Citrus Sinensis ID: 028235


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-
MSYDYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVTIDGRPIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLSSWLEDARQHANPNMSIMLVGNKCDLAHRRAVSKEEGEQFAKENGLLFLEASARTAQNVEEAFIKTAAKILQNIQEGALDAVNDQSGIKVGYGRGQGPSGARDGTVSQRGGCCS
ccccEEEEEEEEccccccHHHHHHHHHHcccccccccccEEEEcEEEEEEccEEEEEEEEcccccHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHHHHHHcccccEEEEEEEcccccccccccHHHHHHHHHHcccEEEEccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccc
MSYDYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVTIDGRPIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLSSWLEDARQHANPNMSIMLVGNKCDLAHRRAVSKEEGEQFAKENGLLFLEASARTAQNVEEAFIKTAAKILQNIQE**************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSYDYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVTIDGRPIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLSSWLEDARQHANPNMSIMLVGNKCDLAHRRAVSKEEGEQFAKENGLLFLEASARTAQNVEEAFIKTAAKILQNIQEGALDAVNDQSGIKVGYGRGQGPSGARDGTVSQRGGCCS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ras-related protein Rab-2A Required for protein transport from the endoplasmic reticulum to the Golgi complex.confidentQ01971
Ras-related protein Rab-2A Required for protein transport from the endoplasmic reticulum to the Golgi complex.confidentP61019
Ras-related protein Rab-2A Required for protein transport from the endoplasmic reticulum to the Golgi complex.confidentP53994

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2A5J, chain A
Confidence level:very confident
Coverage over the Query: 3-173
View the alignment between query and template
View the model in PyMOL
Template: 3BBP, chain A
Confidence level:very confident
Coverage over the Query: 7-167
View the alignment between query and template
View the model in PyMOL