BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 028280
         (211 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4DJ4|A Chain A, X-ray Structure Of Mutant N211d Of Bifunctional Nuclease
           Tbn1 From Solanum Lycopersicum (tomato)
 pdb|4DJ4|B Chain B, X-ray Structure Of Mutant N211d Of Bifunctional Nuclease
           Tbn1 From Solanum Lycopersicum (tomato)
          Length = 277

 Score = 27.3 bits (59), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 58  GYQLALSFKDICNDFFNTNVEIIVTEGDQEGARIAALVREI-GAS 101
           GY+   + + + +D+FN+ + I++    Q G R+A L+  + GAS
Sbjct: 224 GYKGVEAGETLSDDYFNSRLPIVMKRVAQGGIRLAMLLNNVFGAS 268


>pdb|3SNG|A Chain A, X-ray Structure Of Fully Glycosylated Bifunctional
           Nuclease Tbn1 From Solanum Lycopersicum (tomato)
          Length = 277

 Score = 27.3 bits (59), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 58  GYQLALSFKDICNDFFNTNVEIIVTEGDQEGARIAALVREI-GAS 101
           GY+   + + + +D+FN+ + I++    Q G R+A L+  + GAS
Sbjct: 224 GYKGVEAGETLSDDYFNSRLPIVMKRVAQGGIRLAMLLNNVFGAS 268


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.136    0.405 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,590,156
Number of Sequences: 62578
Number of extensions: 143745
Number of successful extensions: 355
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 355
Number of HSP's gapped (non-prelim): 4
length of query: 211
length of database: 14,973,337
effective HSP length: 95
effective length of query: 116
effective length of database: 9,028,427
effective search space: 1047297532
effective search space used: 1047297532
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 49 (23.5 bits)