BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 028280
(211 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4DJ4|A Chain A, X-ray Structure Of Mutant N211d Of Bifunctional Nuclease
Tbn1 From Solanum Lycopersicum (tomato)
pdb|4DJ4|B Chain B, X-ray Structure Of Mutant N211d Of Bifunctional Nuclease
Tbn1 From Solanum Lycopersicum (tomato)
Length = 277
Score = 27.3 bits (59), Expect = 6.7, Method: Compositional matrix adjust.
Identities = 14/45 (31%), Positives = 27/45 (60%), Gaps = 1/45 (2%)
Query: 58 GYQLALSFKDICNDFFNTNVEIIVTEGDQEGARIAALVREI-GAS 101
GY+ + + + +D+FN+ + I++ Q G R+A L+ + GAS
Sbjct: 224 GYKGVEAGETLSDDYFNSRLPIVMKRVAQGGIRLAMLLNNVFGAS 268
>pdb|3SNG|A Chain A, X-ray Structure Of Fully Glycosylated Bifunctional
Nuclease Tbn1 From Solanum Lycopersicum (tomato)
Length = 277
Score = 27.3 bits (59), Expect = 6.7, Method: Compositional matrix adjust.
Identities = 14/45 (31%), Positives = 27/45 (60%), Gaps = 1/45 (2%)
Query: 58 GYQLALSFKDICNDFFNTNVEIIVTEGDQEGARIAALVREI-GAS 101
GY+ + + + +D+FN+ + I++ Q G R+A L+ + GAS
Sbjct: 224 GYKGVEAGETLSDDYFNSRLPIVMKRVAQGGIRLAMLLNNVFGAS 268
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.322 0.136 0.405
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,590,156
Number of Sequences: 62578
Number of extensions: 143745
Number of successful extensions: 355
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 355
Number of HSP's gapped (non-prelim): 4
length of query: 211
length of database: 14,973,337
effective HSP length: 95
effective length of query: 116
effective length of database: 9,028,427
effective search space: 1047297532
effective search space used: 1047297532
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 49 (23.5 bits)