Citrus Sinensis ID: 028226
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 212 | ||||||
| 297739428 | 369 | unnamed protein product [Vitis vinifera] | 0.976 | 0.560 | 0.782 | 7e-93 | |
| 224129872 | 225 | predicted protein [Populus trichocarpa] | 0.995 | 0.937 | 0.773 | 6e-92 | |
| 359486147 | 219 | PREDICTED: glutathione S-transferase zet | 0.976 | 0.945 | 0.782 | 1e-91 | |
| 225465322 | 216 | PREDICTED: glutathione S-transferase zet | 0.976 | 0.958 | 0.782 | 1e-91 | |
| 255556709 | 221 | glutathione-s-transferase theta, gst, pu | 0.995 | 0.954 | 0.758 | 8e-91 | |
| 325300944 | 231 | glutathione-S-transferase [Pyrus pyrifol | 0.976 | 0.896 | 0.769 | 1e-90 | |
| 11132235 | 225 | RecName: Full=Glutathione S-transferase | 0.990 | 0.933 | 0.747 | 2e-89 | |
| 329130892 | 231 | zeta class glutathione S-transferase pro | 0.995 | 0.913 | 0.715 | 1e-87 | |
| 29420155 | 218 | glutathione S-transferase Z1 [Malva pusi | 0.995 | 0.967 | 0.715 | 2e-87 | |
| 24061762 | 220 | glutathione S-transferase [Capsicum annu | 0.990 | 0.954 | 0.719 | 2e-87 |
| >gi|297739428|emb|CBI29610.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 345 bits (885), Expect = 7e-93, Method: Compositional matrix adjust.
Identities = 162/207 (78%), Positives = 188/207 (90%)
Query: 2 LKLFSYWRSSCSHRVRIGLNLKGLEYEYKAVNLVKGEQFSPDFLKINPIGYVPALVDGDF 61
LKL+SYWRSSCS RVRI LNLK L+YEYKAVNLVKGEQFSP+F K+NP+ +VPALVDGD
Sbjct: 159 LKLYSYWRSSCSCRVRIALNLKRLKYEYKAVNLVKGEQFSPEFSKLNPLNFVPALVDGDI 218
Query: 62 VVSDSFAILMYLEEKYPQPPLLPSDLKRKAINYQAANIVSSSIQPLQNLAVVKYIEEKAG 121
VV+DSFAILMYLEEKYPQ PLLP DL ++AINYQAANIVS++IQPLQNL V+KYIEEK G
Sbjct: 219 VVADSFAILMYLEEKYPQHPLLPQDLHKRAINYQAANIVSANIQPLQNLVVLKYIEEKCG 278
Query: 122 ADERDIWAKTHIGKGFAALEKLLKDYAGKYATGDEVFLADLYLAPQLYAAVNRFNLDMTQ 181
+ ER W K HI KGFAALEKLLKD+AGKYATGDEVFLADL+LAPQ++AA+ RF +DMT+
Sbjct: 279 SGERLTWVKHHIEKGFAALEKLLKDHAGKYATGDEVFLADLFLAPQIHAALKRFKMDMTE 338
Query: 182 FPLLLRLHEAYSKLPAFQNAVPEKQPD 208
FPLLLRL++AY++LPAFQ+A+PEKQPD
Sbjct: 339 FPLLLRLNDAYNELPAFQDAMPEKQPD 365
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224129872|ref|XP_002328824.1| predicted protein [Populus trichocarpa] gi|222839122|gb|EEE77473.1| predicted protein [Populus trichocarpa] gi|283135898|gb|ADB11340.1| zeta class glutathione transferase GSTZ2 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359486147|ref|XP_003633399.1| PREDICTED: glutathione S-transferase zeta class-like isoform 2 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225465322|ref|XP_002273077.1| PREDICTED: glutathione S-transferase zeta class-like isoform 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255556709|ref|XP_002519388.1| glutathione-s-transferase theta, gst, putative [Ricinus communis] gi|223541455|gb|EEF43005.1| glutathione-s-transferase theta, gst, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|325300944|gb|ADZ05465.1| glutathione-S-transferase [Pyrus pyrifolia] | Back alignment and taxonomy information |
|---|
| >gi|11132235|sp|P57108.1|GSTZ_EUPES RecName: Full=Glutathione S-transferase zeta class gi|8099671|gb|AAF72197.1|AF263737_1 glutathione S-transferase [Euphorbia esula] | Back alignment and taxonomy information |
|---|
| >gi|329130892|gb|AEB77870.1| zeta class glutathione S-transferase protein [Bruguiera gymnorhiza] | Back alignment and taxonomy information |
|---|
| >gi|29420155|gb|AAO61856.1| glutathione S-transferase Z1 [Malva pusilla] | Back alignment and taxonomy information |
|---|
| >gi|24061762|gb|AAN39918.1| glutathione S-transferase [Capsicum annuum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 212 | ||||||
| TAIR|locus:2056261 | 223 | GSTZ2 "glutathione S-transfera | 0.995 | 0.946 | 0.658 | 4.5e-75 | |
| DICTYBASE|DDB_G0278155 | 219 | mai "maleylacetoacetate isomer | 0.962 | 0.931 | 0.471 | 2.1e-45 | |
| ZFIN|ZDB-GENE-040718-184 | 220 | gstz1 "glutathione S-transfera | 0.943 | 0.909 | 0.471 | 9.1e-45 | |
| RGD|1589363 | 216 | Gstz1 "glutathione S-transfera | 0.952 | 0.935 | 0.473 | 6.4e-44 | |
| FB|FBgn0037697 | 227 | GstZ2 "Glutathione S transfera | 0.948 | 0.885 | 0.447 | 5.7e-43 | |
| UNIPROTKB|F1S2N0 | 216 | GSTZ1 "Uncharacterized protein | 0.948 | 0.930 | 0.461 | 1.2e-42 | |
| UNIPROTKB|K7GQV5 | 217 | GSTZ1 "Uncharacterized protein | 0.948 | 0.926 | 0.461 | 1.2e-42 | |
| UNIPROTKB|E2RT24 | 217 | GSTZ1 "Uncharacterized protein | 0.948 | 0.926 | 0.461 | 1.5e-42 | |
| UNIPROTKB|J9NVB0 | 216 | GSTZ1 "Uncharacterized protein | 0.948 | 0.930 | 0.461 | 1.5e-42 | |
| MGI|MGI:1341859 | 216 | Gstz1 "glutathione transferase | 0.952 | 0.935 | 0.454 | 3.2e-42 |
| TAIR|locus:2056261 GSTZ2 "glutathione S-transferase (class zeta) 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 757 (271.5 bits), Expect = 4.5e-75, P = 4.5e-75
Identities = 139/211 (65%), Positives = 174/211 (82%)
Query: 2 LKLFSYWRSSCSHRVRIGLNLKGLEYEYKAVNLVKGEQFSPDFLKINPIGYVPALVDGDF 61
LKL+SYWRSSC+HRVRI L LKGL+YEY VNL+KG+Q DF KINP+G VPALVDGD
Sbjct: 12 LKLYSYWRSSCAHRVRIALTLKGLDYEYIPVNLLKGDQSDSDFKKINPMGTVPALVDGDV 71
Query: 62 VVSDSFAILMYLEEKYPQPPLLPSDLKRKAINYQAANIVSSSIQPLQNLAVVKYIEEKAG 121
V++DSFAI+MYL++KYP+PPLLPSD ++A+NYQA +IV S IQP QN+A+ +Y+E+K
Sbjct: 72 VINDSFAIIMYLDDKYPEPPLLPSDYHKRAVNYQATSIVMSGIQPHQNMALFRYLEDKIN 131
Query: 122 ADERDIWAKTHIGKGFAALEKLLKDYAGKYATGDEVFLADLYLAPQLYAAVNRFNLDMTQ 181
A+E+ W I KGF ALEKLL AGKYATGDEV+LADL+LAPQ++AA NRF+++M
Sbjct: 132 AEEKTAWITNAITKGFTALEKLLVSCAGKYATGDEVYLADLFLAPQIHAAFNRFHINMEP 191
Query: 182 FPLLLRLHEAYSKLPAFQNAVPEKQPDAPSS 212
FP L R +E+Y++LPAFQNAVPEKQPD PS+
Sbjct: 192 FPTLARFYESYNELPAFQNAVPEKQPDTPST 222
|
|
| DICTYBASE|DDB_G0278155 mai "maleylacetoacetate isomerase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040718-184 gstz1 "glutathione S-transferase zeta 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|1589363 Gstz1 "glutathione S-transferase zeta 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0037697 GstZ2 "Glutathione S transferase Z2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S2N0 GSTZ1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7GQV5 GSTZ1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RT24 GSTZ1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NVB0 GSTZ1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1341859 Gstz1 "glutathione transferase zeta 1 (maleylacetoacetate isomerase)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 212 | |||
| TIGR01262 | 210 | TIGR01262, maiA, maleylacetoacetate isomerase | 1e-104 | |
| cd03191 | 121 | cd03191, GST_C_Zeta, C-terminal, alpha helical dom | 5e-57 | |
| COG0625 | 211 | COG0625, Gst, Glutathione S-transferase [Posttrans | 2e-42 | |
| cd03042 | 73 | cd03042, GST_N_Zeta, GST_N family, Class Zeta subf | 1e-39 | |
| cd00570 | 71 | cd00570, GST_N_family, Glutathione S-transferase ( | 4e-23 | |
| cd03048 | 81 | cd03048, GST_N_Ure2p_like, GST_N family, Ure2p-lik | 1e-22 | |
| cd03046 | 76 | cd03046, GST_N_GTT1_like, GST_N family, Saccharomy | 4e-20 | |
| cd03053 | 76 | cd03053, GST_N_Phi, GST_N family, Class Phi subfam | 8e-20 | |
| pfam13417 | 75 | pfam13417, GST_N_3, Glutathione S-transferase, N-t | 8e-20 | |
| cd03050 | 76 | cd03050, GST_N_Theta, GST_N family, Class Theta su | 6e-19 | |
| cd03045 | 74 | cd03045, GST_N_Delta_Epsilon, GST_N family, Class | 1e-17 | |
| cd03057 | 77 | cd03057, GST_N_Beta, GST_N family, Class Beta subf | 5e-17 | |
| pfam13409 | 68 | pfam13409, GST_N_2, Glutathione S-transferase, N-t | 1e-16 | |
| cd03056 | 73 | cd03056, GST_N_4, GST_N family, unknown subfamily | 2e-16 | |
| PLN02395 | 215 | PLN02395, PLN02395, glutathione S-transferase | 2e-16 | |
| pfam02798 | 74 | pfam02798, GST_N, Glutathione S-transferase, N-ter | 3e-15 | |
| cd03051 | 74 | cd03051, GST_N_GTT2_like, GST_N family, Saccharomy | 7e-14 | |
| PRK15113 | 214 | PRK15113, PRK15113, glutathione S-transferase; Pro | 8e-14 | |
| cd03058 | 74 | cd03058, GST_N_Tau, GST_N family, Class Tau subfam | 4e-13 | |
| PRK09481 | 211 | PRK09481, sspA, stringent starvation protein A; Pr | 9e-13 | |
| cd03052 | 73 | cd03052, GST_N_GDAP1, GST_N family, Ganglioside-in | 8e-11 | |
| PLN02473 | 214 | PLN02473, PLN02473, glutathione S-transferase | 8e-10 | |
| PLN02817 | 265 | PLN02817, PLN02817, glutathione dehydrogenase (asc | 8e-10 | |
| PLN02378 | 213 | PLN02378, PLN02378, glutathione S-transferase DHAR | 1e-09 | |
| cd03059 | 73 | cd03059, GST_N_SspA, GST_N family, Stringent starv | 2e-09 | |
| PRK11752 | 264 | PRK11752, PRK11752, putative S-transferase; Provis | 3e-09 | |
| cd03047 | 73 | cd03047, GST_N_2, GST_N family, unknown subfamily | 1e-08 | |
| cd03038 | 84 | cd03038, GST_N_etherase_LigE, GST_N family, Beta e | 3e-08 | |
| PRK13972 | 215 | PRK13972, PRK13972, GSH-dependent disulfide bond o | 2e-07 | |
| cd03043 | 73 | cd03043, GST_N_1, GST_N family, unknown subfamily | 7e-07 | |
| pfam00043 | 92 | pfam00043, GST_C, Glutathione S-transferase, C-ter | 1e-06 | |
| PRK10542 | 201 | PRK10542, PRK10542, glutathionine S-transferase; P | 4e-05 | |
| cd03039 | 72 | cd03039, GST_N_Sigma_like, GST_N family, Class Sig | 5e-05 | |
| PRK10357 | 202 | PRK10357, PRK10357, putative glutathione S-transfe | 1e-04 | |
| cd03044 | 75 | cd03044, GST_N_EF1Bgamma, GST_N family, Gamma subu | 4e-04 | |
| cd03055 | 89 | cd03055, GST_N_Omega, GST_N family, Class Omega su | 0.001 |
| >gnl|CDD|233333 TIGR01262, maiA, maleylacetoacetate isomerase | Back alignment and domain information |
|---|
Score = 298 bits (765), Expect = e-104
Identities = 111/211 (52%), Positives = 143/211 (67%), Gaps = 4/211 (1%)
Query: 3 KLFSYWRSSCSHRVRIGLNLKGLEYEYKAVNLVK-GEQFSPDFLKINPIGYVPALVDGDF 61
KL+SYWRSSCS+RVRI L LKG++YEY VNL++ GEQ SP+FL +NP G VP L
Sbjct: 1 KLYSYWRSSCSYRVRIALALKGIDYEYVPVNLLRDGEQRSPEFLALNPQGLVPTLDIDGE 60
Query: 62 VVSDSFAILMYLEEKYPQPPLLPSDLKRKAINYQAANIVSSSIQPLQNLAVVKYIEEKAG 121
V++ S AI+ YLEE YP PPLLP+D ++A A +++ I PL NL V++Y+ EK G
Sbjct: 61 VLTQSLAIIEYLEETYPDPPLLPADPIKRARVRALALLIACDIHPLNNLRVLQYLREKLG 120
Query: 122 ADE--RDIWAKTHIGKGFAALEKLLKDYAGKYATGDEVFLADLYLAPQLYAAVNRFNLDM 179
+E R+ W + I KGFAALE LL+ +AG + GD LADL L PQ+Y A RF +D+
Sbjct: 121 VEEEARNRWYQHWISKGFAALEALLQPHAGAFCVGDTPTLADLCLVPQVYNA-ERFGVDL 179
Query: 180 TQFPLLLRLHEAYSKLPAFQNAVPEKQPDAP 210
T +P L R+ A + LPAFQ A PE QPD P
Sbjct: 180 TPYPTLRRIAAALAALPAFQRAHPENQPDTP 210
|
Maleylacetoacetate isomerase is an enzyme of tyrosine and phenylalanine catabolism. It requires glutathione and belongs by homology to the zeta family of glutathione S-transferases. The enzyme (EC 5.2.1.2) is described as active also on maleylpyruvate, and the example from a Ralstonia sp. catabolic plasmid is described as a maleylpyruvate isomerase involved in gentisate catabolism [Energy metabolism, Amino acids and amines]. Length = 210 |
| >gnl|CDD|198300 cd03191, GST_C_Zeta, C-terminal, alpha helical domain of Class Zeta Glutathione S-transferases | Back alignment and domain information |
|---|
| >gnl|CDD|223698 COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|239340 cd03042, GST_N_Zeta, GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|238319 cd00570, GST_N_family, Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|239346 cd03048, GST_N_Ure2p_like, GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs | Back alignment and domain information |
|---|
| >gnl|CDD|239344 cd03046, GST_N_GTT1_like, GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >gnl|CDD|239351 cd03053, GST_N_Phi, GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >gnl|CDD|205595 pfam13417, GST_N_3, Glutathione S-transferase, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|239348 cd03050, GST_N_Theta, GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >gnl|CDD|239343 cd03045, GST_N_Delta_Epsilon, GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|239355 cd03057, GST_N_Beta, GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|222110 pfam13409, GST_N_2, Glutathione S-transferase, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|239354 cd03056, GST_N_4, GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >gnl|CDD|166036 PLN02395, PLN02395, glutathione S-transferase | Back alignment and domain information |
|---|
| >gnl|CDD|217234 pfam02798, GST_N, Glutathione S-transferase, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|239349 cd03051, GST_N_GTT2_like, GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >gnl|CDD|185068 PRK15113, PRK15113, glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239356 cd03058, GST_N_Tau, GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|236537 PRK09481, sspA, stringent starvation protein A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239350 cd03052, GST_N_GDAP1, GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells | Back alignment and domain information |
|---|
| >gnl|CDD|166114 PLN02473, PLN02473, glutathione S-transferase | Back alignment and domain information |
|---|
| >gnl|CDD|166458 PLN02817, PLN02817, glutathione dehydrogenase (ascorbate) | Back alignment and domain information |
|---|
| >gnl|CDD|166019 PLN02378, PLN02378, glutathione S-transferase DHAR1 | Back alignment and domain information |
|---|
| >gnl|CDD|239357 cd03059, GST_N_SspA, GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >gnl|CDD|183298 PRK11752, PRK11752, putative S-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239345 cd03047, GST_N_2, GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >gnl|CDD|239336 cd03038, GST_N_etherase_LigE, GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor | Back alignment and domain information |
|---|
| >gnl|CDD|172475 PRK13972, PRK13972, GSH-dependent disulfide bond oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239341 cd03043, GST_N_1, GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs | Back alignment and domain information |
|---|
| >gnl|CDD|215674 pfam00043, GST_C, Glutathione S-transferase, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|182533 PRK10542, PRK10542, glutathionine S-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239337 cd03039, GST_N_Sigma_like, GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha | Back alignment and domain information |
|---|
| >gnl|CDD|182405 PRK10357, PRK10357, putative glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239342 cd03044, GST_N_EF1Bgamma, GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis | Back alignment and domain information |
|---|
| >gnl|CDD|239353 cd03055, GST_N_Omega, GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 212 | |||
| TIGR01262 | 210 | maiA maleylacetoacetate isomerase. Maleylacetoacet | 100.0 | |
| PRK09481 | 211 | sspA stringent starvation protein A; Provisional | 100.0 | |
| KOG0868 | 217 | consensus Glutathione S-transferase [Posttranslati | 100.0 | |
| PRK13972 | 215 | GSH-dependent disulfide bond oxidoreductase; Provi | 100.0 | |
| PLN02473 | 214 | glutathione S-transferase | 100.0 | |
| PRK15113 | 214 | glutathione S-transferase; Provisional | 100.0 | |
| PRK10542 | 201 | glutathionine S-transferase; Provisional | 100.0 | |
| PLN02395 | 215 | glutathione S-transferase | 100.0 | |
| COG0625 | 211 | Gst Glutathione S-transferase [Posttranslational m | 100.0 | |
| PRK10357 | 202 | putative glutathione S-transferase; Provisional | 100.0 | |
| PRK11752 | 264 | putative S-transferase; Provisional | 100.0 | |
| PTZ00057 | 205 | glutathione s-transferase; Provisional | 100.0 | |
| KOG0406 | 231 | consensus Glutathione S-transferase [Posttranslati | 100.0 | |
| KOG1695 | 206 | consensus Glutathione S-transferase [Posttranslati | 100.0 | |
| KOG0867 | 226 | consensus Glutathione S-transferase [Posttranslati | 100.0 | |
| PLN02378 | 213 | glutathione S-transferase DHAR1 | 100.0 | |
| TIGR00862 | 236 | O-ClC intracellular chloride channel protein. Thes | 100.0 | |
| PRK10387 | 210 | glutaredoxin 2; Provisional | 99.97 | |
| PLN02817 | 265 | glutathione dehydrogenase (ascorbate) | 99.97 | |
| TIGR02182 | 209 | GRXB Glutaredoxin, GrxB family. This model include | 99.96 | |
| KOG4420 | 325 | consensus Uncharacterized conserved protein (Gangl | 99.94 | |
| PLN02907 | 722 | glutamate-tRNA ligase | 99.92 | |
| KOG1422 | 221 | consensus Intracellular Cl- channel CLIC, contains | 99.85 | |
| cd03048 | 81 | GST_N_Ure2p_like GST_N family, Ure2p-like subfamil | 99.83 | |
| cd03052 | 73 | GST_N_GDAP1 GST_N family, Ganglioside-induced diff | 99.83 | |
| cd03045 | 74 | GST_N_Delta_Epsilon GST_N family, Class Delta and | 99.82 | |
| cd03050 | 76 | GST_N_Theta GST_N family, Class Theta subfamily; c | 99.81 | |
| cd03041 | 77 | GST_N_2GST_N GST_N family, 2 repeats of the N-term | 99.81 | |
| PF13417 | 75 | GST_N_3: Glutathione S-transferase, N-terminal dom | 99.8 | |
| cd03053 | 76 | GST_N_Phi GST_N family, Class Phi subfamily; compo | 99.8 | |
| cd03056 | 73 | GST_N_4 GST_N family, unknown subfamily 4; compose | 99.79 | |
| cd03047 | 73 | GST_N_2 GST_N family, unknown subfamily 2; compose | 99.79 | |
| cd03059 | 73 | GST_N_SspA GST_N family, Stringent starvation prot | 99.78 | |
| cd03058 | 74 | GST_N_Tau GST_N family, Class Tau subfamily; GSTs | 99.78 | |
| cd03046 | 76 | GST_N_GTT1_like GST_N family, Saccharomyces cerevi | 99.78 | |
| cd03057 | 77 | GST_N_Beta GST_N family, Class Beta subfamily; GST | 99.78 | |
| PF02798 | 76 | GST_N: Glutathione S-transferase, N-terminal domai | 99.78 | |
| cd03051 | 74 | GST_N_GTT2_like GST_N family, Saccharomyces cerevi | 99.77 | |
| cd03076 | 73 | GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar | 99.77 | |
| cd03042 | 73 | GST_N_Zeta GST_N family, Class Zeta subfamily; GST | 99.77 | |
| cd03044 | 75 | GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo | 99.77 | |
| cd03191 | 121 | GST_C_Zeta GST_C family, Class Zeta subfamily; GST | 99.76 | |
| cd03061 | 91 | GST_N_CLIC GST_N family, Chloride Intracellular Ch | 99.76 | |
| cd03039 | 72 | GST_N_Sigma_like GST_N family, Class Sigma_like; c | 99.75 | |
| cd03075 | 82 | GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar | 99.75 | |
| cd03080 | 75 | GST_N_Metaxin_like GST_N family, Metaxin subfamily | 99.75 | |
| COG2999 | 215 | GrxB Glutaredoxin 2 [Posttranslational modificatio | 99.74 | |
| KOG4244 | 281 | consensus Failed axon connections (fax) protein/gl | 99.73 | |
| cd03060 | 71 | GST_N_Omega_like GST_N family, Omega-like subfamil | 99.73 | |
| cd03055 | 89 | GST_N_Omega GST_N family, Class Omega subfamily; G | 99.73 | |
| cd03037 | 71 | GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub | 99.72 | |
| cd03077 | 79 | GST_N_Alpha GST_N family, Class Alpha subfamily; G | 99.72 | |
| cd03038 | 84 | GST_N_etherase_LigE GST_N family, Beta etherase Li | 99.71 | |
| cd03049 | 73 | GST_N_3 GST_N family, unknown subfamily 3; compose | 99.71 | |
| cd03188 | 114 | GST_C_Beta GST_C family, Class Beta subfamily; GST | 99.71 | |
| KOG3029 | 370 | consensus Glutathione S-transferase-related protei | 99.7 | |
| cd03196 | 115 | GST_C_5 GST_C family, unknown subfamily 5; compose | 99.7 | |
| cd03189 | 119 | GST_C_GTT1_like GST_C family, Saccharomyces cerevi | 99.69 | |
| cd03178 | 113 | GST_C_Ure2p_like GST_C family, Ure2p-like subfamil | 99.69 | |
| cd03208 | 137 | GST_C_Alpha GST_C family, Class Alpha subfamily; G | 99.69 | |
| cd03186 | 107 | GST_C_SspA GST_N family, Stringent starvation prot | 99.68 | |
| PF13409 | 70 | GST_N_2: Glutathione S-transferase, N-terminal dom | 99.68 | |
| cd03040 | 77 | GST_N_mPGES2 GST_N family; microsomal Prostaglandi | 99.68 | |
| COG0435 | 324 | ECM4 Predicted glutathione S-transferase [Posttran | 99.67 | |
| cd03177 | 118 | GST_C_Delta_Epsilon GST_C family, Class Delta and | 99.67 | |
| cd03180 | 110 | GST_C_2 GST_C family, unknown subfamily 2; compose | 99.66 | |
| cd03210 | 126 | GST_C_Pi GST_C family, Class Pi subfamily; GSTs ar | 99.66 | |
| cd03187 | 118 | GST_C_Phi GST_C family, Class Phi subfamily; compo | 99.66 | |
| cd03043 | 73 | GST_N_1 GST_N family, unknown subfamily 1; compose | 99.66 | |
| cd03209 | 121 | GST_C_Mu GST_C family, Class Mu subfamily; GSTs ar | 99.65 | |
| cd03181 | 123 | GST_C_EFB1gamma GST_C family, Gamma subunit of Elo | 99.65 | |
| cd03184 | 124 | GST_C_Omega GST_C family, Class Omega subfamily; G | 99.65 | |
| cd03182 | 117 | GST_C_GTT2_like GST_C family, Saccharomyces cerevi | 99.64 | |
| cd03185 | 126 | GST_C_Tau GST_C family, Class Tau subfamily; GSTs | 99.64 | |
| cd00570 | 71 | GST_N_family Glutathione S-transferase (GST) famil | 99.64 | |
| cd03190 | 142 | GST_C_ECM4_like GST_C family, ECM4-like subfamily; | 99.63 | |
| cd03183 | 126 | GST_C_Theta GST_C family, Class Theta subfamily; c | 99.6 | |
| cd03054 | 72 | GST_N_Metaxin GST_N family, Metaxin subfamily; com | 99.57 | |
| cd03200 | 96 | GST_C_JTV1 GST_C family, JTV-1 subfamily; composed | 99.56 | |
| cd03198 | 134 | GST_C_CLIC GST_C family, Chloride Intracellular Ch | 99.56 | |
| cd03195 | 114 | GST_C_4 GST_C family, unknown subfamily 4; compose | 99.56 | |
| cd03207 | 103 | GST_C_8 GST_C family, unknown subfamily 8; compose | 99.55 | |
| KOG2903 | 319 | consensus Predicted glutathione S-transferase [Pos | 99.55 | |
| cd03203 | 120 | GST_C_Lambda GST_C family, Class Lambda subfamily; | 99.54 | |
| PF00043 | 95 | GST_C: Glutathione S-transferase, C-terminal domai | 99.54 | |
| cd03206 | 100 | GST_C_7 GST_C family, unknown subfamily 7; compose | 99.54 | |
| KOG3027 | 257 | consensus Mitochondrial outer membrane protein Met | 99.51 | |
| cd03194 | 114 | GST_C_3 GST_C family, unknown subfamily 3; compose | 99.5 | |
| cd03179 | 105 | GST_C_1 GST_C family, unknown subfamily 1; compose | 99.49 | |
| cd03204 | 111 | GST_C_GDAP1 GST_C family, Ganglioside-induced diff | 99.48 | |
| PF14497 | 99 | GST_C_3: Glutathione S-transferase, C-terminal dom | 99.43 | |
| cd03201 | 121 | GST_C_DHAR GST_C family, Dehydroascorbate Reductas | 99.42 | |
| PF13410 | 69 | GST_C_2: Glutathione S-transferase, C-terminal dom | 99.4 | |
| cd03192 | 104 | GST_C_Sigma_like GST_C family, Class Sigma_like; c | 99.38 | |
| cd03079 | 74 | GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me | 99.36 | |
| cd00299 | 100 | GST_C_family Glutathione S-transferase (GST) famil | 99.33 | |
| cd03202 | 124 | GST_C_etherase_LigE GST_C family, Beta etherase Li | 99.27 | |
| KOG3028 | 313 | consensus Translocase of outer mitochondrial membr | 99.25 | |
| cd03205 | 98 | GST_C_6 GST_C family, unknown subfamily 6; compose | 99.17 | |
| cd03193 | 88 | GST_C_Metaxin GST_C family, Metaxin subfamily; com | 99.17 | |
| PF14834 | 117 | GST_C_4: Glutathione S-transferase, C-terminal dom | 99.17 | |
| TIGR02190 | 79 | GlrX-dom Glutaredoxin-family domain. This C-termin | 99.11 | |
| cd03078 | 73 | GST_N_Metaxin1_like GST_N family, Metaxin subfamil | 99.04 | |
| PRK10638 | 83 | glutaredoxin 3; Provisional | 99.02 | |
| cd03211 | 126 | GST_C_Metaxin2 GST_C family, Metaxin subfamily, Me | 99.01 | |
| cd03197 | 149 | GST_C_mPGES2 GST_C family; microsomal Prostaglandi | 98.97 | |
| cd03029 | 72 | GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb | 98.97 | |
| cd03212 | 137 | GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, | 98.97 | |
| TIGR02196 | 74 | GlrX_YruB Glutaredoxin-like protein, YruB-family. | 98.88 | |
| cd03027 | 73 | GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg | 98.8 | |
| cd02066 | 72 | GRX_family Glutaredoxin (GRX) family; composed of | 98.65 | |
| PRK10329 | 81 | glutaredoxin-like protein; Provisional | 98.63 | |
| COG0695 | 80 | GrxC Glutaredoxin and related proteins [Posttransl | 98.61 | |
| cd02976 | 73 | NrdH NrdH-redoxin (NrdH) family; NrdH is a small m | 98.6 | |
| cd03418 | 75 | GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b | 98.52 | |
| TIGR02200 | 77 | GlrX_actino Glutaredoxin-like protein. This family | 98.46 | |
| TIGR02181 | 79 | GRX_bact Glutaredoxin, GrxC family. This family of | 98.45 | |
| PRK11200 | 85 | grxA glutaredoxin 1; Provisional | 98.43 | |
| TIGR02194 | 72 | GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red | 98.37 | |
| TIGR02183 | 86 | GRXA Glutaredoxin, GrxA family. This model include | 98.34 | |
| PF00462 | 60 | Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl | 98.33 | |
| cd03419 | 82 | GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h | 98.29 | |
| TIGR02189 | 99 | GlrX-like_plant Glutaredoxin-like family. This fam | 98.19 | |
| PHA03050 | 108 | glutaredoxin; Provisional | 98.1 | |
| PF10568 | 72 | Tom37: Outer mitochondrial membrane transport comp | 98.08 | |
| TIGR02180 | 84 | GRX_euk Glutaredoxin. This model represents eukary | 98.04 | |
| TIGR00365 | 97 | monothiol glutaredoxin, Grx4 family. The gene for | 97.93 | |
| PF04399 | 132 | Glutaredoxin2_C: Glutaredoxin 2, C terminal domain | 97.9 | |
| cd03199 | 128 | GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) sub | 97.84 | |
| cd03028 | 90 | GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte | 97.82 | |
| KOG1147 | 712 | consensus Glutamyl-tRNA synthetase [Translation, r | 97.42 | |
| cd03031 | 147 | GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d | 97.33 | |
| cd03032 | 115 | ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub | 97.33 | |
| PRK01655 | 131 | spxA transcriptional regulator Spx; Reviewed | 97.29 | |
| PRK12759 | 410 | bifunctional gluaredoxin/ribonucleoside-diphosphat | 97.24 | |
| cd02973 | 67 | TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- | 97.19 | |
| PRK10824 | 115 | glutaredoxin-4; Provisional | 97.17 | |
| PRK13344 | 132 | spxA transcriptional regulator Spx; Reviewed | 97.15 | |
| PRK12559 | 131 | transcriptional regulator Spx; Provisional | 97.11 | |
| COG1393 | 117 | ArsC Arsenate reductase and related proteins, glut | 96.93 | |
| PRK10853 | 118 | putative reductase; Provisional | 96.85 | |
| cd03036 | 111 | ArsC_like Arsenate Reductase (ArsC) family, unknow | 96.79 | |
| KOG1752 | 104 | consensus Glutaredoxin and related proteins [Postt | 96.69 | |
| cd02977 | 105 | ArsC_family Arsenate Reductase (ArsC) family; comp | 96.67 | |
| cd03030 | 92 | GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 | 96.54 | |
| PTZ00062 | 204 | glutaredoxin; Provisional | 96.48 | |
| TIGR01617 | 117 | arsC_related transcriptional regulator, Spx/MgsR f | 96.32 | |
| PRK10026 | 141 | arsenate reductase; Provisional | 96.25 | |
| cd03035 | 105 | ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s | 96.11 | |
| cd03033 | 113 | ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p | 96.08 | |
| PHA02125 | 75 | thioredoxin-like protein | 95.73 | |
| COG4545 | 85 | Glutaredoxin-related protein [Posttranslational mo | 95.31 | |
| TIGR01616 | 126 | nitro_assoc nitrogenase-associated protein. This m | 95.28 | |
| TIGR00014 | 114 | arsC arsenate reductase (glutaredoxin). composed o | 95.05 | |
| cd03034 | 112 | ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC s | 95.04 | |
| cd03026 | 89 | AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid | 95.02 | |
| PF05768 | 81 | DUF836: Glutaredoxin-like domain (DUF836); InterPr | 94.98 | |
| COG0278 | 105 | Glutaredoxin-related protein [Posttranslational mo | 94.78 | |
| TIGR00411 | 82 | redox_disulf_1 small redox-active disulfide protei | 94.68 | |
| TIGR00412 | 76 | redox_disulf_2 small redox-active disulfide protei | 94.56 | |
| PF11801 | 168 | Tom37_C: Tom37 C-terminal domain; InterPro: IPR019 | 93.53 | |
| PF11287 | 112 | DUF3088: Protein of unknown function (DUF3088); In | 93.52 | |
| cd01659 | 69 | TRX_superfamily Thioredoxin (TRX) superfamily; a l | 91.37 | |
| PF13192 | 76 | Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY | 91.2 | |
| PF04908 | 99 | SH3BGR: SH3-binding, glutamic acid-rich protein; I | 90.16 | |
| PF09635 | 122 | MetRS-N: MetRS-N binding domain; InterPro: IPR0182 | 89.49 | |
| PF03960 | 110 | ArsC: ArsC family; InterPro: IPR006660 Several bac | 87.98 | |
| cd02947 | 93 | TRX_family TRX family; composed of two groups: Gro | 83.07 | |
| cd02949 | 97 | TRX_NTR TRX domain, novel NADPH thioredoxin reduct | 82.82 | |
| cd02989 | 113 | Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior | 81.98 | |
| cd02953 | 104 | DsbDgamma DsbD gamma family; DsbD gamma is the C-t | 81.54 | |
| KOG0911 | 227 | consensus Glutaredoxin-related protein [Posttransl | 81.3 |
| >TIGR01262 maiA maleylacetoacetate isomerase | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.7e-40 Score=242.91 Aligned_cols=207 Identities=53% Similarity=0.899 Sum_probs=172.5
Q ss_pred eecccCCCchhHHHHHHHHHcCCceeEEEeecCC-CCCCChhhhhcCCCcccceEeeCCeeeeeHHHHHHHHHHhCCCCC
Q 028226 3 KLFSYWRSSCSHRVRIGLNLKGLEYEYKAVNLVK-GEQFSPDFLKINPIGYVPALVDGDFVVSDSFAILMYLEEKYPQPP 81 (212)
Q Consensus 3 ~Ly~~~~s~~~~~vr~~l~~~~i~~~~~~~~~~~-~~~~~~~~~~~~p~~~~P~l~~~~~~~~es~~I~~yl~~~~~~~~ 81 (212)
+||++..|++++++|++|+++||+|+.+.+++.. ++...+++.+.||.+++|+|++||.+++||.+|++||++++++..
T Consensus 1 ~Ly~~~~s~~~~~v~~~l~~~gi~~~~~~v~~~~~~~~~~~~~~~~nP~g~vP~L~~~g~~l~ES~aI~~yl~~~~~~~~ 80 (210)
T TIGR01262 1 KLYSYWRSSCSYRVRIALALKGIDYEYVPVNLLRDGEQRSPEFLALNPQGLVPTLDIDGEVLTQSLAIIEYLEETYPDPP 80 (210)
T ss_pred CcccCCCCCchHHHHHHHHHCCCCceEEecccccccccCChhhhhcCCCCcCCEEEECCEEeecHHHHHHHHHHhCCCCC
Confidence 6899999999999999999999999999998743 345567899999999999999999999999999999999998777
Q ss_pred CCCCCHHHHHHHHHHHHHHHcccchhhHHHHHHHhhhh--cCcchHHHHHHHHHHHHHHHHHHHHhccCCCcccCCCchH
Q 028226 82 LLPSDLKRKAINYQAANIVSSSIQPLQNLAVVKYIEEK--AGADERDIWAKTHIGKGFAALEKLLKDYAGKYATGDEVFL 159 (212)
Q Consensus 82 l~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~l~~le~~L~~~~~~~l~G~~~t~ 159 (212)
+.|.++.+++++++|+.++...+.+............. ..++...+...+.+.+.|+.||++|++++++|++|+++|+
T Consensus 81 l~p~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~le~~L~~~~~~~l~G~~~T~ 160 (210)
T TIGR01262 81 LLPADPIKRARVRALALLIACDIHPLNNLRVLQYLREKLGVEEEARNRWYQHWISKGFAALEALLQPHAGAFCVGDTPTL 160 (210)
T ss_pred CCCCCHHHHHHHHHHHHHHhcccChhhhhhHHHHHHhhcCCCHHHHHHHHHHHHHHHHHHHHHHHhcCCCCEeeCCCCCH
Confidence 99999999999999999987666543222222221111 1122334556677999999999999875567999999999
Q ss_pred HHHhhHHHHHHHHHhcccCCCCcchHHHHHHHHhCCcchhhhCCCCCCCCC
Q 028226 160 ADLYLAPQLYAAVNRFNLDMTQFPLLLRLHEAYSKLPAFQNAVPEKQPDAP 210 (212)
Q Consensus 160 aD~~~~~~l~~~~~~~~~~~~~~p~l~~~~~~~~~~p~~~~~~~~~~~~~p 210 (212)
|||++++.+.++ ...+..++.||+|++|+++|.++|+++++....+|++|
T Consensus 161 ADi~~~~~l~~~-~~~~~~~~~~p~l~~~~~~~~~rp~~~~~~~~~~~~~~ 210 (210)
T TIGR01262 161 ADLCLVPQVYNA-ERFGVDLTPYPTLRRIAAALAALPAFQRAHPENQPDTP 210 (210)
T ss_pred HHHHHHHHHHHH-HHcCCCcccchHHHHHHHHHhcCHHHHHhCcccCCCCC
Confidence 999999999987 56666678999999999999999999999999988876
|
Maleylacetoacetate isomerase is an enzyme of tyrosine and phenylalanine catabolism. It requires glutathione and belongs by homology to the zeta family of glutathione S-transferases. The enzyme (EC 5.2.1.2) is described as active also on maleylpyruvate, and the example from a Ralstonia sp. catabolic plasmid is described as a maleylpyruvate isomerase involved in gentisate catabolism. |
| >PRK09481 sspA stringent starvation protein A; Provisional | Back alignment and domain information |
|---|
| >KOG0868 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PLN02473 glutathione S-transferase | Back alignment and domain information |
|---|
| >PRK15113 glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK10542 glutathionine S-transferase; Provisional | Back alignment and domain information |
|---|
| >PLN02395 glutathione S-transferase | Back alignment and domain information |
|---|
| >COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10357 putative glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK11752 putative S-transferase; Provisional | Back alignment and domain information |
|---|
| >PTZ00057 glutathione s-transferase; Provisional | Back alignment and domain information |
|---|
| >KOG0406 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1695 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0867 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN02378 glutathione S-transferase DHAR1 | Back alignment and domain information |
|---|
| >TIGR00862 O-ClC intracellular chloride channel protein | Back alignment and domain information |
|---|
| >PRK10387 glutaredoxin 2; Provisional | Back alignment and domain information |
|---|
| >PLN02817 glutathione dehydrogenase (ascorbate) | Back alignment and domain information |
|---|
| >TIGR02182 GRXB Glutaredoxin, GrxB family | Back alignment and domain information |
|---|
| >KOG4420 consensus Uncharacterized conserved protein (Ganglioside-induced differentiation associated protein 1, GDAP1) [Function unknown] | Back alignment and domain information |
|---|
| >PLN02907 glutamate-tRNA ligase | Back alignment and domain information |
|---|
| >KOG1422 consensus Intracellular Cl- channel CLIC, contains GST domain [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs | Back alignment and domain information |
|---|
| >cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells | Back alignment and domain information |
|---|
| >cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins | Back alignment and domain information |
|---|
| >PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A | Back alignment and domain information |
|---|
| >cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione | Back alignment and domain information |
|---|
| >cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis | Back alignment and domain information |
|---|
| >cd03191 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins | Back alignment and domain information |
|---|
| >cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha | Back alignment and domain information |
|---|
| >cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs | Back alignment and domain information |
|---|
| >COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4244 consensus Failed axon connections (fax) protein/glutathione S-transferase-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs | Back alignment and domain information |
|---|
| >cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E | Back alignment and domain information |
|---|
| >cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor | Back alignment and domain information |
|---|
| >cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >KOG3029 consensus Glutathione S-transferase-related protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03189 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs | Back alignment and domain information |
|---|
| >cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B | Back alignment and domain information |
|---|
| >cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 | Back alignment and domain information |
|---|
| >COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis | Back alignment and domain information |
|---|
| >cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03182 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4 | Back alignment and domain information |
|---|
| >cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins | Back alignment and domain information |
|---|
| >cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene | Back alignment and domain information |
|---|
| >cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins | Back alignment and domain information |
|---|
| >cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >KOG2903 consensus Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs | Back alignment and domain information |
|---|
| >PF00043 GST_C: Glutathione S-transferase, C-terminal domain; InterPro: IPR004046 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione | Back alignment and domain information |
|---|
| >cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >KOG3027 consensus Mitochondrial outer membrane protein Metaxin 2, Metaxin 1-binding protein [Cell wall/membrane/envelope biogenesis; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd03194 GST_C_3 GST_C family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03179 GST_C_1 GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells | Back alignment and domain information |
|---|
| >PF14497 GST_C_3: Glutathione S-transferase, C-terminal domain; PDB: 3AY8_A 2UZ8_B 1V2A_C 2HNL_A 2YV9_B 3H1N_A 3FR6_A 1Q4J_B 1PA3_B 1OKT_B | Back alignment and domain information |
|---|
| >cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant | Back alignment and domain information |
|---|
| >PF13410 GST_C_2: Glutathione S-transferase, C-terminal domain; PDB: 4DEJ_H 3IC8_A 2JL4_A 2V6K_B 3CBU_B 1JLW_B 3F6D_B 3G7I_A 3F63_A 3G7J_B | Back alignment and domain information |
|---|
| >cd03192 GST_C_Sigma_like GST_C family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi, and Alpha | Back alignment and domain information |
|---|
| >cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait | Back alignment and domain information |
|---|
| >cd00299 GST_C_family Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03202 GST_C_etherase_LigE GST_C family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor | Back alignment and domain information |
|---|
| >KOG3028 consensus Translocase of outer mitochondrial membrane complex, subunit TOM37/Metaxin 1 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd03205 GST_C_6 GST_C family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins | Back alignment and domain information |
|---|
| >PF14834 GST_C_4: Glutathione S-transferase, C-terminal domain; PDB: 3BBY_A | Back alignment and domain information |
|---|
| >TIGR02190 GlrX-dom Glutaredoxin-family domain | Back alignment and domain information |
|---|
| >cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi | Back alignment and domain information |
|---|
| >PRK10638 glutaredoxin 3; Provisional | Back alignment and domain information |
|---|
| >cd03211 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait | Back alignment and domain information |
|---|
| >cd03197 GST_C_mPGES2 GST_C family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 | Back alignment and domain information |
|---|
| >cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria | Back alignment and domain information |
|---|
| >cd03212 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins | Back alignment and domain information |
|---|
| >TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family | Back alignment and domain information |
|---|
| >cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions | Back alignment and domain information |
|---|
| >cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >PRK10329 glutaredoxin-like protein; Provisional | Back alignment and domain information |
|---|
| >COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile | Back alignment and domain information |
|---|
| >cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >TIGR02200 GlrX_actino Glutaredoxin-like protein | Back alignment and domain information |
|---|
| >TIGR02181 GRX_bact Glutaredoxin, GrxC family | Back alignment and domain information |
|---|
| >PRK11200 grxA glutaredoxin 1; Provisional | Back alignment and domain information |
|---|
| >TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH | Back alignment and domain information |
|---|
| >TIGR02183 GRXA Glutaredoxin, GrxA family | Back alignment and domain information |
|---|
| >PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >TIGR02189 GlrX-like_plant Glutaredoxin-like family | Back alignment and domain information |
|---|
| >PHA03050 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >PF10568 Tom37: Outer mitochondrial membrane transport complex protein; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space | Back alignment and domain information |
|---|
| >TIGR02180 GRX_euk Glutaredoxin | Back alignment and domain information |
|---|
| >TIGR00365 monothiol glutaredoxin, Grx4 family | Back alignment and domain information |
|---|
| >PF04399 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain; InterPro: IPR007494 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >cd03199 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E | Back alignment and domain information |
|---|
| >cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins | Back alignment and domain information |
|---|
| >KOG1147 consensus Glutamyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs | Back alignment and domain information |
|---|
| >cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes | Back alignment and domain information |
|---|
| >PRK01655 spxA transcriptional regulator Spx; Reviewed | Back alignment and domain information |
|---|
| >PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional | Back alignment and domain information |
|---|
| >cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) | Back alignment and domain information |
|---|
| >PRK10824 glutaredoxin-4; Provisional | Back alignment and domain information |
|---|
| >PRK13344 spxA transcriptional regulator Spx; Reviewed | Back alignment and domain information |
|---|
| >PRK12559 transcriptional regulator Spx; Provisional | Back alignment and domain information |
|---|
| >COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10853 putative reductase; Provisional | Back alignment and domain information |
|---|
| >cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >KOG1752 consensus Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx | Back alignment and domain information |
|---|
| >cd03030 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 domain binding glutamic acid-rich protein) subfamily; a recently-identified subfamily composed of SH3BGR and similar proteins possessing significant sequence similarity to GRX, but without a redox active CXXC motif | Back alignment and domain information |
|---|
| >PTZ00062 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family | Back alignment and domain information |
|---|
| >PRK10026 arsenate reductase; Provisional | Back alignment and domain information |
|---|
| >cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >PHA02125 thioredoxin-like protein | Back alignment and domain information |
|---|
| >COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01616 nitro_assoc nitrogenase-associated protein | Back alignment and domain information |
|---|
| >TIGR00014 arsC arsenate reductase (glutaredoxin) | Back alignment and domain information |
|---|
| >cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli | Back alignment and domain information |
|---|
| >cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides | Back alignment and domain information |
|---|
| >PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 | Back alignment and domain information |
|---|
| >TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 | Back alignment and domain information |
|---|
| >PF11801 Tom37_C: Tom37 C-terminal domain; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space | Back alignment and domain information |
|---|
| >PF11287 DUF3088: Protein of unknown function (DUF3088); InterPro: IPR021439 This family of proteins with unknown function appears to be restricted to Proteobacteria | Back alignment and domain information |
|---|
| >cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold | Back alignment and domain information |
|---|
| >PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B | Back alignment and domain information |
|---|
| >PF04908 SH3BGR: SH3-binding, glutamic acid-rich protein; InterPro: IPR006993 This family of proteins, which contains SH3BGRL3, is functionally uncharacterised | Back alignment and domain information |
|---|
| >PF09635 MetRS-N: MetRS-N binding domain; InterPro: IPR018285 This entry represents the N-terminal domain of methionyl-tRNA synthetase (MetRS) | Back alignment and domain information |
|---|
| >PF03960 ArsC: ArsC family; InterPro: IPR006660 Several bacterial taxon have a chromosomal resistance system, encoded by the ars operon, for the detoxification of arsenate, arsenite, and antimonite [] | Back alignment and domain information |
|---|
| >cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains | Back alignment and domain information |
|---|
| >cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains | Back alignment and domain information |
|---|
| >cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif | Back alignment and domain information |
|---|
| >cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD | Back alignment and domain information |
|---|
| >KOG0911 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 212 | ||||
| 1e6b_A | 221 | Crystal Structure Of A Zeta Class Glutathione S-Tra | 9e-84 | ||
| 4igj_A | 242 | Crystal Structure Of Maleylacetoacetate Isomerase F | 1e-46 | ||
| 2cz2_A | 223 | Crystal Structure Of Glutathione Transferase Zeta 1 | 4e-45 | ||
| 1fw1_A | 216 | Glutathione Transferase ZetaMALEYLACETOACETATE ISOM | 6e-45 | ||
| 2v6k_A | 214 | Structure Of Maleyl Pyruvate Isomerase, A Bacterial | 1e-40 | ||
| 2jl4_A | 213 | Holo Structure Of Maleyl Pyruvate Isomerase, A Bact | 1e-40 | ||
| 3lg6_A | 235 | Crystal Structure Of Putative Glutathione Transfera | 7e-34 | ||
| 3niv_A | 222 | The Crystal Structure Of Glutathione S-Transferase | 6e-31 | ||
| 3qav_A | 243 | Crystal Structure Of A Glutathione S-transferase Fr | 1e-17 | ||
| 1ljr_A | 244 | Glutathione Transferase (Hgst T2-2) From Human Leng | 1e-13 | ||
| 4eci_A | 244 | Crystal Structure Of Glutathione S-Transferase Prk1 | 2e-13 | ||
| 4hoj_A | 210 | Crystal Structure Of Glutathione Transferase Homolo | 9e-13 | ||
| 3vwx_A | 222 | Structural Analysis Of An Epsilon-class Glutathione | 7e-12 | ||
| 4hz4_A | 217 | Crystal Structure Of Glutathione S-Transferase B4xh | 9e-12 | ||
| 1aw9_A | 216 | Structure Of Glutathione S-Transferase Iii In Apo F | 1e-11 | ||
| 4j2f_A | 223 | Crystal Structure Of A Glutathione Transferase Fami | 8e-11 | ||
| 2c3n_A | 247 | Human Glutathione-S-Transferase T1-1, Apo Form Leng | 1e-10 | ||
| 2c3q_A | 247 | Human Glutathione-S-Transferase T1-1 W234r Mutant, | 1e-10 | ||
| 4hi7_A | 228 | Crystal Structure Of Glutathione Transferase Homolo | 2e-10 | ||
| 3lyp_A | 215 | Structure Of Stringent Starvation Protein A Homolog | 2e-10 | ||
| 4ivf_A | 231 | Crystal Structure Of Glutathione Transferase Homolo | 2e-10 | ||
| 1pn9_A | 209 | Crystal Structure Of An Insect Delta-class Glutathi | 1e-09 | ||
| 1jlv_A | 209 | Anopheles Dirus Species B Glutathione S-transferase | 1e-09 | ||
| 2vo4_A | 219 | Glutathione Transferase From Glycine Max Length = 2 | 1e-09 | ||
| 3ein_A | 209 | Delta Class Gst Length = 209 | 1e-09 | ||
| 3m3m_A | 210 | Crystal Structure Of Glutathione S-Transferase From | 2e-09 | ||
| 1yy7_A | 213 | Crystal Structure Of Stringent Starvation Protein A | 2e-09 | ||
| 3f6d_A | 219 | Crystal Structure Of A Genetically Modified Delta C | 2e-09 | ||
| 2il3_A | 221 | Structures Of An Insect Epsilon-Class Glutathione S | 2e-09 | ||
| 3g7j_A | 219 | Crystal Structure Of A Genetically Modified Delta C | 2e-09 | ||
| 1jlw_A | 219 | Anopheles Dirus Species B Glutathione S-Transferase | 2e-09 | ||
| 1r5a_A | 218 | Glutathione S-Transferase Length = 218 | 3e-09 | ||
| 3lyk_A | 216 | Structure Of Stringent Starvation Protein A Homolog | 5e-09 | ||
| 3m8n_A | 225 | Crystal Structure Of A Possible Gutathione S-Tranfe | 9e-09 | ||
| 1gnw_A | 211 | Structure Of Glutathione S-Transferase Length = 211 | 1e-08 | ||
| 3ubk_A | 242 | Crystal Structure Of Glutathione Transferase (Targe | 2e-08 | ||
| 3f6f_A | 210 | Crystal Structure Of Glutathione Transferase Dmgstd | 2e-08 | ||
| 3ay8_A | 216 | Glutathione S-Transferase Unclassified 2 From Bomby | 2e-08 | ||
| 3mdk_A | 217 | Structure Of Stringent Starvation Protein A (Sspa) | 2e-08 | ||
| 3uap_A | 227 | Crystal Structure Of Glutathione Transferase (Targe | 5e-08 | ||
| 3vk9_A | 216 | Crystal Structure Of Delta-Class Glutathione Transf | 7e-08 | ||
| 4dej_A | 231 | Crystal Structure Of Glutathione Transferase-Like P | 7e-08 | ||
| 4g9h_A | 211 | Crystal Structure Of Glutahtione S-Transferase Homo | 8e-08 | ||
| 4isd_A | 220 | Crystal Structure Of Glutathione Transferase Homolo | 1e-07 | ||
| 2dsa_A | 203 | Ternary Complex Of Bphk, A Bacterial Gst Length = 2 | 2e-07 | ||
| 2gdr_A | 202 | Crystal Structure Of A Bacterial Glutathione Transf | 2e-07 | ||
| 3vln_A | 241 | Human Glutathione Transferase O1-1 C32s Mutant In C | 3e-07 | ||
| 1gwc_A | 230 | The Structure Of A Tau Class Glutathione S-Transfer | 4e-07 | ||
| 3gx0_A | 215 | Crystal Structure Of Gsh-Dependent Disulfide Bond O | 7e-07 | ||
| 1eem_A | 241 | Glutathione Transferase From Homo Sapiens Length = | 8e-07 | ||
| 1bye_A | 213 | Glutathione S-Transferase I From Mais In Complex Wi | 1e-06 | ||
| 1axd_A | 209 | Structure Of Glutathione S-transferase-i Bound With | 2e-06 | ||
| 1oyj_A | 231 | Crystal Structure Solution Of Rice Gst1 (Osgstu1) I | 2e-06 | ||
| 3bby_A | 215 | Crystal Structure Of Glutathione S-Transferase (Np_ | 2e-06 | ||
| 4iq1_A | 231 | Crystal Structure Of Glutathione S-transferase Mha_ | 4e-06 | ||
| 2nto_A | 201 | Structure Of The Glutathione Transferase From Ochro | 5e-06 | ||
| 4gf0_A | 215 | Crystal Structure Of Glutahtione Transferase Homolo | 6e-06 | ||
| 4hz2_A | 230 | Crystal Structure Of Glutathione S-Transferase Xaut | 8e-06 | ||
| 1f2e_A | 201 | Structure Of Sphingomonad, Glutathione S-Transferas | 1e-05 | ||
| 3c8e_A | 288 | Crystal Structure Analysis Of Yghu From E. Coli Len | 1e-05 | ||
| 3lfl_A | 240 | Crystal Structure Of Human Glutathione Transferase | 2e-05 | ||
| 1g6w_A | 261 | Crystal Structure Of The Globular Region Of The Pri | 3e-05 | ||
| 1jzr_A | 260 | Ure2p In Complex With Glutathione Length = 260 | 3e-05 | ||
| 1hqo_A | 258 | Crystal Structure Of The Nitrogen Regulation Fragme | 3e-05 | ||
| 3lxz_A | 229 | Structure Of Probable Glutathione S-Transferase(Pp0 | 4e-05 | ||
| 4iel_A | 229 | Crystal Structure Of A Glutathione S-Transferase Fa | 7e-05 | ||
| 2pvq_A | 201 | Crystal Structure Of Ochrobactrum Anthropi Glutathi | 8e-05 | ||
| 2pmt_A | 203 | Glutathione Transferase From Proteus Mirabilis Leng | 1e-04 | ||
| 2vct_A | 222 | Glutathione Transferase A2-2 In Complex With Delta- | 4e-04 | ||
| 2x64_A | 207 | Glutathione-S-Transferase From Xylella Fastidiosa L | 4e-04 | ||
| 4acs_A | 222 | Crystal Structure Of Mutant Gst A2-2 With Enhanced | 5e-04 | ||
| 1v2a_A | 210 | Glutathione S-transferase 1-6 From Anopheles Dirus | 6e-04 | ||
| 1ags_A | 221 | A Surface Mutant (G82r) Of A Human Alpha-Glutathion | 7e-04 | ||
| 4g10_A | 265 | Ligg From Sphingobium Sp. Syk-6 Is Related To The G | 8e-04 | ||
| 3qag_A | 239 | Human Glutathione Transferase O2 With Glutathione - | 9e-04 |
| >pdb|1E6B|A Chain A, Crystal Structure Of A Zeta Class Glutathione S-Transferase From Arabidopsis Thaliana Length = 221 | Back alignment and structure |
|
| >pdb|4IGJ|A Chain A, Crystal Structure Of Maleylacetoacetate Isomerase From Anaeromyxobacter Dehalogenans 2cp-1, Target Efi-507175 Length = 242 | Back alignment and structure |
| >pdb|2CZ2|A Chain A, Crystal Structure Of Glutathione Transferase Zeta 1-1 (Maleylacetoacetate Isomerase) From Mus Musculus (Form-1 Crystal) Length = 223 | Back alignment and structure |
| >pdb|1FW1|A Chain A, Glutathione Transferase ZetaMALEYLACETOACETATE ISOMERASE Length = 216 | Back alignment and structure |
| >pdb|2V6K|A Chain A, Structure Of Maleyl Pyruvate Isomerase, A Bacterial Glutathione-s-transferase In Zeta Class, In Complex With Substrate Analogue Dicarboxyethyl Glutathione Length = 214 | Back alignment and structure |
| >pdb|2JL4|A Chain A, Holo Structure Of Maleyl Pyruvate Isomerase, A Bacterial Glutathione-S-Transferase In Zeta Class Length = 213 | Back alignment and structure |
| >pdb|3LG6|A Chain A, Crystal Structure Of Putative Glutathione Transferase From Coccidioides Immitis Length = 235 | Back alignment and structure |
| >pdb|3NIV|A Chain A, The Crystal Structure Of Glutathione S-Transferase From Legionella Pneumophila Length = 222 | Back alignment and structure |
| >pdb|3QAV|A Chain A, Crystal Structure Of A Glutathione S-transferase From Antarctic Clam Laternula Elliptica Length = 243 | Back alignment and structure |
| >pdb|1LJR|A Chain A, Glutathione Transferase (Hgst T2-2) From Human Length = 244 | Back alignment and structure |
| >pdb|4ECI|A Chain A, Crystal Structure Of Glutathione S-Transferase Prk13972 (Target Efi- 501853) From Pseudomonas Aeruginosa Pacs2 Complexed With Acetate Length = 244 | Back alignment and structure |
| >pdb|4HOJ|A Chain A, Crystal Structure Of Glutathione Transferase Homolog From Neisseria Gonorrhoeae, Target Efi-501841, With Bound Glutathione Length = 210 | Back alignment and structure |
| >pdb|3VWX|A Chain A, Structural Analysis Of An Epsilon-class Glutathione S-transferase From Housefly, Musca Domestica Length = 222 | Back alignment and structure |
| >pdb|4HZ4|A Chain A, Crystal Structure Of Glutathione S-Transferase B4xh91 (Target Efi- 501787) From Actinobacillus Pleuropneumoniae Length = 217 | Back alignment and structure |
| >pdb|1AW9|A Chain A, Structure Of Glutathione S-Transferase Iii In Apo Form Length = 216 | Back alignment and structure |
| >pdb|4J2F|A Chain A, Crystal Structure Of A Glutathione Transferase Family Member From Ricinus Communis, Target Efi-501866 Length = 223 | Back alignment and structure |
| >pdb|2C3N|A Chain A, Human Glutathione-S-Transferase T1-1, Apo Form Length = 247 | Back alignment and structure |
| >pdb|2C3Q|A Chain A, Human Glutathione-S-Transferase T1-1 W234r Mutant, Complex With S-Hexylglutathione Length = 247 | Back alignment and structure |
| >pdb|4HI7|A Chain A, Crystal Structure Of Glutathione Transferase Homolog From Drosophilia Mojavensis, Target Efi-501819, With Bound Glutathione Length = 228 | Back alignment and structure |
| >pdb|3LYP|A Chain A, Structure Of Stringent Starvation Protein A Homolog From Pseudomonas Fluorescens Length = 215 | Back alignment and structure |
| >pdb|4IVF|A Chain A, Crystal Structure Of Glutathione Transferase Homolog From Lodderomyces Elongisporus, Target Efi-501753, With Two Gsh Per Subunit Length = 231 | Back alignment and structure |
| >pdb|1PN9|A Chain A, Crystal Structure Of An Insect Delta-class Glutathione S- Transferase From A Ddt-resistant Strain Of The Malaria Vector Anopheles Gambiae Length = 209 | Back alignment and structure |
| >pdb|1JLV|A Chain A, Anopheles Dirus Species B Glutathione S-transferases 1-3 Length = 209 | Back alignment and structure |
| >pdb|2VO4|A Chain A, Glutathione Transferase From Glycine Max Length = 219 | Back alignment and structure |
| >pdb|3EIN|A Chain A, Delta Class Gst Length = 209 | Back alignment and structure |
| >pdb|3M3M|A Chain A, Crystal Structure Of Glutathione S-Transferase From Pseudomonas Fluorescens [pf-5] Length = 210 | Back alignment and structure |
| >pdb|1YY7|A Chain A, Crystal Structure Of Stringent Starvation Protein A (Sspa), An Rna Polymerase-Associated Transcription Factor Length = 213 | Back alignment and structure |
| >pdb|3F6D|A Chain A, Crystal Structure Of A Genetically Modified Delta Class Gst (Adgstd4- 4) From Anopheles Dirus, F123a, In Complex With S-Hexyl Glutathione Length = 219 | Back alignment and structure |
| >pdb|2IL3|A Chain A, Structures Of An Insect Epsilon-Class Glutathione S- Transferase From The Malaria Vector Anopheles Gambiae: Evidence For High Ddt-Detoxifying Activity Length = 221 | Back alignment and structure |
| >pdb|3G7J|A Chain A, Crystal Structure Of A Genetically Modified Delta Class Gst (adgstd4- 4) From Anopheles Dirus, Y119e, In Complex With S-hexyl Glutathione Length = 219 | Back alignment and structure |
| >pdb|1JLW|A Chain A, Anopheles Dirus Species B Glutathione S-Transferases 1-4 Length = 219 | Back alignment and structure |
| >pdb|1R5A|A Chain A, Glutathione S-Transferase Length = 218 | Back alignment and structure |
| >pdb|3LYK|A Chain A, Structure Of Stringent Starvation Protein A Homolog From Haemophilus Influenzae Length = 216 | Back alignment and structure |
| >pdb|3M8N|A Chain A, Crystal Structure Of A Possible Gutathione S-Tranferase From Rhodopseudomonas Palustris Length = 225 | Back alignment and structure |
| >pdb|1GNW|A Chain A, Structure Of Glutathione S-Transferase Length = 211 | Back alignment and structure |
| >pdb|3UBK|A Chain A, Crystal Structure Of Glutathione Transferase (Target Efi-501770) From Leptospira Interrogans Length = 242 | Back alignment and structure |
| >pdb|3F6F|A Chain A, Crystal Structure Of Glutathione Transferase Dmgstd10 From Drosophila Melanogaster Length = 210 | Back alignment and structure |
| >pdb|3AY8|A Chain A, Glutathione S-Transferase Unclassified 2 From Bombyx Mori Length = 216 | Back alignment and structure |
| >pdb|3MDK|A Chain A, Structure Of Stringent Starvation Protein A (Sspa) From Pseudomonas Putida Length = 217 | Back alignment and structure |
| >pdb|3UAP|A Chain A, Crystal Structure Of Glutathione Transferase (Target Efi-501774) From Methylococcus Capsulatus Str. Bath Length = 227 | Back alignment and structure |
| >pdb|3VK9|A Chain A, Crystal Structure Of Delta-Class Glutathione Transferase From Silkmoth Length = 216 | Back alignment and structure |
| >pdb|4DEJ|A Chain A, Crystal Structure Of Glutathione Transferase-Like Protein Il0419 (Target Efi-501089) From Idiomarina Loihiensis L2tr Length = 231 | Back alignment and structure |
| >pdb|4G9H|A Chain A, Crystal Structure Of Glutahtione S-Transferase Homolog From Yersinia Pestis, Target Efi-501894, With Bound Glutathione Length = 211 | Back alignment and structure |
| >pdb|4ISD|A Chain A, Crystal Structure Of Glutathione Transferase Homolog From Burkholderia Gl Bgr1, Target Efi-501803, With Bound Glutathione Length = 220 | Back alignment and structure |
| >pdb|2DSA|A Chain A, Ternary Complex Of Bphk, A Bacterial Gst Length = 203 | Back alignment and structure |
| >pdb|2GDR|A Chain A, Crystal Structure Of A Bacterial Glutathione Transferase Length = 202 | Back alignment and structure |
| >pdb|3VLN|A Chain A, Human Glutathione Transferase O1-1 C32s Mutant In Complex With Ascorbic Acid Length = 241 | Back alignment and structure |
| >pdb|1GWC|A Chain A, The Structure Of A Tau Class Glutathione S-Transferase From Wheat, Active In Herbicide Detoxification Length = 230 | Back alignment and structure |
| >pdb|3GX0|A Chain A, Crystal Structure Of Gsh-Dependent Disulfide Bond Oxidoreductase Length = 215 | Back alignment and structure |
| >pdb|1EEM|A Chain A, Glutathione Transferase From Homo Sapiens Length = 241 | Back alignment and structure |
| >pdb|1BYE|A Chain A, Glutathione S-Transferase I From Mais In Complex With Atrazine Glutathione Conjugate Length = 213 | Back alignment and structure |
| >pdb|1AXD|A Chain A, Structure Of Glutathione S-transferase-i Bound With The Ligand Lactoylglutathione Length = 209 | Back alignment and structure |
| >pdb|1OYJ|A Chain A, Crystal Structure Solution Of Rice Gst1 (Osgstu1) In Complex With Glutathione. Length = 231 | Back alignment and structure |
| >pdb|3BBY|A Chain A, Crystal Structure Of Glutathione S-Transferase (Np_416804.1) From Escherichia Coli K12 At 1.85 A Resolution Length = 215 | Back alignment and structure |
| >pdb|4IQ1|A Chain A, Crystal Structure Of Glutathione S-transferase Mha_0454 (target Efi- 507015) From Mannheimia Haemolytica, Substrate-free Length = 231 | Back alignment and structure |
| >pdb|2NTO|A Chain A, Structure Of The Glutathione Transferase From Ochrobactrum Anthropi In Complex With Glutathione Length = 201 | Back alignment and structure |
| >pdb|4GF0|A Chain A, Crystal Structure Of Glutahtione Transferase Homolog From Sulfitobacter, Target Efi-501084, With Bound Glutathione Length = 215 | Back alignment and structure |
| >pdb|4HZ2|A Chain A, Crystal Structure Of Glutathione S-Transferase Xaut_3756 (Target Efi- 507152) From Xanthobacter Autotrophicus Py2 Length = 230 | Back alignment and structure |
| >pdb|1F2E|A Chain A, Structure Of Sphingomonad, Glutathione S-Transferase Complexed With Glutathione Length = 201 | Back alignment and structure |
| >pdb|3C8E|A Chain A, Crystal Structure Analysis Of Yghu From E. Coli Length = 288 | Back alignment and structure |
| >pdb|3LFL|A Chain A, Crystal Structure Of Human Glutathione Transferase Omega 1, Delta 155 Length = 240 | Back alignment and structure |
| >pdb|1G6W|A Chain A, Crystal Structure Of The Globular Region Of The Prion Protein Ure2 From The Yeast Saccaromyces Cerevisiae Length = 261 | Back alignment and structure |
| >pdb|1JZR|A Chain A, Ure2p In Complex With Glutathione Length = 260 | Back alignment and structure |
| >pdb|1HQO|A Chain A, Crystal Structure Of The Nitrogen Regulation Fragment Of The Yeast Prion Protein Ure2p Length = 258 | Back alignment and structure |
| >pdb|3LXZ|A Chain A, Structure Of Probable Glutathione S-Transferase(Pp0183) From Pseudomonas Putida Length = 229 | Back alignment and structure |
| >pdb|4IEL|A Chain A, Crystal Structure Of A Glutathione S-Transferase Family Protein From Burkholderia Ambifaria, Target Efi-507141, With Bound Glutathione Length = 229 | Back alignment and structure |
| >pdb|2PVQ|A Chain A, Crystal Structure Of Ochrobactrum Anthropi Glutathione Transferase Cys10ala Mutant With Glutathione Bound At The H-Site Length = 201 | Back alignment and structure |
| >pdb|2PMT|A Chain A, Glutathione Transferase From Proteus Mirabilis Length = 203 | Back alignment and structure |
| >pdb|2VCT|A Chain A, Glutathione Transferase A2-2 In Complex With Delta-4- Andostrene-3-17-Dione Length = 222 | Back alignment and structure |
| >pdb|2X64|A Chain A, Glutathione-S-Transferase From Xylella Fastidiosa Length = 207 | Back alignment and structure |
| >pdb|4ACS|A Chain A, Crystal Structure Of Mutant Gst A2-2 With Enhanced Catalytic Efficiency With Azathioprine Length = 222 | Back alignment and structure |
| >pdb|1V2A|A Chain A, Glutathione S-transferase 1-6 From Anopheles Dirus Species B Length = 210 | Back alignment and structure |
| >pdb|1AGS|A Chain A, A Surface Mutant (G82r) Of A Human Alpha-Glutathione S- Transferase Shows Decreased Thermal Stability And A New Mode Of Molecular Association In The Crystal Length = 221 | Back alignment and structure |
| >pdb|4G10|A Chain A, Ligg From Sphingobium Sp. Syk-6 Is Related To The Glutathione Transferase Omega Class Length = 265 | Back alignment and structure |
| >pdb|3QAG|A Chain A, Human Glutathione Transferase O2 With Glutathione -New Crystal Form Length = 239 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 212 | |||
| 1e6b_A | 221 | Glutathione S-transferase; 1.65A {Arabidopsis thal | 1e-107 | |
| 2cz2_A | 223 | Maleylacetoacetate isomerase; structural genomics, | 2e-92 | |
| 2v6k_A | 214 | Maleylpyruvate isomerase; glutathione-S-transferas | 6e-91 | |
| 3n5o_A | 235 | Glutathione transferase; seattle structural genomi | 1e-87 | |
| 3niv_A | 222 | Glutathione S-transferase; structural genomics, PS | 1e-87 | |
| 3qav_A | 243 | RHO-class glutathione S-transferase; cytosol; 2.10 | 7e-79 | |
| 3lxz_A | 229 | Glutathione S-transferase family protein; structur | 9e-69 | |
| 3bby_A | 215 | Uncharacterized GST-like protein YFCF; NP_416804.1 | 3e-64 | |
| 3lyp_A | 215 | Stringent starvation protein A; structural genomic | 2e-60 | |
| 3lyk_A | 216 | Stringent starvation protein A homolog; structural | 9e-60 | |
| 2imi_A | 221 | Epsilon-class glutathione S-transferase; HET: GSH; | 1e-59 | |
| 3cbu_A | 214 | Probable GST-related protein; thioredoxin fold, GS | 5e-57 | |
| 2vo4_A | 219 | 2,4-D inducible glutathione S-transferase; herbici | 4e-55 | |
| 1yy7_A | 213 | SSPA, stringent starvation protein A; GST fold, tr | 2e-53 | |
| 3ubk_A | 242 | Glutathione transferase; GSH binding; 1.95A {Lepto | 4e-53 | |
| 1gwc_A | 230 | Glutathione S-transferase TSI-1; herbicide detoxif | 5e-53 | |
| 3vln_A | 241 | GSTO-1, glutathione S-transferase omega-1; GST fol | 7e-53 | |
| 4dej_A | 231 | Glutathione S-transferase related protein; transfe | 6e-52 | |
| 1gnw_A | 211 | Glutathione S-transferase; herbicide detoxificatio | 3e-48 | |
| 3ibh_A | 233 | GST-II, saccharomyces cerevisiae GTT2; glutathione | 2e-47 | |
| 1axd_A | 209 | Glutathione S-transferase I; transferase, herbicid | 3e-47 | |
| 3ay8_A | 216 | Glutathione S-transferase; GST fold, GST binding, | 5e-46 | |
| 3q18_A | 239 | GSTO-2, glutathione S-transferase omega-2; glutath | 1e-45 | |
| 1oyj_A | 231 | Glutathione S-transferase; herbicide detoxificatio | 1e-45 | |
| 2dsa_A | 203 | Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu | 1e-44 | |
| 1ljr_A | 244 | HGST T2-2, glutathione S-transferase; HET: GSH; 3. | 2e-44 | |
| 2x64_A | 207 | Glutathione-S-transferase; detoxification enzyme; | 8e-44 | |
| 3rbt_A | 246 | Glutathione transferase O1; glutathione S-transfer | 3e-43 | |
| 2c3n_A | 247 | Glutathione S-transferase theta 1; glutathione tra | 4e-43 | |
| 4g9h_A | 211 | Glutathione S-transferase; GST, enzyme function in | 2e-42 | |
| 1aw9_A | 216 | Glutathione S-transferase III; herbicide detoxific | 3e-42 | |
| 1pmt_A | 203 | PMGST, GST B1-1, glutathione transferase; glutathi | 1e-41 | |
| 1n2a_A | 201 | Glutathione S-transferase; HET: GTS; 1.90A {Escher | 2e-41 | |
| 1r5a_A | 218 | Glutathione transferase; glutathione S-transferase | 3e-41 | |
| 3tou_A | 226 | Glutathione S-transferase protein; GSH binding sit | 2e-40 | |
| 3ein_A | 209 | GST class-theta, glutathione S-transferase 1-1; de | 8e-40 | |
| 1v2a_A | 210 | Glutathione transferase GST1-6; glutathione S-tran | 5e-39 | |
| 3m8n_A | 225 | Possible glutathione S-transferase; PSI-II, struct | 3e-38 | |
| 2pvq_A | 201 | Glutathione S-transferase; xenobiotics detoxificat | 3e-37 | |
| 1pn9_A | 209 | GST class-delta, glutathione S-transferase 1-6; pr | 4e-37 | |
| 3lsz_A | 225 | Glutathione S-transferase; xenobiotic, biodegradat | 5e-37 | |
| 1f2e_A | 201 | Glutathione S-transferase; GST complexed with glut | 4e-36 | |
| 3uar_A | 227 | Glutathione S-transferase; GSH binding site; HET: | 1e-35 | |
| 3r2q_A | 202 | Uncharacterized GST-like protein YIBF; transferase | 2e-35 | |
| 2ahe_A | 267 | Chloride intracellular channel protein 4; glutathi | 2e-35 | |
| 3f6d_A | 219 | Adgstd4-4, glutathione transferase GST1-4; HET: GT | 2e-34 | |
| 3m0f_A | 213 | Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu | 3e-34 | |
| 3m3m_A | 210 | Glutathione S-transferase; PSI-II, structural geno | 1e-32 | |
| 1k0m_A | 241 | CLIC1, NCC27, chloride intracellular channel prote | 1e-32 | |
| 2r4v_A | 247 | XAP121, chloride intracellular channel protein 2; | 6e-32 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 9e-31 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 4e-28 | |
| 2ycd_A | 230 | Glutathione S-transferase; SOIL bacteria, herbicid | 1e-30 | |
| 3fy7_A | 250 | Chloride intracellular channel protein 3; GST, glu | 1e-30 | |
| 1yq1_A | 208 | Glutathione S-transferase; nematoda, structural ge | 4e-28 | |
| 2yv7_A | 260 | CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c | 4e-28 | |
| 1k3y_A | 221 | GSTA1-1, glutathione S-transferase A1; S-hexyl glu | 1e-27 | |
| 1nhy_A | 219 | EF-1-gamma 1, elongation factor 1-gamma 1; protein | 2e-26 | |
| 4exj_A | 238 | Uncharacterized protein; transferase-like protein, | 2e-26 | |
| 3ik7_A | 222 | Glutathione S-transferase A4; human GST A4-4, enzy | 1e-25 | |
| 1vf1_A | 229 | Glutathione S-transferase 3; detoxification; HET: | 2e-25 | |
| 3ic8_A | 310 | Uncharacterized GST-like proteinprotein; glutathio | 1e-23 | |
| 1b48_A | 221 | GST, mgsta4-4, protein (glutathione S-transferase) | 7e-22 | |
| 1k0d_A | 260 | URE2 protein; nitrate assimilation, structural gen | 7e-21 | |
| 2fno_A | 248 | AGR_PAT_752P; thioredoxin fold, GST C-terminal dom | 4e-20 | |
| 2uz8_A | 174 | Eukaryotic translation elongation factor 1 epsilon | 4e-20 | |
| 3gx0_A | 215 | GST-like protein YFCG; transferase, glutathione, g | 1e-19 | |
| 2hnl_A | 225 | Glutathione S-transferase 1; prostaglandin synthas | 1e-19 | |
| 4ecj_A | 244 | Glutathione S-transferase; transferase-like protei | 2e-19 | |
| 2yv9_A | 291 | Chloride intracellular channel EXC-4; chloride ION | 5e-19 | |
| 3c8e_A | 288 | YGHU, glutathione S-transferase homologue; glutath | 1e-18 | |
| 3ir4_A | 218 | Glutaredoxin 2; glutathione, IDP00895, structural | 5e-18 | |
| 2on5_A | 206 | Nagst-2, Na glutathione S-transferase 2; hookworm; | 2e-17 | |
| 3h1n_A | 252 | Probable glutathione S-transferase; APC84167, bord | 2e-17 | |
| 1tw9_A | 206 | Glutathione S-transferase 2; 1.71A {Heligmosomoide | 6e-17 | |
| 3iso_A | 218 | Putative glutathione transferase; GST; HET: GSH; 1 | 7e-17 | |
| 2on7_A | 206 | Nagst-1, Na glutathione S-transferase 1; hookworm; | 1e-16 | |
| 2ws2_A | 204 | NU-class GST, glutathione S-transferase; parasite, | 2e-16 | |
| 2gsq_A | 202 | Squid GST, glutathione S-transferase; squid digest | 8e-16 | |
| 1m0u_A | 249 | GST2 gene product; flight muscle protein, sigma, t | 1e-15 | |
| 1zl9_A | 207 | GST class-sigma, glutathione S-transferase 5; glut | 2e-15 | |
| 1dug_A | 234 | Chimera of glutathione S-transferase-synthetic lin | 4e-15 | |
| 2fhe_A | 216 | GST, glutathione S-transferase; transferase-substr | 5e-15 | |
| 1bg5_A | 254 | MAB, fusion protein of alpha-Na,K-ATPase with glut | 6e-15 | |
| 2cvd_A | 198 | Glutathione-requiring prostaglandin D synthase; gl | 7e-15 | |
| 1b8x_A | 280 | Protein (AML-1B); nuclear matrix targeting signal | 8e-15 | |
| 1tu7_A | 208 | Glutathione S-transferase 2; HET: GSH; 1.50A {Onch | 3e-14 | |
| 1okt_A | 211 | Glutathione S-transferase; GST; 1.9A {Plasmodium f | 1e-13 | |
| 2a2r_A | 210 | Glutathione S-transferase P; detoxification, nitri | 4e-13 | |
| 1gsu_A | 219 | GST, CGSTM1-1, class-MU glutathione S-transferase; | 8e-13 | |
| 2c4j_A | 218 | Glutathione S-transferase MU 2; glutathione transf | 1e-12 | |
| 3gtu_B | 224 | Glutathione S-transferase; conjugation, detoxifica | 1e-12 | |
| 1oe8_A | 211 | Glutathione S-transferase; schistosomiasis, detoxi | 1e-11 | |
| 2wb9_A | 211 | Glutathione transferase sigma class; thioredoxin f | 1e-11 | |
| 1z9h_A | 290 | Membrane-associated prostaglandin E synthase-2; me | 4e-10 |
| >1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Length = 221 | Back alignment and structure |
|---|
Score = 305 bits (784), Expect = e-107
Identities = 140/212 (66%), Positives = 176/212 (83%)
Query: 1 MLKLFSYWRSSCSHRVRIGLNLKGLEYEYKAVNLVKGEQFSPDFLKINPIGYVPALVDGD 60
LKL+SYWRSSC+HRVRI L LKGL+YEY VNL+KG+QF DF KINP+G VPALVDGD
Sbjct: 8 KLKLYSYWRSSCAHRVRIALALKGLDYEYIPVNLLKGDQFDSDFKKINPMGTVPALVDGD 67
Query: 61 FVVSDSFAILMYLEEKYPQPPLLPSDLKRKAINYQAANIVSSSIQPLQNLAVVKYIEEKA 120
V++DSFAI+MYL+EKYP+PPLLP DL ++A+NYQA +IV S IQP QNLAV++YIEEK
Sbjct: 68 VVINDSFAIIMYLDEKYPEPPLLPRDLHKRAVNYQAMSIVLSGIQPHQNLAVIRYIEEKI 127
Query: 121 GADERDIWAKTHIGKGFAALEKLLKDYAGKYATGDEVFLADLYLAPQLYAAVNRFNLDMT 180
+E+ W I KGF ALEKLL + AGK+ATGDE++LADL+LAPQ++ A+NRF ++M
Sbjct: 128 NVEEKTAWVNNAITKGFTALEKLLVNCAGKHATGDEIYLADLFLAPQIHGAINRFQINME 187
Query: 181 QFPLLLRLHEAYSKLPAFQNAVPEKQPDAPSS 212
+P L + +E+Y++LPAFQNA+PEKQPDAPSS
Sbjct: 188 PYPTLAKCYESYNELPAFQNALPEKQPDAPSS 219
|
| >2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Length = 223 | Back alignment and structure |
|---|
| >2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Length = 214 | Back alignment and structure |
|---|
| >3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Length = 235 | Back alignment and structure |
|---|
| >3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Length = 222 | Back alignment and structure |
|---|
| >3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Length = 243 | Back alignment and structure |
|---|
| >3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Length = 229 | Back alignment and structure |
|---|
| >3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Length = 215 | Back alignment and structure |
|---|
| >3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Length = 215 | Back alignment and structure |
|---|
| >3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Length = 216 | Back alignment and structure |
|---|
| >2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Length = 221 | Back alignment and structure |
|---|
| >3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Length = 214 | Back alignment and structure |
|---|
| >2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Length = 219 | Back alignment and structure |
|---|
| >1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Length = 213 | Back alignment and structure |
|---|
| >3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Length = 242 | Back alignment and structure |
|---|
| >1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Length = 230 | Back alignment and structure |
|---|
| >3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Length = 241 | Back alignment and structure |
|---|
| >4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Length = 231 | Back alignment and structure |
|---|
| >1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Length = 211 | Back alignment and structure |
|---|
| >3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Length = 233 | Back alignment and structure |
|---|
| >1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Length = 209 | Back alignment and structure |
|---|
| >3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Length = 216 | Back alignment and structure |
|---|
| >3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Length = 239 | Back alignment and structure |
|---|
| >1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Length = 231 | Back alignment and structure |
|---|
| >2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Length = 203 | Back alignment and structure |
|---|
| >1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Length = 244 | Back alignment and structure |
|---|
| >2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Length = 207 | Back alignment and structure |
|---|
| >3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Length = 246 | Back alignment and structure |
|---|
| >2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Length = 247 | Back alignment and structure |
|---|
| >4g9h_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 2.10A {Yersinia pestis} Length = 211 | Back alignment and structure |
|---|
| >1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Length = 216 | Back alignment and structure |
|---|
| >1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Length = 203 | Back alignment and structure |
|---|
| >1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Length = 201 | Back alignment and structure |
|---|
| >1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Length = 218 | Back alignment and structure |
|---|
| >3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Length = 226 | Back alignment and structure |
|---|
| >3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Length = 209 | Back alignment and structure |
|---|
| >1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Length = 210 | Back alignment and structure |
|---|
| >3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Length = 225 | Back alignment and structure |
|---|
| >2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Length = 201 | Back alignment and structure |
|---|
| >1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Length = 209 | Back alignment and structure |
|---|
| >3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Length = 225 | Back alignment and structure |
|---|
| >1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Length = 201 | Back alignment and structure |
|---|
| >3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Length = 227 | Back alignment and structure |
|---|
| >3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Length = 202 | Back alignment and structure |
|---|
| >2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Length = 267 | Back alignment and structure |
|---|
| >3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Length = 219 | Back alignment and structure |
|---|
| >3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Length = 213 | Back alignment and structure |
|---|
| >3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Length = 210 | Back alignment and structure |
|---|
| >1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Length = 241 | Back alignment and structure |
|---|
| >2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Length = 247 | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 | Back alignment and structure |
|---|
| >2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Length = 230 | Back alignment and structure |
|---|
| >3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Length = 250 | Back alignment and structure |
|---|
| >1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Length = 208 | Back alignment and structure |
|---|
| >2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Length = 260 | Back alignment and structure |
|---|
| >1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Length = 221 | Back alignment and structure |
|---|
| >1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Length = 219 | Back alignment and structure |
|---|
| >4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Length = 238 | Back alignment and structure |
|---|
| >3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Length = 222 | Back alignment and structure |
|---|
| >1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Length = 229 | Back alignment and structure |
|---|
| >3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Length = 310 | Back alignment and structure |
|---|
| >1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Length = 221 | Back alignment and structure |
|---|
| >1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Length = 260 | Back alignment and structure |
|---|
| >2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Length = 248 | Back alignment and structure |
|---|
| >2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Length = 174 | Back alignment and structure |
|---|
| >3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Length = 215 | Back alignment and structure |
|---|
| >2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Length = 225 | Back alignment and structure |
|---|
| >4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Length = 244 | Back alignment and structure |
|---|
| >2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Length = 291 | Back alignment and structure |
|---|
| >3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Length = 288 | Back alignment and structure |
|---|
| >3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Length = 218 | Back alignment and structure |
|---|
| >2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Length = 206 | Back alignment and structure |
|---|
| >3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Length = 252 | Back alignment and structure |
|---|
| >1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Length = 206 | Back alignment and structure |
|---|
| >3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Length = 218 | Back alignment and structure |
|---|
| >2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Length = 206 | Back alignment and structure |
|---|
| >2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Length = 204 | Back alignment and structure |
|---|
| >2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Length = 202 | Back alignment and structure |
|---|
| >1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Length = 249 | Back alignment and structure |
|---|
| >1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Length = 207 | Back alignment and structure |
|---|
| >1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Length = 234 | Back alignment and structure |
|---|
| >2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Length = 216 | Back alignment and structure |
|---|
| >1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Length = 254 | Back alignment and structure |
|---|
| >2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Length = 198 | Back alignment and structure |
|---|
| >1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Length = 280 | Back alignment and structure |
|---|
| >1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Length = 208 | Back alignment and structure |
|---|
| >1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Length = 211 | Back alignment and structure |
|---|
| >2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Length = 210 | Back alignment and structure |
|---|
| >1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Length = 219 | Back alignment and structure |
|---|
| >2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Length = 218 | Back alignment and structure |
|---|
| >3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Length = 224 | Back alignment and structure |
|---|
| >1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Length = 211 | Back alignment and structure |
|---|
| >2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Length = 211 | Back alignment and structure |
|---|
| >1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Length = 290 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 212 | |||
| 1e6b_A | 221 | Glutathione S-transferase; 1.65A {Arabidopsis thal | 100.0 | |
| 4glt_A | 225 | Glutathione S-transferase-like protein; structural | 100.0 | |
| 2cz2_A | 223 | Maleylacetoacetate isomerase; structural genomics, | 100.0 | |
| 4iel_A | 229 | Glutathione S-transferase, N-terminal domain PROT; | 100.0 | |
| 4gf0_A | 215 | Glutathione S-transferase; GST, enzyme function in | 100.0 | |
| 3niv_A | 222 | Glutathione S-transferase; structural genomics, PS | 100.0 | |
| 3n5o_A | 235 | Glutathione transferase; seattle structural genomi | 100.0 | |
| 2v6k_A | 214 | Maleylpyruvate isomerase; glutathione-S-transferas | 100.0 | |
| 4hoj_A | 210 | REGF protein; GST, glutathione S-transferase, enzy | 100.0 | |
| 4hi7_A | 228 | GI20122; GST, glutathione S-transferase, enzyme fu | 100.0 | |
| 3qav_A | 243 | RHO-class glutathione S-transferase; cytosol; 2.10 | 100.0 | |
| 3vk9_A | 216 | Glutathione S-transferase delta; glutathione bindi | 100.0 | |
| 4gci_A | 211 | Glutathione S-transferase; GST, enzyme function in | 100.0 | |
| 3gx0_A | 215 | GST-like protein YFCG; transferase, glutathione, g | 100.0 | |
| 3lyk_A | 216 | Stringent starvation protein A homolog; structural | 100.0 | |
| 3ein_A | 209 | GST class-theta, glutathione S-transferase 1-1; de | 100.0 | |
| 3tou_A | 226 | Glutathione S-transferase protein; GSH binding sit | 100.0 | |
| 3m3m_A | 210 | Glutathione S-transferase; PSI-II, structural geno | 100.0 | |
| 1gnw_A | 211 | Glutathione S-transferase; herbicide detoxificatio | 100.0 | |
| 4hz2_A | 230 | Glutathione S-transferase domain; glutathione,enzy | 100.0 | |
| 3ibh_A | 233 | GST-II, saccharomyces cerevisiae GTT2; glutathione | 100.0 | |
| 1axd_A | 209 | Glutathione S-transferase I; transferase, herbicid | 100.0 | |
| 3r2q_A | 202 | Uncharacterized GST-like protein YIBF; transferase | 100.0 | |
| 3lsz_A | 225 | Glutathione S-transferase; xenobiotic, biodegradat | 100.0 | |
| 3m0f_A | 213 | Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu | 100.0 | |
| 1aw9_A | 216 | Glutathione S-transferase III; herbicide detoxific | 100.0 | |
| 4ecj_A | 244 | Glutathione S-transferase; transferase-like protei | 100.0 | |
| 3lyp_A | 215 | Stringent starvation protein A; structural genomic | 100.0 | |
| 3m8n_A | 225 | Possible glutathione S-transferase; PSI-II, struct | 100.0 | |
| 3ay8_A | 216 | Glutathione S-transferase; GST fold, GST binding, | 100.0 | |
| 2x64_A | 207 | Glutathione-S-transferase; detoxification enzyme; | 100.0 | |
| 1r5a_A | 218 | Glutathione transferase; glutathione S-transferase | 100.0 | |
| 4hz4_A | 217 | Glutathione-S-transferase; enzyme function initiat | 100.0 | |
| 3q18_A | 239 | GSTO-2, glutathione S-transferase omega-2; glutath | 100.0 | |
| 1yy7_A | 213 | SSPA, stringent starvation protein A; GST fold, tr | 100.0 | |
| 3lxz_A | 229 | Glutathione S-transferase family protein; structur | 100.0 | |
| 4ikh_A | 244 | Glutathione S-transferase; enzyme function initiat | 100.0 | |
| 4id0_A | 214 | Glutathione S-transferase-like protein YIBF; GST, | 100.0 | |
| 3cbu_A | 214 | Probable GST-related protein; thioredoxin fold, GS | 100.0 | |
| 4exj_A | 238 | Uncharacterized protein; transferase-like protein, | 100.0 | |
| 2imi_A | 221 | Epsilon-class glutathione S-transferase; HET: GSH; | 100.0 | |
| 1pn9_A | 209 | GST class-delta, glutathione S-transferase 1-6; pr | 100.0 | |
| 4dej_A | 231 | Glutathione S-transferase related protein; transfe | 100.0 | |
| 3vln_A | 241 | GSTO-1, glutathione S-transferase omega-1; GST fol | 100.0 | |
| 3f6d_A | 219 | Adgstd4-4, glutathione transferase GST1-4; HET: GT | 100.0 | |
| 1n2a_A | 201 | Glutathione S-transferase; HET: GTS; 1.90A {Escher | 100.0 | |
| 1v2a_A | 210 | Glutathione transferase GST1-6; glutathione S-tran | 100.0 | |
| 1yq1_A | 208 | Glutathione S-transferase; nematoda, structural ge | 100.0 | |
| 1zl9_A | 207 | GST class-sigma, glutathione S-transferase 5; glut | 100.0 | |
| 3uar_A | 227 | Glutathione S-transferase; GSH binding site; HET: | 100.0 | |
| 2pvq_A | 201 | Glutathione S-transferase; xenobiotics detoxificat | 100.0 | |
| 1ljr_A | 244 | HGST T2-2, glutathione S-transferase; HET: GSH; 3. | 100.0 | |
| 3ubk_A | 242 | Glutathione transferase; GSH binding; 1.95A {Lepto | 100.0 | |
| 2dsa_A | 203 | Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu | 100.0 | |
| 3bby_A | 215 | Uncharacterized GST-like protein YFCF; NP_416804.1 | 100.0 | |
| 2gsq_A | 202 | Squid GST, glutathione S-transferase; squid digest | 100.0 | |
| 1f2e_A | 201 | Glutathione S-transferase; GST complexed with glut | 100.0 | |
| 2on5_A | 206 | Nagst-2, Na glutathione S-transferase 2; hookworm; | 100.0 | |
| 1pmt_A | 203 | PMGST, GST B1-1, glutathione transferase; glutathi | 100.0 | |
| 1k0d_A | 260 | URE2 protein; nitrate assimilation, structural gen | 100.0 | |
| 2on7_A | 206 | Nagst-1, Na glutathione S-transferase 1; hookworm; | 100.0 | |
| 1gwc_A | 230 | Glutathione S-transferase TSI-1; herbicide detoxif | 100.0 | |
| 1k3y_A | 221 | GSTA1-1, glutathione S-transferase A1; S-hexyl glu | 100.0 | |
| 1tw9_A | 206 | Glutathione S-transferase 2; 1.71A {Heligmosomoide | 100.0 | |
| 4g10_A | 265 | Glutathione S-transferase homolog; thioredoxin fol | 100.0 | |
| 2cvd_A | 198 | Glutathione-requiring prostaglandin D synthase; gl | 100.0 | |
| 3rbt_A | 246 | Glutathione transferase O1; glutathione S-transfer | 100.0 | |
| 1b48_A | 221 | GST, mgsta4-4, protein (glutathione S-transferase) | 100.0 | |
| 2hnl_A | 225 | Glutathione S-transferase 1; prostaglandin synthas | 100.0 | |
| 3iso_A | 218 | Putative glutathione transferase; GST; HET: GSH; 1 | 100.0 | |
| 2wb9_A | 211 | Glutathione transferase sigma class; thioredoxin f | 100.0 | |
| 2vo4_A | 219 | 2,4-D inducible glutathione S-transferase; herbici | 100.0 | |
| 1vf1_A | 229 | Glutathione S-transferase 3; detoxification; HET: | 100.0 | |
| 1okt_A | 211 | Glutathione S-transferase; GST; 1.9A {Plasmodium f | 100.0 | |
| 1gsu_A | 219 | GST, CGSTM1-1, class-MU glutathione S-transferase; | 100.0 | |
| 3ik7_A | 222 | Glutathione S-transferase A4; human GST A4-4, enzy | 100.0 | |
| 1nhy_A | 219 | EF-1-gamma 1, elongation factor 1-gamma 1; protein | 100.0 | |
| 3gtu_B | 224 | Glutathione S-transferase; conjugation, detoxifica | 100.0 | |
| 1m0u_A | 249 | GST2 gene product; flight muscle protein, sigma, t | 100.0 | |
| 2ycd_A | 230 | Glutathione S-transferase; SOIL bacteria, herbicid | 100.0 | |
| 1tu7_A | 208 | Glutathione S-transferase 2; HET: GSH; 1.50A {Onch | 100.0 | |
| 2c3n_A | 247 | Glutathione S-transferase theta 1; glutathione tra | 100.0 | |
| 2c4j_A | 218 | Glutathione S-transferase MU 2; glutathione transf | 100.0 | |
| 1oyj_A | 231 | Glutathione S-transferase; herbicide detoxificatio | 100.0 | |
| 2ws2_A | 204 | NU-class GST, glutathione S-transferase; parasite, | 100.0 | |
| 2a2r_A | 210 | Glutathione S-transferase P; detoxification, nitri | 100.0 | |
| 2fhe_A | 216 | GST, glutathione S-transferase; transferase-substr | 100.0 | |
| 3c8e_A | 288 | YGHU, glutathione S-transferase homologue; glutath | 100.0 | |
| 1oe8_A | 211 | Glutathione S-transferase; schistosomiasis, detoxi | 100.0 | |
| 3h1n_A | 252 | Probable glutathione S-transferase; APC84167, bord | 100.0 | |
| 1dug_A | 234 | Chimera of glutathione S-transferase-synthetic lin | 100.0 | |
| 1k0m_A | 241 | CLIC1, NCC27, chloride intracellular channel prote | 100.0 | |
| 1b8x_A | 280 | Protein (AML-1B); nuclear matrix targeting signal | 100.0 | |
| 2r4v_A | 247 | XAP121, chloride intracellular channel protein 2; | 100.0 | |
| 2ahe_A | 267 | Chloride intracellular channel protein 4; glutathi | 100.0 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 100.0 | |
| 3ir4_A | 218 | Glutaredoxin 2; glutathione, IDP00895, structural | 100.0 | |
| 3ic8_A | 310 | Uncharacterized GST-like proteinprotein; glutathio | 100.0 | |
| 2fno_A | 248 | AGR_PAT_752P; thioredoxin fold, GST C-terminal dom | 100.0 | |
| 3fy7_A | 250 | Chloride intracellular channel protein 3; GST, glu | 100.0 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 100.0 | |
| 2yv7_A | 260 | CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c | 100.0 | |
| 1bg5_A | 254 | MAB, fusion protein of alpha-Na,K-ATPase with glut | 100.0 | |
| 2yv9_A | 291 | Chloride intracellular channel EXC-4; chloride ION | 100.0 | |
| 3m1g_A | 362 | Putative glutathione S-transferase; ECM4-like subf | 99.98 | |
| 4f03_A | 253 | Glutathione transferase; GST fold; 1.80A {Phaneroc | 99.97 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 99.97 | |
| 3ppu_A | 352 | Glutathione-S-transferase; GST fold; HET: GSH; 2.3 | 99.97 | |
| 1z9h_A | 290 | Membrane-associated prostaglandin E synthase-2; me | 99.96 | |
| 2uz8_A | 174 | Eukaryotic translation elongation factor 1 epsilon | 99.96 | |
| 4fqu_A | 313 | Putative glutathione transferase; glutathionyl-hyd | 99.95 | |
| 4g0i_A | 328 | Protein YQJG; glutathionyl-hydroquinone reductase, | 99.95 | |
| 2hra_A | 209 | Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l | 99.93 | |
| 2hsn_A | 160 | Methionyl-tRNA synthetase, cytoplasmic; protein co | 99.84 | |
| 2hqt_A | 124 | GU4 nucleic-binding protein 1; GST-fold, biosynthe | 99.36 | |
| 3msz_A | 89 | Glutaredoxin 1; alpha-beta sandwich, center for st | 99.2 | |
| 1fov_A | 82 | Glutaredoxin 3, GRX3; active site disulfide, CIS P | 99.17 | |
| 2khp_A | 92 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 98.98 | |
| 2klx_A | 89 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 98.96 | |
| 1aba_A | 87 | Glutaredoxin; electron transport; HET: MES; 1.45A | 98.81 | |
| 2lqo_A | 92 | Putative glutaredoxin RV3198.1/MT3292; TRX fold, o | 98.75 | |
| 1nm3_A | 241 | Protein HI0572; hybrid, peroxiredoxin, glutaredoxi | 98.74 | |
| 3qmx_A | 99 | Glutaredoxin A, glutaredoxin 3; electron transport | 98.72 | |
| 3ic4_A | 92 | Glutaredoxin (GRX-1); structural genomics, PSI, MC | 98.72 | |
| 1r7h_A | 75 | NRDH-redoxin; thioredoxin, glutaredoxin, redox pro | 98.62 | |
| 3nzn_A | 103 | Glutaredoxin; structural genomics, PSI2, MCSG, pro | 98.42 | |
| 1t1v_A | 93 | SH3BGRL3, SH3 domain-binding glutamic acid-rich pr | 98.39 | |
| 3rhb_A | 113 | ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox | 98.36 | |
| 2cq9_A | 130 | GLRX2 protein, glutaredoxin 2; glutathione-S-trans | 98.29 | |
| 3h8q_A | 114 | Thioredoxin reductase 3; oxidoreductase, structura | 98.29 | |
| 2ct6_A | 111 | SH3 domain-binding glutamic acid-rich-like protein | 98.22 | |
| 1wik_A | 109 | Thioredoxin-like protein 2; picot homology 2 domai | 98.21 | |
| 3zyw_A | 111 | Glutaredoxin-3; metal binding protein; 1.84A {Homo | 98.19 | |
| 1ego_A | 85 | Glutaredoxin; electron transport; NMR {Escherichia | 98.18 | |
| 2ht9_A | 146 | Glutaredoxin-2; thioredoxin fold, iron-sulfur clus | 98.17 | |
| 1kte_A | 105 | Thioltransferase; redox-active center, electron tr | 98.17 | |
| 2yan_A | 105 | Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H | 98.13 | |
| 3ctg_A | 129 | Glutaredoxin-2; reduced form, electron transport, | 98.13 | |
| 3ipz_A | 109 | Monothiol glutaredoxin-S14, chloroplastic; electro | 98.11 | |
| 3c1r_A | 118 | Glutaredoxin-1; oxidized form, oxidoreductase, cyt | 98.1 | |
| 2wci_A | 135 | Glutaredoxin-4; redox-active center, iron-sulfur c | 98.04 | |
| 2hze_A | 114 | Glutaredoxin-1; thioredoxin fold, arsenic, dimethy | 98.04 | |
| 1h75_A | 81 | Glutaredoxin-like protein NRDH; electron transport | 98.02 | |
| 1u6t_A | 121 | SH3 domain-binding glutamic acid-rich-like protein | 98.02 | |
| 1z3e_A | 132 | Regulatory protein SPX; bacterial transcription re | 97.95 | |
| 2wem_A | 118 | Glutaredoxin-related protein 5; chromosome 14 open | 97.88 | |
| 3l4n_A | 127 | Monothiol glutaredoxin-6; C-terminal domain of GRX | 97.87 | |
| 2kok_A | 120 | Arsenate reductase; brucellosis, zoonotic, oxidore | 97.83 | |
| 3gx8_A | 121 | Monothiol glutaredoxin-5, mitochondrial; TRX fold, | 97.82 | |
| 1ttz_A | 87 | Conserved hypothetical protein; structural genomic | 97.6 | |
| 3l78_A | 120 | Regulatory protein SPX; transcription, transcripti | 97.51 | |
| 2fgx_A | 107 | Putative thioredoxin; NET3, NESG, GFT-glutaredoxin | 97.47 | |
| 3fz4_A | 120 | Putative arsenate reductase; APC61768, structural | 97.41 | |
| 3gkx_A | 120 | Putative ARSC family related protein; ARSC family | 97.19 | |
| 1rw1_A | 114 | Conserved hypothetical protein YFFB; thioredoxin f | 97.16 | |
| 3f0i_A | 119 | Arsenate reductase; structural genomics, IDP01300, | 97.11 | |
| 2wul_A | 118 | Glutaredoxin related protein 5; chromosome 14 open | 97.07 | |
| 1s3c_A | 141 | Arsenate reductase; ARSC, arsenite, oxidoreductase | 96.95 | |
| 3rdw_A | 121 | Putative arsenate reductase; structural genomics, | 96.92 | |
| 1wjk_A | 100 | C330018D20RIK protein; glutaredoxin, thioredoxin f | 96.9 | |
| 2jad_A | 362 | Yellow fluorescent protein glutaredoxin fusion pro | 96.87 | |
| 2k8s_A | 80 | Thioredoxin; dimer, structural genomics, PSI-2, pr | 96.86 | |
| 2e7p_A | 116 | Glutaredoxin; thioredoxin fold, poplar, electron t | 96.74 | |
| 2x8g_A | 598 | Thioredoxin glutathione reductase; redox-active ce | 96.55 | |
| 2axo_A | 270 | Hypothetical protein ATU2684; alpha beta protein., | 94.19 | |
| 3kp8_A | 106 | Vkorc1/thioredoxin domain protein; blood coagulati | 89.97 | |
| 1nho_A | 85 | Probable thioredoxin; beta sheet, alpha helix, oxi | 88.21 | |
| 1ilo_A | 77 | Conserved hypothetical protein MTH895; beta-alpha- | 87.43 | |
| 1fo5_A | 85 | Thioredoxin; disulfide oxidoreductase, structural | 86.92 | |
| 2hls_A | 243 | Protein disulfide oxidoreductase; thioredoxin fold | 85.6 | |
| 1gh2_A | 107 | Thioredoxin-like protein; redox-active center, ele | 82.77 | |
| 2wz9_A | 153 | Glutaredoxin-3; protein binding; 1.55A {Homo sapie | 82.0 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 81.5 | |
| 2l6c_A | 110 | Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu | 81.2 | |
| 3kp9_A | 291 | Vkorc1/thioredoxin domain protein; warfarin, disul | 81.05 |
| >1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
Probab=100.00 E-value=8e-44 Score=264.34 Aligned_cols=211 Identities=65% Similarity=1.104 Sum_probs=173.3
Q ss_pred CeeecccCCCchhHHHHHHHHHcCCceeEEEeecCCCCCCChhhhhcCCCcccceEeeCCeeeeeHHHHHHHHHHhCCCC
Q 028226 1 MLKLFSYWRSSCSHRVRIGLNLKGLEYEYKAVNLVKGEQFSPDFLKINPIGYVPALVDGDFVVSDSFAILMYLEEKYPQP 80 (212)
Q Consensus 1 m~~Ly~~~~s~~~~~vr~~l~~~~i~~~~~~~~~~~~~~~~~~~~~~~p~~~~P~l~~~~~~~~es~~I~~yl~~~~~~~ 80 (212)
||+||+++.||+|+++|++|+++|++|+.+.+++..++...+++.+.||.|+||+|++||.+++||.+|++||++++++.
T Consensus 8 ~~~Ly~~~~s~~~~~v~~~L~~~gi~~e~~~v~~~~~~~~~~~~~~~nP~g~vP~L~~~g~~l~eS~aI~~yL~~~~~~~ 87 (221)
T 1e6b_A 8 KLKLYSYWRSSCAHRVRIALALKGLDYEYIPVNLLKGDQFDSDFKKINPMGTVPALVDGDVVINDSFAIIMYLDEKYPEP 87 (221)
T ss_dssp CCEEEECTTCHHHHHHHHHHHHTTCCCEEEECCTTTTGGGCHHHHHHCTTCCSSEEEETTEEEESHHHHHHHHHHHSCSS
T ss_pred CeEEEecCCCCchHHHHHHHHHcCCCCEEEEecCCcccccCHHHHhhCCCCCCCEEEECCEEEeeHHHHHHHHHHhCCCc
Confidence 58999999999999999999999999999999987666678899999999999999999999999999999999999887
Q ss_pred CCCCCCHHHHHHHHHHHHHHHcccchhhHHHHHHHhhhhcCcchHHHHHHHHHHHHHHHHHHHHhccCCCcccCCCchHH
Q 028226 81 PLLPSDLKRKAINYQAANIVSSSIQPLQNLAVVKYIEEKAGADERDIWAKTHIGKGFAALEKLLKDYAGKYATGDEVFLA 160 (212)
Q Consensus 81 ~l~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~le~~L~~~~~~~l~G~~~t~a 160 (212)
.|+|.++.+++++++|+.++...+.+.....+..+.....+++...+...+.+.+.|+.||++|++++++|++|+++|+|
T Consensus 88 ~L~p~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~le~~L~~~~~~~l~G~~~t~A 167 (221)
T 1e6b_A 88 PLLPRDLHKRAVNYQAMSIVLSGIQPHQNLAVIRYIEEKINVEEKTAWVNNAITKGFTALEKLLVNCAGKHATGDEIYLA 167 (221)
T ss_dssp CSSCSCHHHHHHHHHHHHHHHHTTCC-------------------CCCCCHHHHHHHHHHHHHHTTSCSSBTTBSSCCHH
T ss_pred cCCCCCHHHHHHHHHHHHHHhhcccccccHHHHHHHhhccCcHHHHHHHHHHHHHHHHHHHHHHhhcCCCEecCCCCCHH
Confidence 89999999999999999998876665432222222221111112222234567889999999998754699999999999
Q ss_pred HHhhHHHHHHHHHh-cccCCCCcchHHHHHHHHhCCcchhhhCCCCCCCCCCC
Q 028226 161 DLYLAPQLYAAVNR-FNLDMTQFPLLLRLHEAYSKLPAFQNAVPEKQPDAPSS 212 (212)
Q Consensus 161 D~~~~~~l~~~~~~-~~~~~~~~p~l~~~~~~~~~~p~~~~~~~~~~~~~p~~ 212 (212)
|+++++.+.++ .. .+..++.+|+|.+|++++.++|++++++....++.|++
T Consensus 168 Di~l~~~l~~~-~~~~~~~~~~~p~l~~w~~~i~~~p~~~~~~~~~~~~~~~~ 219 (221)
T 1e6b_A 168 DLFLAPQIHGA-INRFQINMEPYPTLAKCYESYNELPAFQNALPEKQPDAPSS 219 (221)
T ss_dssp HHHHHHHHHHH-HHHHCCCCTTCHHHHHHHHHHTTCHHHHHHSGGGSTTSCCC
T ss_pred HHHHHHHHHHH-HHHhCCCcccChHHHHHHHHHHcCHHHHHhCCccCCCCCcC
Confidence 99999999987 44 66667899999999999999999999999999999986
|
| >4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} | Back alignment and structure |
|---|
| >2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* | Back alignment and structure |
|---|
| >4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} | Back alignment and structure |
|---|
| >3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* | Back alignment and structure |
|---|
| >2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* | Back alignment and structure |
|---|
| >4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} | Back alignment and structure |
|---|
| >3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* | Back alignment and structure |
|---|
| >3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} | Back alignment and structure |
|---|
| >4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* | Back alignment and structure |
|---|
| >3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* | Back alignment and structure |
|---|
| >3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* | Back alignment and structure |
|---|
| >3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* | Back alignment and structure |
|---|
| >4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* | Back alignment and structure |
|---|
| >1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* | Back alignment and structure |
|---|
| >3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} | Back alignment and structure |
|---|
| >3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* | Back alignment and structure |
|---|
| >1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* | Back alignment and structure |
|---|
| >3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A | Back alignment and structure |
|---|
| >3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} | Back alignment and structure |
|---|
| >2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} | Back alignment and structure |
|---|
| >3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* | Back alignment and structure |
|---|
| >1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} | Back alignment and structure |
|---|
| >3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* | Back alignment and structure |
|---|
| >4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} | Back alignment and structure |
|---|
| >4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* | Back alignment and structure |
|---|
| >3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} | Back alignment and structure |
|---|
| >2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* | Back alignment and structure |
|---|
| >1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} | Back alignment and structure |
|---|
| >3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* | Back alignment and structure |
|---|
| >3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* | Back alignment and structure |
|---|
| >1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* | Back alignment and structure |
|---|
| >1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* | Back alignment and structure |
|---|
| >2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* | Back alignment and structure |
|---|
| >1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* | Back alignment and structure |
|---|
| >3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* | Back alignment and structure |
|---|
| >2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* | Back alignment and structure |
|---|
| >3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* | Back alignment and structure |
|---|
| >1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} | Back alignment and structure |
|---|
| >1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* | Back alignment and structure |
|---|
| >1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A | Back alignment and structure |
|---|
| >2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} | Back alignment and structure |
|---|
| >1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... | Back alignment and structure |
|---|
| >1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} | Back alignment and structure |
|---|
| >2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* | Back alignment and structure |
|---|
| >3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} | Back alignment and structure |
|---|
| >1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A | Back alignment and structure |
|---|
| >2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} | Back alignment and structure |
|---|
| >3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} | Back alignment and structure |
|---|
| >2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* | Back alignment and structure |
|---|
| >2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* | Back alignment and structure |
|---|
| >1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A | Back alignment and structure |
|---|
| >1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* | Back alignment and structure |
|---|
| >1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* | Back alignment and structure |
|---|
| >3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* | Back alignment and structure |
|---|
| >1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A | Back alignment and structure |
|---|
| >1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* | Back alignment and structure |
|---|
| >2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A | Back alignment and structure |
|---|
| >2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... | Back alignment and structure |
|---|
| >1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} | Back alignment and structure |
|---|
| >2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... | Back alignment and structure |
|---|
| >2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* | Back alignment and structure |
|---|
| >3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* | Back alignment and structure |
|---|
| >3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* | Back alignment and structure |
|---|
| >1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A | Back alignment and structure |
|---|
| >1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* | Back alignment and structure |
|---|
| >2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A | Back alignment and structure |
|---|
| >3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} | Back alignment and structure |
|---|
| >1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* | Back alignment and structure |
|---|
| >2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} | Back alignment and structure |
|---|
| >4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum} | Back alignment and structure |
|---|
| >4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A* | Back alignment and structure |
|---|
| >2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A | Back alignment and structure |
|---|
| >2hsn_A Methionyl-tRNA synthetase, cytoplasmic; protein complex protein interaction GST-fold, ligase/RNA binding protein complex; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2hqt_A GU4 nucleic-binding protein 1; GST-fold, biosynthetic protein, RNA binding; 1.90A {Saccharomyces cerevisiae} SCOP: a.45.1.2 PDB: 2hrk_B 2hsm_B 2hsn_B | Back alignment and structure |
|---|
| >3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* | Back alignment and structure |
|---|
| >1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* | Back alignment and structure |
|---|
| >2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} | Back alignment and structure |
|---|
| >2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} | Back alignment and structure |
|---|
| >1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A | Back alignment and structure |
|---|
| >2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 | Back alignment and structure |
|---|
| >3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A | Back alignment and structure |
|---|
| >3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* | Back alignment and structure |
|---|
| >2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} | Back alignment and structure |
|---|
| >1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A | Back alignment and structure |
|---|
| >2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* | Back alignment and structure |
|---|
| >1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* | Back alignment and structure |
|---|
| >2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* | Back alignment and structure |
|---|
| >3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A | Back alignment and structure |
|---|
| >3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* | Back alignment and structure |
|---|
| >2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A | Back alignment and structure |
|---|
| >2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B | Back alignment and structure |
|---|
| >1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A | Back alignment and structure |
|---|
| >1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A | Back alignment and structure |
|---|
| >3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} | Back alignment and structure |
|---|
| >3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A | Back alignment and structure |
|---|
| >3l78_A Regulatory protein SPX; transcription, transcriptional factor, disulfide bond, redox-active center, transcription regulati; 1.90A {Streptococcus mutans} SCOP: c.47.1.12 | Back alignment and structure |
|---|
| >2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 | Back alignment and structure |
|---|
| >3f0i_A Arsenate reductase; structural genomics, IDP01300, vibrio CH center for structural genomics of infectious diseases, CSGI oxidoreductase; HET: MSE; 1.88A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1s3c_A Arsenate reductase; ARSC, arsenite, oxidoreductase; 1.25A {Escherichia coli} PDB: 1sd9_A 1i9d_A 1j9b_A 1sd8_A 1jzw_A* 1sk1_A* 1sjz_A* 1sk0_A* 1sk2_A 1s3d_A | Back alignment and structure |
|---|
| >3rdw_A Putative arsenate reductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 2.20A {Yersinia pestis} | Back alignment and structure |
|---|
| >1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} | Back alignment and structure |
|---|
| >2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A | Back alignment and structure |
|---|
| >2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* | Back alignment and structure |
|---|
| >2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 | Back alignment and structure |
|---|
| >3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} | Back alignment and structure |
|---|
| >1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A | Back alignment and structure |
|---|
| >3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 212 | ||||
| d1e6ba1 | 133 | a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cres | 7e-37 | |
| d1e6ba2 | 80 | c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress | 5e-27 | |
| d1jlva2 | 84 | c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anoph | 6e-27 | |
| d1fw1a2 | 83 | c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapi | 2e-26 | |
| d1r5aa2 | 85 | c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anoph | 4e-26 | |
| d1axda2 | 80 | c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), | 1e-24 | |
| d1gnwa2 | 84 | c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress ( | 6e-23 | |
| d1oyja2 | 84 | c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativ | 8e-23 | |
| d1aw9a2 | 81 | c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), | 8e-23 | |
| d1fw1a1 | 125 | a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sa | 2e-22 | |
| d1n2aa2 | 80 | c.47.1.5 (A:1-80) Class beta GST {Escherichia coli | 6e-22 | |
| d1f2ea2 | 80 | c.47.1.5 (A:1-80) Class beta GST {Sphingomonas pau | 4e-21 | |
| d1eema2 | 98 | c.47.1.5 (A:5-102) Class omega GST {Human (Homo sa | 5e-21 | |
| d1ljra2 | 79 | c.47.1.5 (A:1-79) Class theta GST {Human (Homo sap | 2e-20 | |
| d1pmta2 | 80 | c.47.1.5 (A:1-80) Class beta GST {Proteus mirabili | 8e-19 | |
| d1v2aa2 | 83 | c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anoph | 5e-18 | |
| d1k0da2 | 92 | c.47.1.5 (A:109-200) Yeast prion protein ure2p, ni | 3e-17 | |
| d1gwca2 | 83 | c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii | 9e-17 | |
| d2c4ja2 | 84 | c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapien | 1e-15 | |
| d1k0ma2 | 86 | c.47.1.5 (A:6-91) Chloride intracellular channel 1 | 2e-14 | |
| d1g7oa2 | 75 | c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli | 4e-14 | |
| d2fnoa2 | 87 | c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752 | 4e-14 | |
| d1nhya2 | 75 | c.47.1.5 (A:1-75) GST-like domain of elongation fa | 4e-14 | |
| d2a2ra2 | 77 | c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapien | 4e-14 | |
| d1z9ha2 | 113 | c.47.1.5 (A:100-212) Microsomal prostaglandin E sy | 1e-13 | |
| d1gula2 | 77 | c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sap | 5e-13 | |
| d1k3ya2 | 79 | c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sap | 1e-12 | |
| d1b48a2 | 78 | c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musc | 2e-12 | |
| d1k3ya1 | 142 | a.45.1.1 (A:81-222) Class alpha GST {Human (Homo s | 5e-12 | |
| d1fhea2 | 80 | c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepati | 1e-11 | |
| d1m0ua2 | 76 | c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Dr | 2e-11 | |
| d2cvda2 | 74 | c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sap | 7e-11 | |
| d1tu7a2 | 77 | c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulu | 4e-10 | |
| d2gsqa2 | 75 | c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastre | 6e-10 | |
| d1tw9a1 | 129 | a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoid | 2e-09 | |
| d1b48a1 | 143 | a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus mu | 3e-09 | |
| d1gula1 | 140 | a.45.1.1 (A:81-220) Class alpha GST {Human (Homo s | 4e-09 | |
| d1okta2 | 85 | c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasm | 4e-09 | |
| d1n2aa1 | 121 | a.45.1.1 (A:81-201) Class beta GST {Escherichia co | 5e-09 | |
| d1tw9a2 | 77 | c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides | 6e-09 | |
| d1duga2 | 80 | c.47.1.5 (A:1-80) Class alpha GST {Schistosoma jap | 7e-09 | |
| d1oe8a2 | 81 | c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Sc | 3e-08 | |
| d1f2ea1 | 121 | a.45.1.1 (A:81-201) Class beta GST {Sphingomonas p | 2e-07 | |
| d1pmta1 | 121 | a.45.1.1 (A:81-201) Class beta GST {Proteus mirabi | 7e-07 | |
| d1eema1 | 139 | a.45.1.1 (A:103-241) Class omega GST {Human (Homo | 1e-06 | |
| d1jlwa1 | 127 | a.45.1.1 (A:91-217) Class delta GST {Mosquito (Ano | 2e-06 | |
| d1okta1 | 126 | a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Pla | 3e-06 | |
| d1gnwa1 | 126 | a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress | 1e-05 | |
| d1oe8a1 | 123 | a.45.1.1 (A:85-207) Class alpha GST {Blood fluke ( | 2e-05 | |
| d1axda1 | 129 | a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays | 3e-05 | |
| d1m0ua1 | 127 | a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (D | 7e-05 | |
| d1aw9a1 | 135 | a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays | 3e-04 | |
| d1k0ma1 | 149 | a.45.1.1 (A:92-240) Chloride intracellular channel | 0.002 | |
| d1k0da1 | 151 | a.45.1.1 (A:201-351) Yeast prion protein ure2p, ni | 0.002 | |
| d1gwca1 | 138 | a.45.1.1 (A:87-224) Class tau GST {Aegilops tausch | 0.002 | |
| d1duga1 | 140 | a.45.1.1 (A:81-220) Class alpha GST {Schistosoma j | 0.003 |
| >d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 133 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: GST C-terminal domain-like superfamily: GST C-terminal domain-like family: Glutathione S-transferase (GST), C-terminal domain domain: Class zeta GST species: Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 123 bits (309), Expect = 7e-37
Identities = 81/132 (61%), Positives = 106/132 (80%)
Query: 81 PLLPSDLKRKAINYQAANIVSSSIQPLQNLAVVKYIEEKAGADERDIWAKTHIGKGFAAL 140
PLLP DL ++A+NYQA +IV S IQP QNLAV++YIEEK +E+ W I KGF AL
Sbjct: 1 PLLPRDLHKRAVNYQAMSIVLSGIQPHQNLAVIRYIEEKINVEEKTAWVNNAITKGFTAL 60
Query: 141 EKLLKDYAGKYATGDEVFLADLYLAPQLYAAVNRFNLDMTQFPLLLRLHEAYSKLPAFQN 200
EKLL + AGK+ATGDE++LADL+LAPQ++ A+NRF ++M +P L + +E+Y++LPAFQN
Sbjct: 61 EKLLVNCAGKHATGDEIYLADLFLAPQIHGAINRFQINMEPYPTLAKCYESYNELPAFQN 120
Query: 201 AVPEKQPDAPSS 212
A+PEKQPDAPSS
Sbjct: 121 ALPEKQPDAPSS 132
|
| >d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 | Back information, alignment and structure |
|---|
| >d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 84 | Back information, alignment and structure |
|---|
| >d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 85 | Back information, alignment and structure |
|---|
| >d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 80 | Back information, alignment and structure |
|---|
| >d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 84 | Back information, alignment and structure |
|---|
| >d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Length = 84 | Back information, alignment and structure |
|---|
| >d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Length = 81 | Back information, alignment and structure |
|---|
| >d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
| >d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Length = 80 | Back information, alignment and structure |
|---|
| >d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Length = 80 | Back information, alignment and structure |
|---|
| >d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 83 | Back information, alignment and structure |
|---|
| >d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 92 | Back information, alignment and structure |
|---|
| >d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Length = 83 | Back information, alignment and structure |
|---|
| >d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Length = 75 | Back information, alignment and structure |
|---|
| >d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Length = 87 | Back information, alignment and structure |
|---|
| >d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 | Back information, alignment and structure |
|---|
| >d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Length = 113 | Back information, alignment and structure |
|---|
| >d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Length = 78 | Back information, alignment and structure |
|---|
| >d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 142 | Back information, alignment and structure |
|---|
| >d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Length = 80 | Back information, alignment and structure |
|---|
| >d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 76 | Back information, alignment and structure |
|---|
| >d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Length = 77 | Back information, alignment and structure |
|---|
| >d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Length = 75 | Back information, alignment and structure |
|---|
| >d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Length = 129 | Back information, alignment and structure |
|---|
| >d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Length = 143 | Back information, alignment and structure |
|---|
| >d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 140 | Back information, alignment and structure |
|---|
| >d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 85 | Back information, alignment and structure |
|---|
| >d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} Length = 121 | Back information, alignment and structure |
|---|
| >d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Length = 77 | Back information, alignment and structure |
|---|
| >d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Length = 80 | Back information, alignment and structure |
|---|
| >d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Length = 81 | Back information, alignment and structure |
|---|
| >d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Length = 121 | Back information, alignment and structure |
|---|
| >d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} Length = 121 | Back information, alignment and structure |
|---|
| >d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Length = 139 | Back information, alignment and structure |
|---|
| >d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} Length = 127 | Back information, alignment and structure |
|---|
| >d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 126 | Back information, alignment and structure |
|---|
| >d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 126 | Back information, alignment and structure |
|---|
| >d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Length = 123 | Back information, alignment and structure |
|---|
| >d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 129 | Back information, alignment and structure |
|---|
| >d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 127 | Back information, alignment and structure |
|---|
| >d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Length = 135 | Back information, alignment and structure |
|---|
| >d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Length = 149 | Back information, alignment and structure |
|---|
| >d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 151 | Back information, alignment and structure |
|---|
| >d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Length = 138 | Back information, alignment and structure |
|---|
| >d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Length = 140 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 212 | |||
| d1e6ba1 | 133 | Class zeta GST {Mouse-ear cress (Arabidopsis thali | 99.92 | |
| d1jlva2 | 84 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.92 | |
| d1aw9a2 | 81 | Class phi GST {Maize (Zea mays), type III [TaxId: | 99.91 | |
| d1r5aa2 | 85 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.91 | |
| d1fw1a1 | 125 | Class zeta GST {Human (Homo sapiens) [TaxId: 9606] | 99.91 | |
| d1gnwa2 | 84 | Class phi GST {Mouse-ear cress (Arabidopsis thalia | 99.91 | |
| d1e6ba2 | 80 | Class zeta GST {Mouse-ear cress (Arabidopsis thali | 99.9 | |
| d1axda2 | 80 | Class phi GST {Maize (Zea mays), type I [TaxId: 45 | 99.9 | |
| d1ljra2 | 79 | Class theta GST {Human (Homo sapiens) [TaxId: 9606 | 99.9 | |
| d1v2aa2 | 83 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.89 | |
| d1fw1a2 | 83 | Class zeta GST {Human (Homo sapiens) [TaxId: 9606] | 99.88 | |
| d1k0da2 | 92 | Yeast prion protein ure2p, nitrogen regulation fra | 99.88 | |
| d1eema2 | 98 | Class omega GST {Human (Homo sapiens) [TaxId: 9606 | 99.87 | |
| d1oyja2 | 84 | Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | 99.87 | |
| d1b48a1 | 143 | Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax | 99.86 | |
| d1gula1 | 140 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 99.86 | |
| d1n2aa2 | 80 | Class beta GST {Escherichia coli [TaxId: 562]} | 99.85 | |
| d1tu7a2 | 77 | Class pi GST {Onchocerca volvulus [TaxId: 6282]} | 99.85 | |
| d1f2ea2 | 80 | Class beta GST {Sphingomonas paucimobilis [TaxId: | 99.85 | |
| d1k3ya1 | 142 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 99.85 | |
| d1pmta2 | 80 | Class beta GST {Proteus mirabilis [TaxId: 584]} | 99.85 | |
| d2cvda2 | 74 | Class sigma GST {Human (Homo sapiens) [TaxId: 9606 | 99.85 | |
| d2gsqa2 | 75 | Class sigma GST {Squid (Ommastrephes sloani pacifi | 99.85 | |
| d1n2aa1 | 121 | Class beta GST {Escherichia coli [TaxId: 562]} | 99.85 | |
| d1aw9a1 | 135 | Class phi GST {Maize (Zea mays), type III [TaxId: | 99.85 | |
| d1g7oa2 | 75 | Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | 99.85 | |
| d1axda1 | 129 | Class phi GST {Maize (Zea mays), type I [TaxId: 45 | 99.85 | |
| d1tw9a1 | 129 | Class sigma GST {Heligmosomoides polygyrus [TaxId: | 99.85 | |
| d1m0ua2 | 76 | Class sigma GST {Fruit fly (Drosophila melanogaste | 99.84 | |
| d2cvda1 | 124 | Class sigma GST {Human (Homo sapiens) [TaxId: 9606 | 99.84 | |
| d1f2ea1 | 121 | Class beta GST {Sphingomonas paucimobilis [TaxId: | 99.84 | |
| d2a2ra2 | 77 | Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | 99.83 | |
| d1m0ua1 | 127 | Class sigma GST {Fruit fly (Drosophila melanogaste | 99.83 | |
| d1nhya1 | 144 | GST-like domain of elongation factor 1-gamma {Bake | 99.83 | |
| d2c4ja2 | 84 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 99.83 | |
| d2gsqa1 | 127 | Class sigma GST {Squid (Ommastrephes sloani pacifi | 99.83 | |
| d1v2aa1 | 125 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.83 | |
| d1pmta1 | 121 | Class beta GST {Proteus mirabilis [TaxId: 584]} | 99.83 | |
| d3gtub1 | 140 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 99.83 | |
| d1gula2 | 77 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 99.83 | |
| d1jlwa1 | 127 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.82 | |
| d1k0ma2 | 86 | Chloride intracellular channel 1 (clic1) {Human (H | 99.82 | |
| d1k3ya2 | 79 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 99.82 | |
| d1b48a2 | 78 | Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax | 99.82 | |
| d1tw9a2 | 77 | Class sigma GST {Heligmosomoides polygyrus [TaxId: | 99.81 | |
| d1eema1 | 139 | Class omega GST {Human (Homo sapiens) [TaxId: 9606 | 99.81 | |
| d1gwca2 | 83 | Class tau GST {Aegilops tauschii, also known as Tr | 99.81 | |
| d1gnwa1 | 126 | Class phi GST {Mouse-ear cress (Arabidopsis thalia | 99.81 | |
| d2gsta1 | 133 | Class mu GST {Rat (Rattus norvegicus) [TaxId: 1011 | 99.81 | |
| d2c4ja1 | 133 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 99.8 | |
| d1jlva1 | 123 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.8 | |
| d1okta2 | 85 | Pf GST {Malarial parasite (Plasmodium falciparum) | 99.8 | |
| d1gsua1 | 133 | Class mu GST {Chicken (Gallus gallus) [TaxId: 9031 | 99.8 | |
| d1r5aa1 | 129 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.79 | |
| d1gwca1 | 138 | Class tau GST {Aegilops tauschii, also known as Tr | 99.79 | |
| d1fhea2 | 80 | Class alpha GST {Fasciola hepatica [TaxId: 6192]} | 99.79 | |
| d2fnoa2 | 87 | Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac | 99.79 | |
| d2a2ra1 | 132 | Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | 99.79 | |
| d1duga2 | 80 | Class alpha GST {Schistosoma japonicum [TaxId: 618 | 99.78 | |
| d1ljra1 | 165 | Class theta GST {Human (Homo sapiens) [TaxId: 9606 | 99.78 | |
| d1okta1 | 126 | Pf GST {Malarial parasite (Plasmodium falciparum) | 99.78 | |
| d2fhea1 | 136 | Class alpha GST {Fasciola hepatica [TaxId: 6192]} | 99.77 | |
| d1k0da1 | 151 | Yeast prion protein ure2p, nitrogen regulation fra | 99.77 | |
| d1duga1 | 140 | Class alpha GST {Schistosoma japonicum [TaxId: 618 | 99.77 | |
| d1oe8a1 | 123 | Class alpha GST {Blood fluke (Schistosoma haematob | 99.74 | |
| d1tu7a1 | 131 | Class pi GST {Onchocerca volvulus [TaxId: 6282]} | 99.73 | |
| d1oe8a2 | 81 | Class alpha GST {Blood fluke (Schistosoma haematob | 99.73 | |
| d1z9ha2 | 113 | Microsomal prostaglandin E synthase-2 {Crab-eating | 99.71 | |
| d1nhya2 | 75 | GST-like domain of elongation factor 1-gamma {Bake | 99.65 | |
| d1oyja1 | 145 | Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | 99.6 | |
| d2hrkb1 | 118 | GU4 nucleic-binding protein 1, Arc1p {Baker's yeas | 99.49 | |
| d1k0ma1 | 149 | Chloride intracellular channel 1 (clic1) {Human (H | 99.43 | |
| d1z9ha1 | 161 | Microsomal prostaglandin E synthase-2 {Crab-eating | 98.9 | |
| d1nm3a1 | 74 | C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus | 98.8 | |
| d1fova_ | 82 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 98.62 | |
| d1abaa_ | 87 | Glutaredoxin (Grx, thioltransferase) {Bacteriophag | 98.44 | |
| d1r7ha_ | 74 | Glutaredoxin-like NRDH-redoxin {Corynebacterium am | 98.43 | |
| d1h75a_ | 76 | Glutaredoxin-like NRDH-redoxin {Escherichia coli [ | 98.38 | |
| d2fnoa1 | 149 | Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac | 98.24 | |
| d1egoa_ | 85 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 97.73 | |
| d1g7oa1 | 140 | Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | 97.65 | |
| d1wika_ | 109 | Thioredoxin-like protein 2 {Mouse (Mus musculus) [ | 97.64 | |
| d1t1va_ | 93 | SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} | 97.39 | |
| d1ktea_ | 105 | Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr | 97.39 | |
| d1ttza_ | 75 | Hypothetical protein XCC2852 {Xanthomonas campestr | 97.35 | |
| d1wjka_ | 100 | Thioredoxin-like structure containing protein C330 | 97.33 | |
| d1z3ea1 | 114 | Regulatory protein Spx {Bacillus subtilis [TaxId: | 97.09 | |
| d1rw1a_ | 114 | Hypothetical protein PA3664 (YffB) {Pseudomonas ae | 95.22 | |
| d1hyua4 | 96 | Alkyl hydroperoxide reductase subunit F (AhpF), N- | 93.88 | |
| d1j9ba_ | 138 | Arsenate reductase ArsC {Escherichia coli [TaxId: | 92.75 | |
| d1iloa_ | 77 | MTH985, a thioredoxin {Archaeon Methanobacterium t | 92.39 | |
| d1nhoa_ | 85 | MTH807, thioredoxin/glutaredoxin-like protein {Arc | 87.63 |
| >d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: GST C-terminal domain-like superfamily: GST C-terminal domain-like family: Glutathione S-transferase (GST), C-terminal domain domain: Class zeta GST species: Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=99.92 E-value=2e-25 Score=150.82 Aligned_cols=131 Identities=61% Similarity=0.995 Sum_probs=101.1
Q ss_pred CCCCCHHHHHHHHHHHHHHHcccchhhHHHHHHHhhhhcCcchHHHHHHHHHHHHHHHHHHHHhccCCCcccCCCchHHH
Q 028226 82 LLPSDLKRKAINYQAANIVSSSIQPLQNLAVVKYIEEKAGADERDIWAKTHIGKGFAALEKLLKDYAGKYATGDEVFLAD 161 (212)
Q Consensus 82 l~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~le~~L~~~~~~~l~G~~~t~aD 161 (212)
|+|+|+.+++++++|+.++.+.+.+.....+..+.......++..+.....+.+.+..+|+.|+..+++|++|+++|+||
T Consensus 2 LlP~Dp~~RA~vr~~~~~~~~~i~p~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~lE~~L~~~~~~~~~Gd~~slAD 81 (133)
T d1e6ba1 2 LLPRDLHKRAVNYQAMSIVLSGIQPHQNLAVIRYIEEKINVEEKTAWVNNAITKGFTALEKLLVNCAGKHATGDEIYLAD 81 (133)
T ss_dssp SSCSCHHHHHHHHHHHHHHHHTTCC-------------------CCCCCHHHHHHHHHHHHHHTTSCSSBTTBSSCCHHH
T ss_pred CCCCCHHHHHHHHHHHHHHHcCcCcchhHHHHHHhhhhccHHHHHHHHHHHHHHHHHHHHHHHhhcCCCeeeCCcCcchH
Confidence 89999999999999999999998886555555544444333444444456678889999999998667899999999999
Q ss_pred HhhHHHHHHHHHhcccCCCCcchHHHHHHHHhCCcchhhhCCCCCCCCCCC
Q 028226 162 LYLAPQLYAAVNRFNLDMTQFPLLLRLHEAYSKLPAFQNAVPEKQPDAPSS 212 (212)
Q Consensus 162 ~~~~~~l~~~~~~~~~~~~~~p~l~~~~~~~~~~p~~~~~~~~~~~~~p~~ 212 (212)
|++++.+.++....+.+++.||+|.+|++|+.++|+|+++.+.+++++|.+
T Consensus 82 i~l~~~~~~~~~~~~~d~~~~P~l~aw~~r~~~rPa~~~a~p~~q~d~p~~ 132 (133)
T d1e6ba1 82 LFLAPQIHGAINRFQINMEPYPTLAKCYESYNELPAFQNALPEKQPDAPSS 132 (133)
T ss_dssp HHHHHHHHHHHHHHCCCCTTCHHHHHHHHHHTTCHHHHHHSGGGSTTSCCC
T ss_pred HHHHHHHHHHHHHhhhhhccCcHHHHHHHHHHCCHHHHHhCcccCCCCCCC
Confidence 999999887646678889999999999999999999999999999999985
|
| >d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} | Back information, alignment and structure |
|---|
| >d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} | Back information, alignment and structure |
|---|
| >d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} | Back information, alignment and structure |
|---|
| >d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} | Back information, alignment and structure |
|---|
| >d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} | Back information, alignment and structure |
|---|
| >d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} | Back information, alignment and structure |
|---|
| >d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} | Back information, alignment and structure |
|---|
| >d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} | Back information, alignment and structure |
|---|
| >d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} | Back information, alignment and structure |
|---|
| >d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} | Back information, alignment and structure |
|---|
| >d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} | Back information, alignment and structure |
|---|
| >d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} | Back information, alignment and structure |
|---|
| >d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} | Back information, alignment and structure |
|---|
| >d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} | Back information, alignment and structure |
|---|
| >d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} | Back information, alignment and structure |
|---|
| >d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} | Back information, alignment and structure |
|---|
| >d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} | Back information, alignment and structure |
|---|
| >d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} | Back information, alignment and structure |
|---|
| >d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} | Back information, alignment and structure |
|---|
| >d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fnoa1 a.45.1.1 (A:88-236) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g7oa1 a.45.1.1 (A:76-215) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1rw1a_ c.47.1.12 (A:) Hypothetical protein PA3664 (YffB) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1j9ba_ c.47.1.12 (A:) Arsenate reductase ArsC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|