Citrus Sinensis ID: 028225

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210--

MARDSGIWQNSFIFISVDFNFSLRPKIKRQQLQQRQGTKTGKKKKMHSFGYRANALLTFAVTILALMCAIASLSDNLNTPSPSAQIEILNINWFQKQPHGNDEVSLTLNITADLQSLFTWNTKQLFIFVAAEYETPKNALNQVSLWDAIIPAKEFAKFSIHTSNKYRFIDQGHNLRSKEFNLTLHWHVMPKTGKMFANKIVMSGYRLPEDYR

ccccccccEEEEEEEEEEccCCccccccccHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEECcccccccccEEEEEEEEccccccccccccEEEEEEEEEEECcccccccEEEEEEcccccccccEEEEccccCEEEEEcccccccccEEEEEEEEEECcCEEEEEEEEEcCEECcccccc

****SGIWQNSFIFISVDFNFSLRP**********************SFGYRANALLTFAVTILALMCAIASLSDNLNTPSPSAQIEILNINWFQKQPHGNDEVSLTLNITADLQSLFTWNTKQLFIFVAAEYETPKNALNQVSLWDAIIPAKEFAKFSIHTSNKYRFIDQGHNLRSKEFNLTLHWHVMPKTGKMFANKIVMSGYRLPE***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Signal peptidase complex subunit 3B	Microsomal signal peptidase is a membrane-bound endoproteinase that removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.	probable	Q53YF3

Prediction of Enzyme Commission Number

No confident prediction of EC number!