BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 028224
         (212 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2GMH|A Chain A, Structure Of Porcine Electron Transfer Flavoprotein-
           Ubiquinone Oxidoreductase In Complexed With Ubiquinone
 pdb|2GMH|B Chain B, Structure Of Porcine Electron Transfer Flavoprotein-
           Ubiquinone Oxidoreductase In Complexed With Ubiquinone
 pdb|2GMJ|A Chain A, Structure Of Porcine Electron Transfer Flavoprotein-
           Ubiquinone Oxidoreductase
 pdb|2GMJ|B Chain B, Structure Of Porcine Electron Transfer Flavoprotein-
           Ubiquinone Oxidoreductase
          Length = 584

 Score = 28.1 bits (61), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 2/40 (5%)

Query: 57  WQHLKTSPSFADAAMG--RIAQGTKVLAEGGYEKIFRQTF 94
           +Q  K  PS      G  RIA G + L EGG++ I + TF
Sbjct: 307 FQRWKHHPSIKPTLEGGKRIAYGARALNEGGFQSIPKLTF 346


>pdb|1ATG|A Chain A, Azotobacter Vinelandii Periplasmic Molybdate-Binding
           Protein
          Length = 231

 Score = 27.3 bits (59), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 35/71 (49%), Gaps = 11/71 (15%)

Query: 16  APPSNSFSFKDAVGSVKDVLGRWGKKVGEATKKAEDLAGNTWQHLKTS-PSFADAAMGRI 74
           A P + F++  A+G  K VL  W  K G    + + LAGN W+H+  S P  A   +   
Sbjct: 69  ALPGSRFTY--AIG--KLVL--WSAKPGLVDNQGKVLAGNGWRHIAISNPQIAPYGLA-- 120

Query: 75  AQGTKVLAEGG 85
             GT+VL   G
Sbjct: 121 --GTQVLTHLG 129


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.314    0.130    0.393 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,723,697
Number of Sequences: 62578
Number of extensions: 267137
Number of successful extensions: 451
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 451
Number of HSP's gapped (non-prelim): 6
length of query: 212
length of database: 14,973,337
effective HSP length: 95
effective length of query: 117
effective length of database: 9,028,427
effective search space: 1056325959
effective search space used: 1056325959
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 49 (23.5 bits)