Citrus Sinensis ID: 028288

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-
MVITCLLEMVLESRYKASHFIVKSFPSLGILFSDNFFRHILYFQVCQMLRIVTFYSTQLPGPNYHCREGSKLARLPRPESVVEVLLINFPRGMIYGCGDLIFSSHMIFTLLFVLTYHKYGTIRFIKQSAWLLAIIESLLIIASRKHYTVDVVVAWYTVNLVVFFINKKLPELPDRSNASASLQFLPVSSRDKDGRNKDELHRSNNGTSGHI
cHHHHHHHHHHHHHcccccEEEEccccccEEEEHHHHHHHHHHHHHHHHHHHHEEEECccccccccccccccccccccHHHHHHHHEEcccccccccccEEEcHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccc
*VITCLLEMVLESRYKASHFIVKSFPSLGILFSDNFFRHILYFQVCQMLRIVTFYSTQLPGPNYHCREGSKLARLPRPESVVEVLLINFPRGMIYGCGDLIFSSHMIFTLLFVLTYHKYGTIRFIKQSAWLLAIIESLLIIASRKHYTVDVVVAWYTVNLVVFFINKKLPELPDRSNASASLQFLPVSS**********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVITCLLEMVLESRYKASHFIVKSFPSLGILFSDNFFRHILYFQVCQMLRIVTFYSTQLPGPNYHCREGSKLARLPRPESVVEVLLINFPRGMIYGCGDLIFSSHMIFTLLFVLTYHKYGTIRFIKQSAWLLAIIESLLIIASRKHYTVDVVVAWYTVNLVVFFINKKLPELPDRSNASASLQFLPVSSRDKDGRNKDELHRSNNGTSGHI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phosphatidylinositol:ceramide inositolphosphotransferase Catalyzes the transfer of the phosphorylinositol group from phosphatidylinositol (PI) to phytoceramide, an essential step in sphingolipid biosynthesis. May play an important role in modulating plant programmed cell death (PCD) associated with defense by promoting sphingolipid metabolism and regulating ceramide accumulation.probableQ5N7A7

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1D2T, chain A
Confidence level:probable
Coverage over the Query: 100-165
View the alignment between query and template
View the model in PyMOL