BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 028208
         (212 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2VHC|A Chain A, P4 Protein From Bacteriophage Phi12 N234g Mutant In
           Complex With Ampcpp And Mn
 pdb|2VHC|B Chain B, P4 Protein From Bacteriophage Phi12 N234g Mutant In
           Complex With Ampcpp And Mn
 pdb|2VHC|C Chain C, P4 Protein From Bacteriophage Phi12 N234g Mutant In
           Complex With Ampcpp And Mn
          Length = 331

 Score = 28.9 bits (63), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 3/42 (7%)

Query: 117 QGHKDVIVWSPFLCGNSVPVSPFVAEALGQDLNAGMVMVNIK 158
           QGH+    W   L G  V  SP VAE  G    +GMV+V  K
Sbjct: 93  QGHRG---WLVDLTGELVGCSPVVAEFGGHRYASGMVIVTGK 131


>pdb|2VHU|A Chain A, P4 Protein From Bacteriophage Phi12 K241c Mutant In
           Complex With Adp And Mgcl
 pdb|2VHU|B Chain B, P4 Protein From Bacteriophage Phi12 K241c Mutant In
           Complex With Adp And Mgcl
 pdb|2VHU|C Chain C, P4 Protein From Bacteriophage Phi12 K241c Mutant In
           Complex With Adp And Mgcl
          Length = 331

 Score = 28.9 bits (63), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 3/42 (7%)

Query: 117 QGHKDVIVWSPFLCGNSVPVSPFVAEALGQDLNAGMVMVNIK 158
           QGH+    W   L G  V  SP VAE  G    +GMV+V  K
Sbjct: 93  QGHRG---WLVDLTGELVGCSPVVAEFGGHRYASGMVIVTGK 131


>pdb|1W44|A Chain A, P4 Protein From Bacteriophage Phi12 In Complex With Adp
 pdb|1W44|B Chain B, P4 Protein From Bacteriophage Phi12 In Complex With Adp
 pdb|1W44|C Chain C, P4 Protein From Bacteriophage Phi12 In Complex With Adp
 pdb|1W46|A Chain A, P4 Protein From Bacteriophage Phi12 In Complex With Adp
           And Mg
 pdb|1W46|B Chain B, P4 Protein From Bacteriophage Phi12 In Complex With Adp
           And Mg
 pdb|1W46|C Chain C, P4 Protein From Bacteriophage Phi12 In Complex With Adp
           And Mg
 pdb|1W47|A Chain A, P4 Protein From Bacteriophage Phi12 In Complex With Adp
           And Mn
 pdb|1W47|B Chain B, P4 Protein From Bacteriophage Phi12 In Complex With Adp
           And Mn
 pdb|1W47|C Chain C, P4 Protein From Bacteriophage Phi12 In Complex With Adp
           And Mn
 pdb|1W48|A Chain A, P4 Protein From Bacteriophage Phi12 In Complex With Ampcpp
 pdb|1W48|B Chain B, P4 Protein From Bacteriophage Phi12 In Complex With Ampcpp
 pdb|1W48|C Chain C, P4 Protein From Bacteriophage Phi12 In Complex With Ampcpp
 pdb|1W49|A Chain A, P4 Protein From Bacteriophage Phi12 In Complex With Ampcpp
           And Mg
 pdb|1W49|B Chain B, P4 Protein From Bacteriophage Phi12 In Complex With Ampcpp
           And Mg
 pdb|1W49|C Chain C, P4 Protein From Bacteriophage Phi12 In Complex With Ampcpp
           And Mg
 pdb|1W4A|A Chain A, P4 Protein From Phi12 In Complex With Ampcpp And Mn
 pdb|1W4A|B Chain B, P4 Protein From Phi12 In Complex With Ampcpp And Mn
 pdb|1W4A|C Chain C, P4 Protein From Phi12 In Complex With Ampcpp And Mn
 pdb|1W4B|A Chain A, P4 Protein From Phi12 In Complex With Product (Ampcpp Mg
           22c)
 pdb|1W4B|B Chain B, P4 Protein From Phi12 In Complex With Product (Ampcpp Mg
           22c)
 pdb|1W4B|C Chain C, P4 Protein From Phi12 In Complex With Product (Ampcpp Mg
           22c)
 pdb|1W4C|A Chain A, P4 Protein From Bacteriophage Phi12 Apo State
 pdb|1W4C|B Chain B, P4 Protein From Bacteriophage Phi12 Apo State
 pdb|1W4C|C Chain C, P4 Protein From Bacteriophage Phi12 Apo State
 pdb|1W4C|D Chain D, P4 Protein From Bacteriophage Phi12 Apo State
 pdb|1W4C|E Chain E, P4 Protein From Bacteriophage Phi12 Apo State
 pdb|1W4C|F Chain F, P4 Protein From Bacteriophage Phi12 Apo State
 pdb|1W4C|G Chain G, P4 Protein From Bacteriophage Phi12 Apo State
 pdb|1W4C|H Chain H, P4 Protein From Bacteriophage Phi12 Apo State
 pdb|1W4C|I Chain I, P4 Protein From Bacteriophage Phi12 Apo State
 pdb|1W4C|J Chain J, P4 Protein From Bacteriophage Phi12 Apo State
 pdb|1W4C|K Chain K, P4 Protein From Bacteriophage Phi12 Apo State
 pdb|1W4C|L Chain L, P4 Protein From Bacteriophage Phi12 Apo State
 pdb|1W4C|M Chain M, P4 Protein From Bacteriophage Phi12 Apo State
 pdb|1W4C|N Chain N, P4 Protein From Bacteriophage Phi12 Apo State
 pdb|1W4C|O Chain O, P4 Protein From Bacteriophage Phi12 Apo State
 pdb|1W4C|P Chain P, P4 Protein From Bacteriophage Phi12 Apo State
 pdb|1W4C|Q Chain Q, P4 Protein From Bacteriophage Phi12 Apo State
 pdb|1W4C|R Chain R, P4 Protein From Bacteriophage Phi12 Apo State
 pdb|1W4C|S Chain S, P4 Protein From Bacteriophage Phi12 Apo State
 pdb|1W4C|T Chain T, P4 Protein From Bacteriophage Phi12 Apo State
 pdb|1W4C|U Chain U, P4 Protein From Bacteriophage Phi12 Apo State
 pdb|1W4C|V Chain V, P4 Protein From Bacteriophage Phi12 Apo State
 pdb|1W4C|W Chain W, P4 Protein From Bacteriophage Phi12 Apo State
 pdb|1W4C|X Chain X, P4 Protein From Bacteriophage Phi12 Apo State
          Length = 331

 Score = 28.9 bits (63), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 3/42 (7%)

Query: 117 QGHKDVIVWSPFLCGNSVPVSPFVAEALGQDLNAGMVMVNIK 158
           QGH+    W   L G  V  SP VAE  G    +GMV+V  K
Sbjct: 93  QGHRG---WLVDLTGELVGCSPVVAEFGGHRYASGMVIVTGK 131


>pdb|2VHJ|A Chain A, P4 Protein From Bacteriophage Phi12 S252a Mutant In
           Complex With Adp
 pdb|2VHJ|B Chain B, P4 Protein From Bacteriophage Phi12 S252a Mutant In
           Complex With Adp
 pdb|2VHJ|C Chain C, P4 Protein From Bacteriophage Phi12 S252a Mutant In
           Complex With Adp
 pdb|2VHQ|A Chain A, P4 Protein From Bacteriophage Phi12 S252a Mutant In
           Complex With Atp And Mg
 pdb|2VHQ|B Chain B, P4 Protein From Bacteriophage Phi12 S252a Mutant In
           Complex With Atp And Mg
 pdb|2VHQ|C Chain C, P4 Protein From Bacteriophage Phi12 S252a Mutant In
           Complex With Atp And Mg
          Length = 331

 Score = 28.9 bits (63), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 3/42 (7%)

Query: 117 QGHKDVIVWSPFLCGNSVPVSPFVAEALGQDLNAGMVMVNIK 158
           QGH+    W   L G  V  SP VAE  G    +GMV+V  K
Sbjct: 93  QGHRG---WLVDLTGELVGCSPVVAEFGGHRYASGMVIVTGK 131


>pdb|2VHT|A Chain A, P4 Protein From Bacteriophage Phi12 R279a Mutant In
           Complex With Atp
 pdb|2VHT|B Chain B, P4 Protein From Bacteriophage Phi12 R279a Mutant In
           Complex With Atp
 pdb|2VHT|C Chain C, P4 Protein From Bacteriophage Phi12 R279a Mutant In
           Complex With Atp
          Length = 331

 Score = 28.9 bits (63), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 3/42 (7%)

Query: 117 QGHKDVIVWSPFLCGNSVPVSPFVAEALGQDLNAGMVMVNIK 158
           QGH+    W   L G  V  SP VAE  G    +GMV+V  K
Sbjct: 93  QGHRG---WLVDLTGELVGCSPVVAEFGGHRYASGMVIVTGK 131


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.134    0.409 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,819,663
Number of Sequences: 62578
Number of extensions: 216099
Number of successful extensions: 481
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 8
Number of HSP's that attempted gapping in prelim test: 481
Number of HSP's gapped (non-prelim): 8
length of query: 212
length of database: 14,973,337
effective HSP length: 95
effective length of query: 117
effective length of database: 9,028,427
effective search space: 1056325959
effective search space used: 1056325959
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)