BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 028216
         (212 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3N8H|A Chain A, Crystal Structure Of Pantoate-Beta-Alanine Ligase From
          Franc Tularensis
 pdb|3N8H|B Chain B, Crystal Structure Of Pantoate-Beta-Alanine Ligase From
          Franc Tularensis
 pdb|3QTT|A Chain A, Crystal Structure Of Pantoate-Beta-Alanine Ligase From
          Francisella Tularensis Complexed With Beta-Gamma Atp
          And Beta-Alanine
 pdb|3QTT|B Chain B, Crystal Structure Of Pantoate-Beta-Alanine Ligase From
          Francisella Tularensis Complexed With Beta-Gamma Atp
          And Beta-Alanine
          Length = 264

 Score = 32.0 bits (71), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 41 HNGFAWFVAFL-CESCFTFVWVLITGTKWT-PISYNTYPQRLQERIKELPPLDIFV 94
          HNG    +     E+    V + +  T++  P  Y TYP +LQ+ I+ L  LD+ V
Sbjct: 36 HNGHISLIKKAKSENDVVIVSIFVNPTQFNNPNDYQTYPNQLQQDIQILASLDVDV 91


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.138    0.452 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,081,308
Number of Sequences: 62578
Number of extensions: 219269
Number of successful extensions: 433
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 432
Number of HSP's gapped (non-prelim): 2
length of query: 212
length of database: 14,973,337
effective HSP length: 95
effective length of query: 117
effective length of database: 9,028,427
effective search space: 1056325959
effective search space used: 1056325959
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 49 (23.5 bits)