 zinc-finger domain;  InterPro: IPR004457 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZPR1-type zinc finger domains. An orthologous protein found once in each of the completed archaeal genomes corresponds to a zinc finger-containing domain repeated as the N-terminal and C-terminal halves of the mouse protein ZPR1. ZPR1 is an experimentally proven zinc-binding protein that binds the tyrosine kinase domain of the epidermal growth factor receptor (EGFR); binding is inhibited by EGF stimulation and tyrosine phosphorylation, and activation by EGF is followed by some redistribution of ZPR1 to the nucleus. By analogy, other proteins with the ZPR1 zinc finger domain may be regulatory proteins that sense protein phosphorylation state and/or participate in signal transduction (see also IPR004470 from INTERPRO). Deficiencies in ZPR1 may contribute to neurodegenerative disorders. ZPR1 appears to be down-regulated in patients with spinal muscular atrophy (SMA), a disease characterised by degeneration of the alpha-motor neurons in the spinal cord that can arise from mutations affecting the expression of Survival Motor Neurons (SMN) []. ZPR1 interacts with complexes formed by SMN [], and may act as a modifier that effects the severity of SMA. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2QKD_A.
Probab=22.06  E-value=76  Score=26.58  Aligned_cols=13  Identities=31%  Similarity=1.140  Sum_probs=8.5

Q ss_pred             ccCCCCCCCceeEE
Q 028198           87 FCPKCGNGGTLRKV  100 (212)
Q Consensus        87 FCp~CG~~~TL~Rv  100 (212)
                      -||.||.+ ...|+
T Consensus         3 ~Cp~C~~~-~~~~~   15 (161)
T PF03367_consen    3 LCPNCGEN-GTTRI   15 (161)
T ss_dssp             E-TTTSSC-CEEEE
T ss_pred             cCCCCCCC-cEEEE
Confidence            59999988 45555


No 366
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=22.06  E-value=67  Score=24.44  Aligned_cols=10  Identities=60%  Similarity=1.481  Sum_probs=7.6

Q ss_pred             cCCCCCCCcee
Q 028198           88 CPKCGNGGTLR   98 (212)
Q Consensus        88 Cp~CG~~~TL~   98 (212)
                      ||.||.. ++.
T Consensus         1 C~~C~~~-~~~   10 (127)
T TIGR03830         1 CPICGSG-ELV   10 (127)
T ss_pred             CCCCCCc-cce
Confidence            9999975 453


No 367
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family. Restriction alleviation proteins provide a countermeasure to host cell restriction enzyme defense against foreign DNA such as phage or plasmids. This family consists of homologs to the phage antirestriction protein Lar, and most members belong to phage genomes or prophage regions of bacterial genomes.
Probab=22.00  E-value=42  Score=22.80  Aligned_cols=8  Identities=50%  Similarity=1.290  Sum_probs=7.1

Q ss_pred             ccCCCCCC
Q 028198           87 FCPKCGNG   94 (212)
Q Consensus        87 FCp~CG~~   94 (212)
                      -||.||..
T Consensus         3 PCPfCGg~   10 (53)
T TIGR03655         3 PCPFCGGA   10 (53)
T ss_pred             CCCCCCCc
Confidence            59999997


No 368
>PRK02625 rpoC1 DNA-directed RNA polymerase subunit gamma; Provisional
Probab=22.00  E-value=46  Score=33.98  Aligned_cols=26  Identities=27%  Similarity=0.687  Sum_probs=14.9

Q ss_pred             eeeEEEEccCccccccc-cCccccCCCCCC
Q 028198           66 LHRWILKCHACYTITAE-IGRIFCPKCGNG   94 (212)
Q Consensus        66 ~k~wvlrC~aC~k~~~~-~~k~FCp~CG~~   94 (212)
                      ++.|.  | +|+|.-.. ....||+.||-.
T Consensus        66 ~k~~e--C-~CGkyk~~~~~~~~C~~CgvE   92 (627)
T PRK02625         66 SKDWE--C-HCGKYKRVRHRGIVCERCGVE   92 (627)
T ss_pred             ccCcE--E-eCCCccccCcCCcCCCCCCcE
Confidence            34444  5 56653321 124799999965


No 369
>PRK14351 ligA NAD-dependent DNA ligase LigA; Provisional
Probab=21.78  E-value=1.1e+02  Score=31.45  Aligned_cols=44  Identities=20%  Similarity=0.311  Sum_probs=27.2

Q ss_pred             HHHHhCcee-----ecCCCCcceeeeeEEEEccCccccccccCccccCCCCCC
Q 028198           47 VILQMGLRL-----LAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        47 VllqmGL~~-----~s~~g~~I~~~k~wvlrC~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      -+.++||.+     +.-.|..|-++-.-+.+ ..... +. ++ ..||.||++
T Consensus       384 ~i~~~di~iGD~V~V~raGdVIPkI~~vv~~-~~~~~-~~-~P-~~CP~C~~~  432 (689)
T PRK14351        384 EIEELGVNVGDRVRVKRAGDVIPYVEEVVEK-DSEGT-FE-FP-DTCPVCDSA  432 (689)
T ss_pred             HHHHcCCCCCCEEEEEecCCccceeeeeecc-cCCCC-Cc-CC-CCCCCCCCE
Confidence            456777765     45568889888775542 22222 11 22 489999997


No 370
>TIGR02387 rpoC1_cyan DNA-directed RNA polymerase, gamma subunit. The RNA polymerase gamma subunit, encoded by the rpoC1 gene, is found in cyanobacteria and corresponds to the N-terminal region the beta' subunit, encoded by rpoC, in other bacteria. The equivalent subunit in plastids and chloroplasts is designated beta', while the product of the rpoC2 gene is designated beta''.
Probab=21.61  E-value=35  Score=34.76  Aligned_cols=32  Identities=28%  Similarity=0.583  Sum_probs=17.4

Q ss_pred             eeeEEEEccCccccccc-cCccccCCCCCCCceeEE
Q 028198           66 LHRWILKCHACYTITAE-IGRIFCPKCGNGGTLRKV  100 (212)
Q Consensus        66 ~k~wvlrC~aC~k~~~~-~~k~FCp~CG~~~TL~Rv  100 (212)
                      ++.|.  | +|+|.-.. ....||+.||-.-|..||
T Consensus        59 ~k~~e--C-~CGkyk~~~~~~~~C~~CgvE~t~s~v   91 (619)
T TIGR02387        59 SKDWE--C-HCGKYKRVRHRGIVCERCGVEVTESRV   91 (619)
T ss_pred             CcCcE--E-eCCCccccCcCCcCCCCCCCEEchhhh
Confidence            34554  4 56653321 124799999976333333


No 371
>TIGR00201 comF comF family protein. This protein is found in species that do (Bacillus subtilis, Haemophilus influenzae) or do not (E. coli, Borrelia burgdorferi) have described systems for natural transformation with exogenous DNA. It is involved in competence for transformation in Bacillus subtilis.
Probab=21.57  E-value=46  Score=27.76  Aligned_cols=21  Identities=24%  Similarity=0.713  Sum_probs=15.5

Q ss_pred             ccCccccccccCccccCCCCCC
Q 028198           73 CHACYTITAEIGRIFCPKCGNG   94 (212)
Q Consensus        73 C~aC~k~~~~~~k~FCp~CG~~   94 (212)
                      |..|++..... ..+|+.|+..
T Consensus         1 C~~C~~~~~~~-~~~C~~C~~~   21 (190)
T TIGR00201         1 CSLCGRPYQSV-HALCRQCGSW   21 (190)
T ss_pred             CCccccccccc-cCCchhhCCc
Confidence            88999864332 3689999875


No 372
>COG2824 PhnA Uncharacterized Zn-ribbon-containing protein involved in phosphonate metabolism [Inorganic ion transport and metabolism]
Probab=21.52  E-value=53  Score=26.58  Aligned_cols=26  Identities=23%  Similarity=0.723  Sum_probs=18.2

Q ss_pred             EEEEccCcccc--ccccCccccCCCCCC
Q 028198           69 WILKCHACYTI--TAEIGRIFCPKCGNG   94 (212)
Q Consensus        69 wvlrC~aC~k~--~~~~~k~FCp~CG~~   94 (212)
                      |.--|+-|...  |.+.....||.|+++
T Consensus         2 ~lp~cp~c~sEytYed~~~~~cpec~~e   29 (112)
T COG2824           2 SLPPCPKCNSEYTYEDGGQLICPECAHE   29 (112)
T ss_pred             CCCCCCccCCceEEecCceEeCchhccc
Confidence            44568888644  345556789999987


No 373
>TIGR01079 rplX_bact ribosomal protein L24, bacterial/organelle. This model recognizes bacterial and organellar forms of ribosomal protein L24. It excludes eukaryotic and archaeal forms, designated L26 in eukaryotes.
Probab=21.22  E-value=84  Score=24.65  Aligned_cols=23  Identities=35%  Similarity=0.624  Sum_probs=19.2

Q ss_pred             ccccCCCCCCCceeEEEEEeCCCceE
Q 028198           85 RIFCPKCGNGGTLRKVAVTVGENGIV  110 (212)
Q Consensus        85 k~FCp~CG~~~TL~Rvsvsv~~~G~~  110 (212)
                      ..+||.|+.+ |  ||..-+++||+-
T Consensus        71 ~lv~p~~~k~-~--rv~~~~~~~g~k   93 (104)
T TIGR01079        71 MLFDPKTGKA-T--RVGIRFEEDGKK   93 (104)
T ss_pred             EEEcCcCCCC-e--EEEEEEccCCcE
Confidence            5799999987 4  899988888864


No 374
>PF09567 RE_MamI:  MamI restriction endonuclease;  InterPro: IPR019067 There are four classes of restriction endonucleases: types I, II,III and IV. All types of enzymes recognise specific short DNA sequences and carry out the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. They differ in their recognition sequence, subunit composition, cleavage position, and cofactor requirements [, ], as summarised below:   Type I enzymes (3.1.21.3 from EC) cleave at sites remote from recognition site; require both ATP and S-adenosyl-L-methionine to function; multifunctional protein with both restriction and methylase (2.1.1.72 from EC) activities. Type II enzymes (3.1.21.4 from EC) cleave within or at short specific distances from recognition site; most require magnesium; single function (restriction) enzymes independent of methylase. Type III enzymes (3.1.21.5 from EC) cleave at sites a short distance from recognition site; require ATP (but doesn't hydrolyse it); S-adenosyl-L-methionine stimulates reaction but is not required; exists as part of a complex with a modification methylase methylase (2.1.1.72 from EC). Type IV enzymes target methylated DNA.   Type II restriction endonucleases (3.1.21.4 from EC) are components of prokaryotic DNA restriction-modification mechanisms that protect the organism against invading foreign DNA. These site-specific deoxyribonucleases catalyse the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. Of the 3000 restriction endonucleases that have been characterised, most are homodimeric or tetrameric enzymes that cleave target DNA at sequence-specific sites close to the recognition site. For homodimeric enzymes, the recognition site is usually a palindromic sequence 4-8 bp in length. Most enzymes require magnesium ions as a cofactor for catalysis. Although they can vary in their mode of recognition, many restriction endonucleases share a similar structural core comprising four beta-strands and one alpha-helix, as well as a similar mechanism of cleavage, suggesting a common ancestral origin []. However, there is still considerable diversity amongst restriction endonucleases [, ]. The target site recognition process triggers large conformational changes of the enzyme and the target DNA, leading to the activation of the catalytic centres. Like other DNA binding proteins, restriction enzymes are capable of non-specific DNA binding as well, which is the prerequisite for efficient target site location by facilitated diffusion. Non-specific binding usually does not involve interactions with the bases but only with the DNA backbone [].   This entry includes the MamI restriction endonuclease which recognises and cleaves GATNN^NNATC. ; GO: 0003677 DNA binding, 0009036 Type II site-specific deoxyribonuclease activity, 0009307 DNA restriction-modification system
Probab=21.18  E-value=43  Score=31.06  Aligned_cols=28  Identities=25%  Similarity=0.720  Sum_probs=20.3

Q ss_pred             EEccCccccccccCccccCCCCCCCceeEE
Q 028198           71 LKCHACYTITAEIGRIFCPKCGNGGTLRKV  100 (212)
Q Consensus        71 lrC~aC~k~~~~~~k~FCp~CG~~~TL~Rv  100 (212)
                      -.|--|+...... ...||.||+. .+.|.
T Consensus        83 ~~C~~CGa~V~~~-e~~Cp~C~St-nI~r~  110 (314)
T PF09567_consen   83 GKCNNCGANVSRL-EESCPNCGST-NIKRK  110 (314)
T ss_pred             hhhccccceeeeh-hhcCCCCCcc-ccccc
Confidence            4688898766543 4689999996 66654


No 375
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=21.07  E-value=80  Score=22.21  Aligned_cols=27  Identities=22%  Similarity=0.539  Sum_probs=17.0

Q ss_pred             EEccCccccccc-----cCccccCCCCCCCceeE
Q 028198           71 LKCHACYTITAE-----IGRIFCPKCGNGGTLRK   99 (212)
Q Consensus        71 lrC~aC~k~~~~-----~~k~FCp~CG~~~TL~R   99 (212)
                      ..|+-|+....-     -...-||.||..  |.=
T Consensus         3 ~~CP~CG~~iev~~~~~GeiV~Cp~CGae--leV   34 (54)
T TIGR01206         3 FECPDCGAEIELENPELGELVICDECGAE--LEV   34 (54)
T ss_pred             cCCCCCCCEEecCCCccCCEEeCCCCCCE--EEE
Confidence            368888865431     125679999974  553


No 376
>PRK13764 ATPase; Provisional
Probab=21.04  E-value=79  Score=32.00  Aligned_cols=29  Identities=17%  Similarity=0.158  Sum_probs=26.1

Q ss_pred             CceeeEecchHHHHHHHHHhCceeecCCC
Q 028198           32 ESTVACITGDYAMQNVILQMGLRLLAPGG   60 (212)
Q Consensus        32 ~~~vac~TdDfAmQNVllqmGL~~~s~~g   60 (212)
                      +..+.++|.|+.+..+|..+||.++.+..
T Consensus       101 ~~~~~lvT~D~~l~~~A~~~GI~V~~l~~  129 (602)
T PRK13764        101 ELGATLVTSDRVQAEVARAKGIDVIYLKP  129 (602)
T ss_pred             HcCCEEEeCCHHHHHHHHHcCCEEEEeCC
Confidence            56899999999999999999999987654


No 377
>PF12387 Peptidase_C74:  Pestivirus NS2 peptidase;  InterPro: IPR022120  The pestivirus NS2 peptidase is responsible for single cleavage between NS2 and NS3 of the Bovine viral diarrhea virus 1 polyprotein, a cleavage that is correlated with cytopathogenicity []. The peptidase is activated by its interaction with 'J-domain protein interacting with viral protein' - Jiv. ; GO: 0003968 RNA-directed RNA polymerase activity, 0004197 cysteine-type endopeptidase activity, 0004252 serine-type endopeptidase activity, 0016817 hydrolase activity, acting on acid anhydrides, 0017111 nucleoside-triphosphatase activity, 0070008 serine-type exopeptidase activity
Probab=21.04  E-value=43  Score=29.37  Aligned_cols=45  Identities=27%  Similarity=0.540  Sum_probs=25.7

Q ss_pred             HHHHHHHHHhCceeecCCCCcceeeeeEEEEccCccccccccCccccCCCCCCCc
Q 028198           42 YAMQNVILQMGLRLLAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGT   96 (212)
Q Consensus        42 fAmQNVllqmGL~~~s~~g~~I~~~k~wvlrC~aC~k~~~~~~k~FCp~CG~~~T   96 (212)
                      |+|+-|+.-+-..-++-.        +.-..|+-|-.--  -....||+||..++
T Consensus       142 yGmpKi~~iika~tLsk~--------~hcilCtvCe~r~--w~g~~CPKCGr~G~  186 (200)
T PF12387_consen  142 YGMPKIITIIKAATLSKS--------KHCILCTVCEGRE--WKGGNCPKCGRHGK  186 (200)
T ss_pred             cCcchhhhhhhHHhccCC--------CceEEEeeeecCc--cCCCCCCcccCCCC
Confidence            666666655443333222        3446788886432  23467999997643


No 378
>PRK14278 chaperone protein DnaJ; Provisional
Probab=21.00  E-value=3.4e+02  Score=25.48  Aligned_cols=26  Identities=23%  Similarity=0.528  Sum_probs=14.4

Q ss_pred             EEEccCccccccccCccccCCCCCCCc
Q 028198           70 ILKCHACYTITAEIGRIFCPKCGNGGT   96 (212)
Q Consensus        70 vlrC~aC~k~~~~~~k~FCp~CG~~~T   96 (212)
                      ...|..|.=.-... +.-|+.|...++
T Consensus       182 ~~~C~~C~G~G~~~-~~~C~~C~G~g~  207 (378)
T PRK14278        182 SRPCPTCRGVGEVI-PDPCHECAGDGR  207 (378)
T ss_pred             EEECCCCCccceee-CCCCCCCCCcee
Confidence            34676665433222 345888887633


No 379
>TIGR03847 conserved hypothetical protein. The conserved hypothetical protein described here occurs as part of the trio of uncharacterized proteins common in the Actinobacteria.
Probab=20.99  E-value=55  Score=28.45  Aligned_cols=18  Identities=39%  Similarity=0.946  Sum_probs=13.9

Q ss_pred             CccccCCCCCCCceeEEEEEeCCCceE
Q 028198           84 GRIFCPKCGNGGTLRKVAVTVGENGIV  110 (212)
Q Consensus        84 ~k~FCp~CG~~~TL~Rvsvsv~~~G~~  110 (212)
                      .+..||-||.+         +|.+|-+
T Consensus       155 GRP~CPlCg~P---------ldP~GH~  172 (177)
T TIGR03847       155 GRPPCPLCGRP---------IDPDGHI  172 (177)
T ss_pred             CCCCCCCCCCC---------CCCCCcc
Confidence            47789999998         5777754


No 380
>PRK14281 chaperone protein DnaJ; Provisional
Probab=20.79  E-value=3e+02  Score=25.99  Aligned_cols=27  Identities=26%  Similarity=0.518  Sum_probs=16.9

Q ss_pred             EEEccCccccccccCccccCCCCCCCce
Q 028198           70 ILKCHACYTITAEIGRIFCPKCGNGGTL   97 (212)
Q Consensus        70 vlrC~aC~k~~~~~~k~FCp~CG~~~TL   97 (212)
                      ...|..|.=.-... +.-|+.|.+.+++
T Consensus       205 ~~~C~~C~G~G~~~-~~~C~~C~G~g~v  231 (397)
T PRK14281        205 ITACPTCGGEGRVV-KDRCPACYGEGIK  231 (397)
T ss_pred             EEecCCCcceeeee-CCCCCCCCCCccE
Confidence            44677776544332 4569999887444


No 381
>COG1885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=20.71  E-value=82  Score=25.52  Aligned_cols=18  Identities=39%  Similarity=0.916  Sum_probs=12.0

Q ss_pred             cCccccCCCCCCCceeEEEE
Q 028198           83 IGRIFCPKCGNGGTLRKVAV  102 (212)
Q Consensus        83 ~~k~FCp~CG~~~TL~Rvsv  102 (212)
                      +...-||+||.+  +.-+-+
T Consensus        47 ~G~t~CP~Cg~~--~e~~fv   64 (115)
T COG1885          47 VGSTSCPKCGEP--FESAFV   64 (115)
T ss_pred             cccccCCCCCCc--cceeEE
Confidence            344579999997  554443


No 382
>COG3809 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=20.68  E-value=42  Score=25.95  Aligned_cols=10  Identities=30%  Similarity=0.943  Sum_probs=6.5

Q ss_pred             ccccCCCCCC
Q 028198           85 RIFCPKCGNG   94 (212)
Q Consensus        85 k~FCp~CG~~   94 (212)
                      .+.||.|+.-
T Consensus        21 iD~CPrCrGV   30 (88)
T COG3809          21 IDYCPRCRGV   30 (88)
T ss_pred             eeeCCccccE
Confidence            4567777763


No 383
>PLN02915 cellulose synthase A [UDP-forming], catalytic subunit
Probab=20.64  E-value=43  Score=36.13  Aligned_cols=26  Identities=27%  Similarity=0.866  Sum_probs=20.2

Q ss_pred             EccCccccccccCccccCCCCCCCceeE
Q 028198           72 KCHACYTITAEIGRIFCPKCGNGGTLRK   99 (212)
Q Consensus        72 rC~aC~k~~~~~~k~FCp~CG~~~TL~R   99 (212)
                      .|..|+........+-||.|+.+  -+|
T Consensus        44 vCr~cyeye~~~g~~~cp~c~t~--y~~   69 (1044)
T PLN02915         44 VCKPCYEYERSEGNQCCPQCNTR--YKR   69 (1044)
T ss_pred             cccchhhhhhhcCCccCCccCCc--hhh
Confidence            57888877666678899999986  554


No 384
>PF06839 zf-GRF:  GRF zinc finger;  InterPro: IPR010666 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This presumed zinc-binding domain is found in a variety of DNA-binding proteins. It seems likely that this domain is involved in nucleic acid binding. It is named GRF after three conserved residues in the centre of the alignment of the domain. This zinc finger may be related to IPR000380 from INTERPRO. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding
Probab=20.61  E-value=73  Score=20.90  Aligned_cols=14  Identities=36%  Similarity=1.009  Sum_probs=10.8

Q ss_pred             ccCCCCCCCceeEEEE
Q 028198           87 FCPKCGNGGTLRKVAV  102 (212)
Q Consensus        87 FCp~CG~~~TL~Rvsv  102 (212)
                      .|+ ||.+ .+.+++.
T Consensus         2 ~C~-Cg~~-~~~~~s~   15 (45)
T PF06839_consen    2 KCP-CGEP-AVRRTSK   15 (45)
T ss_pred             CCC-CCCE-eEEEEEe
Confidence            599 9987 6777775


No 385
>COG0333 RpmF Ribosomal protein L32 [Translation, ribosomal structure and biogenesis]
Probab=20.28  E-value=61  Score=23.21  Aligned_cols=19  Identities=32%  Similarity=0.723  Sum_probs=8.0

Q ss_pred             EccCccccccccCccccCCCC
Q 028198           72 KCHACYTITAEIGRIFCPKCG   92 (212)
Q Consensus        72 rC~aC~k~~~~~~k~FCp~CG   92 (212)
                      .|..|++..-  .-..|+.||
T Consensus        29 ~c~~cG~~~l--~Hrvc~~cg   47 (57)
T COG0333          29 VCPNCGEYKL--PHRVCLKCG   47 (57)
T ss_pred             eccCCCCccc--CceEcCCCC
Confidence            4445554322  123455555


No 386
>PLN02189 cellulose synthase
Probab=20.24  E-value=40  Score=36.28  Aligned_cols=28  Identities=25%  Similarity=0.772  Sum_probs=20.4

Q ss_pred             EccCccccccccCccccCCCCCCCceeEEE
Q 028198           72 KCHACYTITAEIGRIFCPKCGNGGTLRKVA  101 (212)
Q Consensus        72 rC~aC~k~~~~~~k~FCp~CG~~~TL~Rvs  101 (212)
                      .|..|+........+-||.|+.+  -+|+-
T Consensus        63 vCr~Cyeyer~eg~q~CpqCkt~--Y~r~k   90 (1040)
T PLN02189         63 VCRPCYEYERREGTQNCPQCKTR--YKRLK   90 (1040)
T ss_pred             cccchhhhhhhcCCccCcccCCc--hhhcc
Confidence            56777876666667899999975  55443


No 387
>PRK13795 hypothetical protein; Provisional
Probab=20.23  E-value=87  Score=31.55  Aligned_cols=38  Identities=26%  Similarity=0.342  Sum_probs=25.8

Q ss_pred             eeeEEEEccCccccccccCccccCCCCCCCceeEEEEEeCCCceE
Q 028198           66 LHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENGIV  110 (212)
Q Consensus        66 ~k~wvlrC~aC~k~~~~~~k~FCp~CG~~~TL~Rvsvsv~~~G~~  110 (212)
                      -+.|++.|..|.--.-   ..-|..||+. | .+|.+  ..-|-+
T Consensus         8 ~~~~~~wc~~cn~p~~---~~~c~~c~~~-~-~~~~~--t~p~d~   45 (636)
T PRK13795          8 GKDHIYWCEKCNVPLL---GKKCGICGKE-G-FKVRL--TPPGDV   45 (636)
T ss_pred             cceeEEEcccCCCeec---cccccccCCC-c-eEeec--CCCCCC
Confidence            3579999999984322   2359999998 6 56665  444443


No 388
>KOG1522 consensus RNA polymerase II, subunit POLR2C/RPB3 [Transcription]
Probab=20.13  E-value=75  Score=29.31  Aligned_cols=20  Identities=10%  Similarity=0.169  Sum_probs=12.1

Q ss_pred             CceeeEecchHHHHHHHHHh
Q 028198           32 ESTVACITGDYAMQNVILQM   51 (212)
Q Consensus        32 ~~~vac~TdDfAmQNVllqm   51 (212)
                      .++.++--+|.||-|.|.+.
T Consensus        17 ~vkF~L~nTdlsvANsLRRV   36 (285)
T KOG1522|consen   17 NVKFVLSNTDLSVANSLRRV   36 (285)
T ss_pred             ceEEEEecChHHHHHHHHHH
Confidence            34556666666666666553


Done!