Citrus Sinensis ID: 028314
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 210 | ||||||
| 224136053 | 343 | predicted protein [Populus trichocarpa] | 0.938 | 0.574 | 0.776 | 4e-87 | |
| 118488445 | 343 | unknown [Populus trichocarpa] | 0.938 | 0.574 | 0.776 | 4e-87 | |
| 255561522 | 380 | phosphoglycerate dehydrogenase, putative | 0.957 | 0.528 | 0.733 | 9e-84 | |
| 363807464 | 391 | uncharacterized protein LOC100785085 [Gl | 0.914 | 0.491 | 0.723 | 4e-79 | |
| 359493304 | 333 | PREDICTED: d-3-phosphoglycerate dehydrog | 0.890 | 0.561 | 0.737 | 2e-78 | |
| 225460279 | 373 | PREDICTED: d-3-phosphoglycerate dehydrog | 0.961 | 0.541 | 0.712 | 6e-78 | |
| 296089431 | 343 | unnamed protein product [Vitis vinifera] | 0.947 | 0.580 | 0.718 | 2e-77 | |
| 357455585 | 382 | D-3-phosphoglycerate dehydrogenase [Medi | 0.895 | 0.492 | 0.702 | 1e-76 | |
| 449503247 | 337 | PREDICTED: d-3-phosphoglycerate dehydrog | 0.904 | 0.563 | 0.715 | 1e-76 | |
| 388510518 | 344 | unknown [Medicago truncatula] | 0.895 | 0.546 | 0.702 | 2e-76 |
| >gi|224136053|ref|XP_002327369.1| predicted protein [Populus trichocarpa] gi|222835739|gb|EEE74174.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 326 bits (835), Expect = 4e-87, Method: Compositional matrix adjust.
Identities = 153/197 (77%), Positives = 176/197 (89%)
Query: 4 MARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYHLCVVKT 63
M +SDK+ITRVLFCGP+FPASH YTKEYLQ YP IQVD VP++ VPDVI+NY++C+VK
Sbjct: 1 MVGNSDKHITRVLFCGPYFPASHQYTKEYLQKYPFIQVDDVPLAVVPDVISNYNICIVKN 60
Query: 64 MRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYL 123
MRL SN ISRA QMKLIMQFGVG+EGVDI+AAT+ GIKVARIPGD TGNAASCAE+ IYL
Sbjct: 61 MRLTSNIISRATQMKLIMQFGVGIEGVDIDAATKYGIKVARIPGDATGNAASCAEMAIYL 120
Query: 124 MLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFILGFGNIGVELAKRLRPFGVKIIATK 183
MLGLLRKQNEM+++I+QK+LG P GETL GKTVFI+GFGNIG++LAKRLRPFGVKIIATK
Sbjct: 121 MLGLLRKQNEMQISIKQKRLGEPAGETLFGKTVFIMGFGNIGIDLAKRLRPFGVKIIATK 180
Query: 184 RSWASHSQVSCQSSGML 200
RSWA HS+ S QS+G L
Sbjct: 181 RSWALHSEGSLQSNGFL 197
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|118488445|gb|ABK96037.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255561522|ref|XP_002521771.1| phosphoglycerate dehydrogenase, putative [Ricinus communis] gi|223538984|gb|EEF40581.1| phosphoglycerate dehydrogenase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|363807464|ref|NP_001242647.1| uncharacterized protein LOC100785085 [Glycine max] gi|255645066|gb|ACU23032.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359493304|ref|XP_003634565.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like isoform 2 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225460279|ref|XP_002282092.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like isoform 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296089431|emb|CBI39250.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357455585|ref|XP_003598073.1| D-3-phosphoglycerate dehydrogenase [Medicago truncatula] gi|355487121|gb|AES68324.1| D-3-phosphoglycerate dehydrogenase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449503247|ref|XP_004161907.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|388510518|gb|AFK43325.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 210 | ||||||
| TAIR|locus:2207046 | 373 | AT1G72190 [Arabidopsis thalian | 0.885 | 0.498 | 0.623 | 3.4e-61 | |
| TIGR_CMR|CHY_2698 | 525 | CHY_2698 "D-3-phosphoglycerate | 0.580 | 0.232 | 0.359 | 1.1e-12 | |
| UNIPROTKB|Q0BWN7 | 328 | gyaR "Glyoxylate reductase" [H | 0.542 | 0.347 | 0.357 | 1.6e-12 | |
| UNIPROTKB|E1C7Y3 | 525 | PHGDH "Uncharacterized protein | 0.571 | 0.228 | 0.344 | 1.8e-12 | |
| ZFIN|ZDB-GENE-030131-647 | 528 | phgdh "phosphoglycerate dehydr | 0.585 | 0.232 | 0.341 | 3.9e-12 | |
| UNIPROTKB|Q5SZU1 | 499 | PHGDH "D-3-phosphoglycerate de | 0.557 | 0.234 | 0.359 | 7.3e-12 | |
| UNIPROTKB|O43175 | 533 | PHGDH "D-3-phosphoglycerate de | 0.557 | 0.219 | 0.359 | 8.3e-12 | |
| UNIPROTKB|A5GFY8 | 533 | PHGDH "D-3-phosphoglycerate de | 0.557 | 0.219 | 0.367 | 8.3e-12 | |
| MGI|MGI:1355330 | 533 | Phgdh "3-phosphoglycerate dehy | 0.571 | 0.225 | 0.344 | 1.1e-11 | |
| RGD|61987 | 533 | Phgdh "phosphoglycerate dehydr | 0.571 | 0.225 | 0.336 | 1.1e-11 |
| TAIR|locus:2207046 AT1G72190 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 626 (225.4 bits), Expect = 3.4e-61, P = 3.4e-61
Identities = 116/186 (62%), Positives = 147/186 (79%)
Query: 1 MEGMARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPXXXXXXXXXXXXXXXXANYHLCV 60
+E + D ++TRVLFCGPHFP S+N+T+EYLQ YP NYH+CV
Sbjct: 40 IERIVEKEDMHVTRVLFCGPHFPDSYNFTREYLQPYPFIKVDVVHYRDVPEVIKNYHICV 99
Query: 61 VKTMRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELT 120
TM++DSN ISRA+ +KLIMQ+GVGL+GVDI+AAT+ GIKVARIP + TGNAASC+E+
Sbjct: 100 AMTMQMDSNVISRASNIKLIMQYGVGLDGVDIDAATKHGIKVARIPSEGTGNAASCSEMA 159
Query: 121 IYLMLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFILGFGNIGVELAKRLRPFGVKII 180
IYLMLGLL+KQNEM++++ + LG PTG+TLLGKTVFILG+GNIG+ELAKRL+PFG ++I
Sbjct: 160 IYLMLGLLKKQNEMQISLRNRLLGEPTGDTLLGKTVFILGYGNIGIELAKRLKPFGSRVI 219
Query: 181 ATKRSW 186
ATKR W
Sbjct: 220 ATKRFW 225
|
|
| TIGR_CMR|CHY_2698 CHY_2698 "D-3-phosphoglycerate dehydrogenase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0BWN7 gyaR "Glyoxylate reductase" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C7Y3 PHGDH "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-647 phgdh "phosphoglycerate dehydrogenase" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5SZU1 PHGDH "D-3-phosphoglycerate dehydrogenase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O43175 PHGDH "D-3-phosphoglycerate dehydrogenase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A5GFY8 PHGDH "D-3-phosphoglycerate dehydrogenase" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1355330 Phgdh "3-phosphoglycerate dehydrogenase" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|61987 Phgdh "phosphoglycerate dehydrogenase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_Genewise1_v1.C_410478 | SubName- Full=Putative uncharacterized protein; (344 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| gw1.1441.1.1 | • | 0.401 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 210 | |||
| PLN02928 | 347 | PLN02928, PLN02928, oxidoreductase family protein | 1e-122 | |
| cd12175 | 311 | cd12175, 2-Hacid_dh_11, Putative D-isomer specific | 7e-60 | |
| cd12172 | 306 | cd12172, PGDH_like_2, Putative D-3-Phosphoglycerat | 3e-29 | |
| cd12173 | 304 | cd12173, PGDH_4, Phosphoglycerate dehydrogenases, | 7e-25 | |
| COG0111 | 324 | COG0111, SerA, Phosphoglycerate dehydrogenase and | 7e-25 | |
| COG1052 | 324 | COG1052, LdhA, Lactate dehydrogenase and related d | 2e-24 | |
| cd05198 | 302 | cd05198, formate_dh_like, Formate/glycerate and re | 3e-24 | |
| cd05303 | 301 | cd05303, PGDH_2, Phosphoglycerate dehydrogenase (P | 2e-23 | |
| pfam00389 | 312 | pfam00389, 2-Hacid_dh, D-isomer specific 2-hydroxy | 7e-23 | |
| PRK13581 | 526 | PRK13581, PRK13581, D-3-phosphoglycerate dehydroge | 7e-22 | |
| cd12178 | 317 | cd12178, 2-Hacid_dh_13, Putative D-isomer specific | 1e-21 | |
| TIGR01327 | 525 | TIGR01327, PGDH, D-3-phosphoglycerate dehydrogenas | 9e-21 | |
| cd05301 | 309 | cd05301, GDH, D-glycerate dehydrogenase/hydroxypyr | 2e-20 | |
| cd12171 | 310 | cd12171, 2-Hacid_dh_10, Putative D-isomer specific | 6e-20 | |
| cd12177 | 321 | cd12177, 2-Hacid_dh_12, Putative D-isomer specific | 1e-19 | |
| cd12179 | 306 | cd12179, 2-Hacid_dh_14, Putative D-isomer specific | 1e-18 | |
| cd12165 | 314 | cd12165, 2-Hacid_dh_6, Putative D-isomer specific | 2e-18 | |
| cd12156 | 301 | cd12156, HPPR, Hydroxy(phenyl)pyruvate Reductase, | 6e-18 | |
| cd12168 | 321 | cd12168, Mand_dh_like, D-Mandelate Dehydrogenase-l | 2e-17 | |
| cd05299 | 312 | cd05299, CtBP_dh, C-terminal binding protein (CtBP | 2e-16 | |
| PRK13243 | 333 | PRK13243, PRK13243, glyoxylate reductase; Reviewed | 6e-16 | |
| cd12169 | 308 | cd12169, PGDH_like_1, Putative D-3-Phosphoglycerat | 8e-16 | |
| cd12174 | 305 | cd12174, PGDH_like_3, Putative D-3-Phosphoglycerat | 1e-15 | |
| cd01619 | 323 | cd01619, LDH_like, D-Lactate and related Dehydroge | 1e-15 | |
| cd05300 | 313 | cd05300, 2-Hacid_dh_1, Putative D-isomer specific | 1e-15 | |
| cd12157 | 318 | cd12157, PTDH, Thermostable Phosphite Dehydrogenas | 2e-14 | |
| cd12161 | 315 | cd12161, GDH_like_1, Putative glycerate dehydrogen | 1e-13 | |
| pfam02826 | 175 | pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydro | 4e-13 | |
| cd05302 | 348 | cd05302, FDH, NAD-dependent Formate Dehydrogenase | 6e-13 | |
| cd12159 | 303 | cd12159, 2-Hacid_dh_2, Putative D-isomer specific | 2e-12 | |
| cd12162 | 307 | cd12162, 2-Hacid_dh_4, Putative D-isomer specific | 2e-12 | |
| PRK07574 | 385 | PRK07574, PRK07574, formate dehydrogenase; Provisi | 6e-12 | |
| cd12187 | 329 | cd12187, LDH_like_1, D-Lactate and related Dehydro | 1e-11 | |
| cd12185 | 322 | cd12185, HGDH_LDH_like, Putative Lactate dehydroge | 1e-10 | |
| cd12183 | 328 | cd12183, LDH_like_2, D-Lactate and related Dehydro | 5e-10 | |
| cd12155 | 314 | cd12155, PGDH_1, Phosphoglycerate Dehydrogenase, 2 | 8e-10 | |
| cd12166 | 300 | cd12166, 2-Hacid_dh_7, Putative D-isomer specific | 1e-09 | |
| PRK06487 | 317 | PRK06487, PRK06487, glycerate dehydrogenase; Provi | 1e-09 | |
| cd12167 | 330 | cd12167, 2-Hacid_dh_8, Putative D-isomer specific | 2e-09 | |
| PLN03139 | 386 | PLN03139, PLN03139, formate dehydrogenase; Provisi | 1e-08 | |
| cd12176 | 304 | cd12176, PGDH_3, Phosphoglycerate dehydrogenases, | 4e-08 | |
| cd12186 | 329 | cd12186, LDH, D-Lactate dehydrogenase and D-2-Hydr | 7e-08 | |
| cd12154 | 310 | cd12154, FDH_GDH_like, Formate/glycerate dehydroge | 2e-07 | |
| cd12184 | 330 | cd12184, HGDH_like, (R)-2-Hydroxyglutarate Dehydro | 8e-07 | |
| cd12158 | 343 | cd12158, ErythrP_dh, D-Erythronate-4-Phosphate Deh | 5e-06 | |
| PLN02306 | 386 | PLN02306, PLN02306, hydroxypyruvate reductase | 1e-05 | |
| cd12180 | 308 | cd12180, 2-Hacid_dh_15, Putative D-isomer specific | 1e-05 | |
| PRK08410 | 311 | PRK08410, PRK08410, 2-hydroxyacid dehydrogenase; P | 3e-05 | |
| PRK06436 | 303 | PRK06436, PRK06436, glycerate dehydrogenase; Provi | 8e-05 | |
| cd12160 | 310 | cd12160, 2-Hacid_dh_3, Putative D-isomer specific | 9e-05 | |
| PRK08605 | 332 | PRK08605, PRK08605, D-lactate dehydrogenase; Valid | 3e-04 | |
| PRK06932 | 314 | PRK06932, PRK06932, glycerate dehydrogenase; Provi | 0.001 | |
| cd12163 | 334 | cd12163, 2-Hacid_dh_5, Putative D-isomer specific | 0.002 |
| >gnl|CDD|215501 PLN02928, PLN02928, oxidoreductase family protein | Back alignment and domain information |
|---|
Score = 348 bits (896), Expect = e-122
Identities = 131/195 (67%), Positives = 160/195 (82%)
Query: 1 MEGMARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYHLCV 60
++ SD TRVLFCGP FPAS++YT+EYLQ YP IQVD V DVPDVIANY +CV
Sbjct: 7 IDKRVHHSDMRPTRVLFCGPEFPASYSYTREYLQKYPFIQVDAVAREDVPDVIANYDICV 66
Query: 61 VKTMRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELT 120
K MRLD++ I+RA+QMKLIMQFGVGLEGVD++AAT+ GIKVARIP + TGNAASCAE+
Sbjct: 67 PKMMRLDADIIARASQMKLIMQFGVGLEGVDVDAATKHGIKVARIPSEGTGNAASCAEMA 126
Query: 121 IYLMLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFILGFGNIGVELAKRLRPFGVKII 180
IYLMLGLLRKQNEM+++++ ++LG P G+TL GKTVFILG+G IG+ELAKRLRPFGVK++
Sbjct: 127 IYLMLGLLRKQNEMQISLKARRLGEPIGDTLFGKTVFILGYGAIGIELAKRLRPFGVKLL 186
Query: 181 ATKRSWASHSQVSCQ 195
AT+RSW S +
Sbjct: 187 ATRRSWTSEPEDGLL 201
|
Length = 347 |
| >gnl|CDD|240652 cd12175, 2-Hacid_dh_11, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240649 cd12172, PGDH_like_2, Putative D-3-Phosphoglycerate Dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240650 cd12173, PGDH_4, Phosphoglycerate dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|223189 COG0111, SerA, Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223980 COG1052, LdhA, Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|240622 cd05198, formate_dh_like, Formate/glycerate and related dehydrogenases of the D-specific 2-hydroxy acid dehydrogenase family | Back alignment and domain information |
|---|
| >gnl|CDD|240628 cd05303, PGDH_2, Phosphoglycerate dehydrogenase (PGDH) NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|215893 pfam00389, 2-Hacid_dh, D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|237436 PRK13581, PRK13581, D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240655 cd12178, 2-Hacid_dh_13, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|233358 TIGR01327, PGDH, D-3-phosphoglycerate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|240626 cd05301, GDH, D-glycerate dehydrogenase/hydroxypyruvate reductase (GDH) | Back alignment and domain information |
|---|
| >gnl|CDD|240648 cd12171, 2-Hacid_dh_10, Putative D-isomer specific 2-hydroxyacid dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|240654 cd12177, 2-Hacid_dh_12, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240656 cd12179, 2-Hacid_dh_14, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240642 cd12165, 2-Hacid_dh_6, Putative D-isomer specific 2-hydroxyacid dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|240633 cd12156, HPPR, Hydroxy(phenyl)pyruvate Reductase, D-isomer-specific 2-hydroxyacid-related dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|240645 cd12168, Mand_dh_like, D-Mandelate Dehydrogenase-like dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|240624 cd05299, CtBP_dh, C-terminal binding protein (CtBP), D-isomer-specific 2-hydroxyacid dehydrogenases related repressor | Back alignment and domain information |
|---|
| >gnl|CDD|183914 PRK13243, PRK13243, glyoxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240646 cd12169, PGDH_like_1, Putative D-3-Phosphoglycerate Dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|240651 cd12174, PGDH_like_3, Putative D-3-Phosphoglycerate Dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240620 cd01619, LDH_like, D-Lactate and related Dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240625 cd05300, 2-Hacid_dh_1, Putative D-isomer specific 2-hydroxyacid dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|240634 cd12157, PTDH, Thermostable Phosphite Dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|240638 cd12161, GDH_like_1, Putative glycerate dehydrogenase and related proteins of the D-specific 2-hydroxy dehydrogenase family | Back alignment and domain information |
|---|
| >gnl|CDD|217244 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|240627 cd05302, FDH, NAD-dependent Formate Dehydrogenase (FDH) | Back alignment and domain information |
|---|
| >gnl|CDD|240636 cd12159, 2-Hacid_dh_2, Putative D-isomer specific 2-hydroxyacid dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|240639 cd12162, 2-Hacid_dh_4, Putative D-isomer specific 2-hydroxyacid dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|181041 PRK07574, PRK07574, formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240663 cd12187, LDH_like_1, D-Lactate and related Dehydrogenase like proteins, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240661 cd12185, HGDH_LDH_like, Putative Lactate dehydrogenase and (R)-2-Hydroxyglutarate Dehydrogenase-like proteins, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240659 cd12183, LDH_like_2, D-Lactate and related Dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240632 cd12155, PGDH_1, Phosphoglycerate Dehydrogenase, 2-hydroxyacid dehydrogenase family | Back alignment and domain information |
|---|
| >gnl|CDD|240643 cd12166, 2-Hacid_dh_7, Putative D-isomer specific 2-hydroxyacid dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|180588 PRK06487, PRK06487, glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240644 cd12167, 2-Hacid_dh_8, Putative D-isomer specific 2-hydroxyacid dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|178684 PLN03139, PLN03139, formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240653 cd12176, PGDH_3, Phosphoglycerate dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240662 cd12186, LDH, D-Lactate dehydrogenase and D-2-Hydroxyisocaproic acid dehydrogenase (D-HicDH), NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240631 cd12154, FDH_GDH_like, Formate/glycerate dehydrogenases, D-specific 2-hydroxy acid dehydrogenases and related dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|240660 cd12184, HGDH_like, (R)-2-Hydroxyglutarate Dehydrogenase and related dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240635 cd12158, ErythrP_dh, D-Erythronate-4-Phosphate Dehydrogenase NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|177941 PLN02306, PLN02306, hydroxypyruvate reductase | Back alignment and domain information |
|---|
| >gnl|CDD|240657 cd12180, 2-Hacid_dh_15, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|181414 PRK08410, PRK08410, 2-hydroxyacid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235800 PRK06436, PRK06436, glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240637 cd12160, 2-Hacid_dh_3, Putative D-isomer specific 2-hydroxyacid dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|181499 PRK08605, PRK08605, D-lactate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235890 PRK06932, PRK06932, glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240640 cd12163, 2-Hacid_dh_5, Putative D-isomer specific 2-hydroxyacid dehydrogenases | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 210 | |||
| PRK08410 | 311 | 2-hydroxyacid dehydrogenase; Provisional | 100.0 | |
| PLN02928 | 347 | oxidoreductase family protein | 100.0 | |
| COG0111 | 324 | SerA Phosphoglycerate dehydrogenase and related de | 100.0 | |
| PRK06487 | 317 | glycerate dehydrogenase; Provisional | 100.0 | |
| COG1052 | 324 | LdhA Lactate dehydrogenase and related dehydrogena | 100.0 | |
| PRK06932 | 314 | glycerate dehydrogenase; Provisional | 100.0 | |
| PRK15409 | 323 | bifunctional glyoxylate/hydroxypyruvate reductase | 100.0 | |
| PRK11790 | 409 | D-3-phosphoglycerate dehydrogenase; Provisional | 100.0 | |
| PRK13243 | 333 | glyoxylate reductase; Reviewed | 100.0 | |
| PRK13581 | 526 | D-3-phosphoglycerate dehydrogenase; Provisional | 100.0 | |
| PRK07574 | 385 | formate dehydrogenase; Provisional | 100.0 | |
| PLN03139 | 386 | formate dehydrogenase; Provisional | 100.0 | |
| TIGR01327 | 525 | PGDH D-3-phosphoglycerate dehydrogenase. This mode | 100.0 | |
| PLN02306 | 386 | hydroxypyruvate reductase | 100.0 | |
| PRK12480 | 330 | D-lactate dehydrogenase; Provisional | 100.0 | |
| KOG0068 | 406 | consensus D-3-phosphoglycerate dehydrogenase, D-is | 100.0 | |
| PRK08605 | 332 | D-lactate dehydrogenase; Validated | 100.0 | |
| PRK15469 | 312 | ghrA bifunctional glyoxylate/hydroxypyruvate reduc | 100.0 | |
| PRK06436 | 303 | glycerate dehydrogenase; Provisional | 100.0 | |
| PRK15438 | 378 | erythronate-4-phosphate dehydrogenase PdxB; Provis | 100.0 | |
| PRK00257 | 381 | erythronate-4-phosphate dehydrogenase; Validated | 100.0 | |
| KOG0069 | 336 | consensus Glyoxylate/hydroxypyruvate reductase (D- | 99.97 | |
| PF02826 | 178 | 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy | 99.86 | |
| PF00389 | 133 | 2-Hacid_dh: D-isomer specific 2-hydroxyacid dehydr | 99.71 | |
| TIGR02853 | 287 | spore_dpaA dipicolinic acid synthetase, A subunit. | 99.68 | |
| KOG0067 | 435 | consensus Transcription factor CtBP [Transcription | 99.68 | |
| PRK08306 | 296 | dipicolinate synthase subunit A; Reviewed | 99.36 | |
| PTZ00075 | 476 | Adenosylhomocysteinase; Provisional | 99.24 | |
| PRK13403 | 335 | ketol-acid reductoisomerase; Provisional | 98.95 | |
| PRK05476 | 425 | S-adenosyl-L-homocysteine hydrolase; Provisional | 98.26 | |
| PRK05479 | 330 | ketol-acid reductoisomerase; Provisional | 98.17 | |
| PLN02494 | 477 | adenosylhomocysteinase | 98.14 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 98.04 | |
| PF00670 | 162 | AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase | 97.94 | |
| TIGR00936 | 406 | ahcY adenosylhomocysteinase. This enzyme hydrolyze | 97.93 | |
| TIGR00465 | 314 | ilvC ketol-acid reductoisomerase. This is the seco | 97.89 | |
| cd00401 | 413 | AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado | 97.79 | |
| PF03446 | 163 | NAD_binding_2: NAD binding domain of 6-phosphogluc | 97.78 | |
| PRK14619 | 308 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 97.7 | |
| PRK05225 | 487 | ketol-acid reductoisomerase; Validated | 97.69 | |
| PF07991 | 165 | IlvN: Acetohydroxy acid isomeroreductase, catalyti | 97.45 | |
| PLN02712 | 667 | arogenate dehydrogenase | 97.44 | |
| cd01076 | 227 | NAD_bind_1_Glu_DH NAD(P) binding domain of glutama | 97.36 | |
| TIGR00518 | 370 | alaDH alanine dehydrogenase. The family of known L | 97.3 | |
| PRK11199 | 374 | tyrA bifunctional chorismate mutase/prephenate deh | 97.24 | |
| PLN02256 | 304 | arogenate dehydrogenase | 97.21 | |
| cd05313 | 254 | NAD_bind_2_Glu_DH NAD(P) binding domain of glutama | 97.2 | |
| cd05211 | 217 | NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of | 97.08 | |
| cd05191 | 86 | NAD_bind_amino_acid_DH NAD(P) binding domain of am | 97.06 | |
| PF03807 | 96 | F420_oxidored: NADP oxidoreductase coenzyme F420-d | 96.95 | |
| PRK09414 | 445 | glutamate dehydrogenase; Provisional | 96.92 | |
| PRK08818 | 370 | prephenate dehydrogenase; Provisional | 96.91 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 96.85 | |
| PLN02712 | 667 | arogenate dehydrogenase | 96.8 | |
| PRK09424 | 509 | pntA NAD(P) transhydrogenase subunit alpha; Provis | 96.78 | |
| PRK14031 | 444 | glutamate dehydrogenase; Provisional | 96.77 | |
| TIGR00561 | 511 | pntA NAD(P) transhydrogenase, alpha subunit. In so | 96.75 | |
| PLN02477 | 410 | glutamate dehydrogenase | 96.72 | |
| PLN02545 | 295 | 3-hydroxybutyryl-CoA dehydrogenase | 96.71 | |
| PRK14194 | 301 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 96.7 | |
| KOG0023 | 360 | consensus Alcohol dehydrogenase, class V [Secondar | 96.69 | |
| cd01080 | 168 | NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of | 96.68 | |
| COG0499 | 420 | SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me | 96.62 | |
| PRK07502 | 307 | cyclohexadienyl dehydrogenase; Validated | 96.61 | |
| PRK14189 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 96.56 | |
| PRK07066 | 321 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 96.55 | |
| KOG0409 | 327 | consensus Predicted dehydrogenase [General functio | 96.52 | |
| TIGR02356 | 202 | adenyl_thiF thiazole biosynthesis adenylyltransfer | 96.52 | |
| PF13241 | 103 | NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ | 96.52 | |
| PRK01710 | 458 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 96.5 | |
| PRK14030 | 445 | glutamate dehydrogenase; Provisional | 96.49 | |
| cd01065 | 155 | NAD_bind_Shikimate_DH NAD(P) binding domain of Shi | 96.49 | |
| PLN02858 | 1378 | fructose-bisphosphate aldolase | 96.48 | |
| COG0059 | 338 | IlvC Ketol-acid reductoisomerase [Amino acid trans | 96.39 | |
| COG0287 | 279 | TyrA Prephenate dehydrogenase [Amino acid transpor | 96.36 | |
| PRK05690 | 245 | molybdopterin biosynthesis protein MoeB; Provision | 96.34 | |
| TIGR01035 | 417 | hemA glutamyl-tRNA reductase. This enzyme, togethe | 96.34 | |
| cd00757 | 228 | ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 | 96.29 | |
| PLN02272 | 421 | glyceraldehyde-3-phosphate dehydrogenase | 96.24 | |
| cd01492 | 197 | Aos1_SUMO Ubiquitin activating enzyme (E1) subunit | 96.22 | |
| PRK06035 | 291 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 96.22 | |
| PRK14175 | 286 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 96.21 | |
| PRK05472 | 213 | redox-sensing transcriptional repressor Rex; Provi | 96.07 | |
| PLN02858 | 1378 | fructose-bisphosphate aldolase | 96.04 | |
| PRK12475 | 338 | thiamine/molybdopterin biosynthesis MoeB-like prot | 96.03 | |
| PRK06719 | 157 | precorrin-2 dehydrogenase; Validated | 96.0 | |
| PLN02350 | 493 | phosphogluconate dehydrogenase (decarboxylating) | 95.99 | |
| PRK06130 | 311 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 95.97 | |
| PRK14188 | 296 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 95.95 | |
| PRK00045 | 423 | hemA glutamyl-tRNA reductase; Reviewed | 95.94 | |
| PRK13302 | 271 | putative L-aspartate dehydrogenase; Provisional | 95.92 | |
| PRK00258 | 278 | aroE shikimate 5-dehydrogenase; Reviewed | 95.91 | |
| PTZ00079 | 454 | NADP-specific glutamate dehydrogenase; Provisional | 95.91 | |
| PF00208 | 244 | ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val | 95.91 | |
| PRK07530 | 292 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 95.9 | |
| PRK08328 | 231 | hypothetical protein; Provisional | 95.88 | |
| PRK06718 | 202 | precorrin-2 dehydrogenase; Reviewed | 95.87 | |
| PRK11064 | 415 | wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro | 95.86 | |
| PF10727 | 127 | Rossmann-like: Rossmann-like domain; InterPro: IPR | 95.85 | |
| PRK14618 | 328 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 95.82 | |
| PRK07531 | 495 | bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe | 95.79 | |
| PRK07819 | 286 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 95.76 | |
| PRK05808 | 282 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 95.75 | |
| PRK00683 | 418 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 95.75 | |
| PRK07688 | 339 | thiamine/molybdopterin biosynthesis ThiF/MoeB-like | 95.73 | |
| cd05213 | 311 | NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain | 95.72 | |
| TIGR01470 | 205 | cysG_Nterm siroheme synthase, N-terminal domain. T | 95.72 | |
| COG1064 | 339 | AdhP Zn-dependent alcohol dehydrogenases [General | 95.69 | |
| PRK07679 | 279 | pyrroline-5-carboxylate reductase; Reviewed | 95.68 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 95.66 | |
| PF13478 | 136 | XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 | 95.66 | |
| PF00044 | 151 | Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, | 95.64 | |
| PRK02472 | 447 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 95.61 | |
| PRK09310 | 477 | aroDE bifunctional 3-dehydroquinate dehydratase/sh | 95.53 | |
| COG0334 | 411 | GdhA Glutamate dehydrogenase/leucine dehydrogenase | 95.5 | |
| PRK08293 | 287 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 95.46 | |
| PRK05597 | 355 | molybdopterin biosynthesis protein MoeB; Validated | 95.42 | |
| PRK14106 | 450 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 95.41 | |
| PRK01390 | 460 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 95.41 | |
| TIGR02354 | 200 | thiF_fam2 thiamine biosynthesis protein ThiF, fami | 95.4 | |
| PF00899 | 135 | ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a | 95.4 | |
| PRK04690 | 468 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 95.37 | |
| PTZ00431 | 260 | pyrroline carboxylate reductase; Provisional | 95.33 | |
| PLN00203 | 519 | glutamyl-tRNA reductase | 95.32 | |
| PRK14806 | 735 | bifunctional cyclohexadienyl dehydrogenase/ 3-phos | 95.32 | |
| PRK02006 | 498 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 95.31 | |
| PRK03369 | 488 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 95.3 | |
| PRK14192 | 283 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 95.29 | |
| PRK00141 | 473 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 95.25 | |
| PRK05600 | 370 | thiamine biosynthesis protein ThiF; Validated | 95.25 | |
| cd05311 | 226 | NAD_bind_2_malic_enz NAD(P) binding domain of mali | 95.21 | |
| COG0771 | 448 | MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas | 95.17 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 95.16 | |
| TIGR02964 | 246 | xanthine_xdhC xanthine dehydrogenase accessory pro | 95.16 | |
| PRK14179 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 95.15 | |
| KOG1370 | 434 | consensus S-adenosylhomocysteine hydrolase [Coenzy | 94.99 | |
| PRK06249 | 313 | 2-dehydropantoate 2-reductase; Provisional | 94.98 | |
| PRK08268 | 507 | 3-hydroxy-acyl-CoA dehydrogenase; Validated | 94.93 | |
| TIGR02279 | 503 | PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa | 94.92 | |
| PF01262 | 168 | AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal | 94.85 | |
| PRK12549 | 284 | shikimate 5-dehydrogenase; Reviewed | 94.83 | |
| TIGR00507 | 270 | aroE shikimate 5-dehydrogenase. This model finds p | 94.77 | |
| PRK04308 | 445 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 94.76 | |
| PRK07411 | 390 | hypothetical protein; Validated | 94.75 | |
| TIGR02355 | 240 | moeB molybdopterin synthase sulfurylase MoeB. This | 94.74 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 94.71 | |
| TIGR01921 | 324 | DAP-DH diaminopimelate dehydrogenase. This model r | 94.65 | |
| PRK01368 | 454 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 94.63 | |
| PRK15182 | 425 | Vi polysaccharide biosynthesis protein TviB; Provi | 94.63 | |
| cd01485 | 198 | E1-1_like Ubiquitin activating enzyme (E1), repeat | 94.55 | |
| PRK00421 | 461 | murC UDP-N-acetylmuramate--L-alanine ligase; Provi | 94.53 | |
| PRK00676 | 338 | hemA glutamyl-tRNA reductase; Validated | 94.52 | |
| PRK08762 | 376 | molybdopterin biosynthesis protein MoeB; Validated | 94.47 | |
| PRK03803 | 448 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 94.44 | |
| PRK01438 | 480 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 94.39 | |
| PLN02948 | 577 | phosphoribosylaminoimidazole carboxylase | 94.23 | |
| PRK07878 | 392 | molybdopterin biosynthesis-like protein MoeZ; Vali | 94.16 | |
| cd01483 | 143 | E1_enzyme_family Superfamily of activating enzymes | 94.15 | |
| PRK10792 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 94.12 | |
| PRK12548 | 289 | shikimate 5-dehydrogenase; Provisional | 94.11 | |
| KOG2380 | 480 | consensus Prephenate dehydrogenase (NADP+) [Amino | 94.08 | |
| PRK03806 | 438 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 94.05 | |
| PF02558 | 151 | ApbA: Ketopantoate reductase PanE/ApbA; InterPro: | 94.03 | |
| PF01210 | 157 | NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate | 93.96 | |
| PRK13940 | 414 | glutamyl-tRNA reductase; Provisional | 93.92 | |
| PRK06197 | 306 | short chain dehydrogenase; Provisional | 93.92 | |
| PRK00066 | 315 | ldh L-lactate dehydrogenase; Reviewed | 93.77 | |
| PRK08644 | 212 | thiamine biosynthesis protein ThiF; Provisional | 93.75 | |
| KOG0022 | 375 | consensus Alcohol dehydrogenase, class III [Second | 93.68 | |
| PRK08217 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 93.63 | |
| PF02254 | 116 | TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg | 93.61 | |
| smart00846 | 149 | Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, | 93.57 | |
| TIGR01809 | 282 | Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO | 93.53 | |
| PRK06153 | 393 | hypothetical protein; Provisional | 93.5 | |
| PRK14982 | 340 | acyl-ACP reductase; Provisional | 93.47 | |
| COG0027 | 394 | PurT Formate-dependent phosphoribosylglycinamide f | 93.44 | |
| PRK14176 | 287 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 93.39 | |
| PRK12828 | 239 | short chain dehydrogenase; Provisional | 93.36 | |
| PRK08703 | 239 | short chain dehydrogenase; Provisional | 93.34 | |
| COG0677 | 436 | WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas | 93.3 | |
| PRK07523 | 255 | gluconate 5-dehydrogenase; Provisional | 93.26 | |
| TIGR01381 | 664 | E1_like_apg7 E1-like protein-activating enzyme Gsa | 93.25 | |
| PRK12771 | 564 | putative glutamate synthase (NADPH) small subunit; | 93.22 | |
| PTZ00245 | 287 | ubiquitin activating enzyme; Provisional | 93.11 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 93.1 | |
| PRK06841 | 255 | short chain dehydrogenase; Provisional | 93.01 | |
| TIGR03366 | 280 | HpnZ_proposed putative phosphonate catabolism asso | 92.97 | |
| PF02882 | 160 | THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl | 92.92 | |
| PRK05786 | 238 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 92.89 | |
| PRK06523 | 260 | short chain dehydrogenase; Provisional | 92.83 | |
| PLN02520 | 529 | bifunctional 3-dehydroquinate dehydratase/shikimat | 92.8 | |
| PRK06398 | 258 | aldose dehydrogenase; Validated | 92.73 | |
| PRK07231 | 251 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 92.66 | |
| COG0373 | 414 | HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | 92.66 | |
| PF00056 | 141 | Ldh_1_N: lactate/malate dehydrogenase, NAD binding | 92.62 | |
| cd00755 | 231 | YgdL_like Family of activating enzymes (E1) of ubi | 92.57 | |
| PTZ00117 | 319 | malate dehydrogenase; Provisional | 92.57 | |
| TIGR01832 | 248 | kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod | 92.54 | |
| PRK07634 | 245 | pyrroline-5-carboxylate reductase; Reviewed | 92.53 | |
| cd05312 | 279 | NAD_bind_1_malic_enz NAD(P) binding domain of mali | 92.49 | |
| PF13738 | 203 | Pyr_redox_3: Pyridine nucleotide-disulphide oxidor | 92.43 | |
| cd05212 | 140 | NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom | 92.38 | |
| PRK06057 | 255 | short chain dehydrogenase; Provisional | 92.34 | |
| PRK08223 | 287 | hypothetical protein; Validated | 92.28 | |
| PRK06949 | 258 | short chain dehydrogenase; Provisional | 92.26 | |
| PRK15116 | 268 | sulfur acceptor protein CsdL; Provisional | 92.25 | |
| COG1249 | 454 | Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, | 92.25 | |
| PLN02780 | 320 | ketoreductase/ oxidoreductase | 92.15 | |
| PRK12826 | 251 | 3-ketoacyl-(acyl-carrier-protein) reductase; Revie | 92.1 | |
| PRK08264 | 238 | short chain dehydrogenase; Validated | 92.1 | |
| PRK05717 | 255 | oxidoreductase; Validated | 92.02 | |
| cd08230 | 355 | glucose_DH Glucose dehydrogenase. Glucose dehydrog | 91.99 | |
| PRK07576 | 264 | short chain dehydrogenase; Provisional | 91.92 | |
| PRK08993 | 253 | 2-deoxy-D-gluconate 3-dehydrogenase; Validated | 91.88 | |
| PRK14178 | 279 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 91.88 | |
| PTZ00082 | 321 | L-lactate dehydrogenase; Provisional | 91.86 | |
| PRK07890 | 258 | short chain dehydrogenase; Provisional | 91.79 | |
| PRK08265 | 261 | short chain dehydrogenase; Provisional | 91.77 | |
| COG0540 | 316 | PyrB Aspartate carbamoyltransferase, catalytic cha | 91.76 | |
| PRK06172 | 253 | short chain dehydrogenase; Provisional | 91.73 | |
| PRK08862 | 227 | short chain dehydrogenase; Provisional | 91.69 | |
| PRK09880 | 343 | L-idonate 5-dehydrogenase; Provisional | 91.66 | |
| PRK07060 | 245 | short chain dehydrogenase; Provisional | 91.65 | |
| TIGR03325 | 262 | BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro | 91.65 | |
| PRK06550 | 235 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 91.64 | |
| PRK09186 | 256 | flagellin modification protein A; Provisional | 91.64 | |
| PLN00141 | 251 | Tic62-NAD(P)-related group II protein; Provisional | 91.63 | |
| TIGR01202 | 308 | bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl | 91.6 | |
| PRK08339 | 263 | short chain dehydrogenase; Provisional | 91.58 | |
| PRK07831 | 262 | short chain dehydrogenase; Provisional | 91.54 | |
| TIGR03201 | 349 | dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co | 91.53 | |
| PRK08945 | 247 | putative oxoacyl-(acyl carrier protein) reductase; | 91.49 | |
| PRK08628 | 258 | short chain dehydrogenase; Provisional | 91.48 | |
| PRK07806 | 248 | short chain dehydrogenase; Provisional | 91.44 | |
| COG1648 | 210 | CysG Siroheme synthase (precorrin-2 oxidase/ferroc | 91.44 | |
| PRK05562 | 223 | precorrin-2 dehydrogenase; Provisional | 91.42 | |
| COG2072 | 443 | TrkA Predicted flavoprotein involved in K+ transpo | 91.42 | |
| PRK06125 | 259 | short chain dehydrogenase; Provisional | 91.42 | |
| TIGR02822 | 329 | adh_fam_2 zinc-binding alcohol dehydrogenase famil | 91.39 | |
| PLN02740 | 381 | Alcohol dehydrogenase-like | 91.34 | |
| cd01491 | 286 | Ube1_repeat1 Ubiquitin activating enzyme (E1), rep | 91.28 | |
| PRK06114 | 254 | short chain dehydrogenase; Provisional | 91.26 | |
| PRK07062 | 265 | short chain dehydrogenase; Provisional | 91.18 | |
| PRK08085 | 254 | gluconate 5-dehydrogenase; Provisional | 91.15 | |
| PRK07856 | 252 | short chain dehydrogenase; Provisional | 91.14 | |
| PLN02358 | 338 | glyceraldehyde-3-phosphate dehydrogenase | 91.14 | |
| PRK06138 | 252 | short chain dehydrogenase; Provisional | 91.11 | |
| PRK07326 | 237 | short chain dehydrogenase; Provisional | 91.08 | |
| PRK06505 | 271 | enoyl-(acyl carrier protein) reductase; Provisiona | 91.08 | |
| PRK06079 | 252 | enoyl-(acyl carrier protein) reductase; Provisiona | 91.05 | |
| TIGR02818 | 368 | adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr | 91.05 | |
| PLN02586 | 360 | probable cinnamyl alcohol dehydrogenase | 91.04 | |
| PRK06124 | 256 | gluconate 5-dehydrogenase; Provisional | 91.03 | |
| PF03949 | 255 | Malic_M: Malic enzyme, NAD binding domain; InterPr | 91.01 | |
| PRK05867 | 253 | short chain dehydrogenase; Provisional | 91.01 | |
| PRK12429 | 258 | 3-hydroxybutyrate dehydrogenase; Provisional | 91.01 | |
| TIGR03736 | 244 | PRTRC_ThiF PRTRC system ThiF family protein. A nov | 91.01 | |
| PRK09072 | 263 | short chain dehydrogenase; Provisional | 91.0 | |
| PRK07774 | 250 | short chain dehydrogenase; Provisional | 90.99 | |
| PF01118 | 121 | Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi | 90.99 | |
| cd00762 | 254 | NAD_bind_malic_enz NAD(P) binding domain of malic | 90.97 | |
| PRK06935 | 258 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 90.97 | |
| cd08239 | 339 | THR_DH_like L-threonine dehydrogenase (TDH)-like. | 90.89 | |
| TIGR02622 | 349 | CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member | 90.87 | |
| PTZ00434 | 361 | cytosolic glyceraldehyde 3-phosphate dehydrogenase | 90.86 | |
| cd08301 | 369 | alcohol_DH_plants Plant alcohol dehydrogenase. NAD | 90.85 | |
| PRK12829 | 264 | short chain dehydrogenase; Provisional | 90.85 | |
| cd05188 | 271 | MDR Medium chain reductase/dehydrogenase (MDR)/zin | 90.81 | |
| PRK07533 | 258 | enoyl-(acyl carrier protein) reductase; Provisiona | 90.8 | |
| PRK12859 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 90.79 | |
| PRK14191 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 90.79 | |
| PF01113 | 124 | DapB_N: Dihydrodipicolinate reductase, N-terminus; | 90.77 | |
| PRK12748 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 90.77 | |
| PRK07814 | 263 | short chain dehydrogenase; Provisional | 90.75 | |
| PRK08594 | 257 | enoyl-(acyl carrier protein) reductase; Provisiona | 90.72 | |
| PRK06500 | 249 | short chain dehydrogenase; Provisional | 90.7 | |
| PF01408 | 120 | GFO_IDH_MocA: Oxidoreductase family, NAD-binding R | 90.58 | |
| PLN02178 | 375 | cinnamyl-alcohol dehydrogenase | 90.58 | |
| PRK08213 | 259 | gluconate 5-dehydrogenase; Provisional | 90.57 | |
| PRK07825 | 273 | short chain dehydrogenase; Provisional | 90.56 | |
| PRK12862 | 763 | malic enzyme; Reviewed | 90.55 | |
| PRK08415 | 274 | enoyl-(acyl carrier protein) reductase; Provisiona | 90.55 | |
| PRK03562 | 621 | glutathione-regulated potassium-efflux system prot | 90.52 | |
| PLN02253 | 280 | xanthoxin dehydrogenase | 90.51 | |
| PRK06198 | 260 | short chain dehydrogenase; Provisional | 90.49 | |
| PRK14851 | 679 | hypothetical protein; Provisional | 90.49 | |
| PRK05653 | 246 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 90.49 | |
| PRK08278 | 273 | short chain dehydrogenase; Provisional | 90.49 | |
| PLN02662 | 322 | cinnamyl-alcohol dehydrogenase family protein | 90.48 | |
| TIGR03206 | 250 | benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr | 90.47 | |
| PRK12823 | 260 | benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat | 90.47 | |
| PRK06200 | 263 | 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog | 90.44 | |
| PRK05876 | 275 | short chain dehydrogenase; Provisional | 90.43 | |
| PRK05866 | 293 | short chain dehydrogenase; Provisional | 90.42 | |
| COG0281 | 432 | SfcA Malic enzyme [Energy production and conversio | 90.4 | |
| PRK12939 | 250 | short chain dehydrogenase; Provisional | 90.39 | |
| PRK12861 | 764 | malic enzyme; Reviewed | 90.36 | |
| cd01493 | 425 | APPBP1_RUB Ubiquitin activating enzyme (E1) subuni | 90.34 | |
| PRK12481 | 251 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 90.32 | |
| PRK07889 | 256 | enoyl-(acyl carrier protein) reductase; Provisiona | 90.27 | |
| PRK14852 | 989 | hypothetical protein; Provisional | 90.25 | |
| PRK06171 | 266 | sorbitol-6-phosphate 2-dehydrogenase; Provisional | 90.24 | |
| PRK06141 | 314 | ornithine cyclodeaminase; Validated | 90.23 | |
| PRK06194 | 287 | hypothetical protein; Provisional | 90.23 | |
| PRK09288 | 395 | purT phosphoribosylglycinamide formyltransferase 2 | 90.21 | |
| PRK08589 | 272 | short chain dehydrogenase; Validated | 90.21 | |
| TIGR03451 | 358 | mycoS_dep_FDH mycothiol-dependent formaldehyde deh | 90.17 | |
| TIGR02441 | 737 | fa_ox_alpha_mit fatty acid oxidation complex, alph | 90.16 | |
| PLN03096 | 395 | glyceraldehyde-3-phosphate dehydrogenase A; Provis | 90.15 | |
| PRK08289 | 477 | glyceraldehyde-3-phosphate dehydrogenase; Reviewed | 90.11 | |
| PRK07478 | 254 | short chain dehydrogenase; Provisional | 90.11 | |
| PRK09242 | 257 | tropinone reductase; Provisional | 90.09 | |
| PRK07035 | 252 | short chain dehydrogenase; Provisional | 90.09 | |
| TIGR01408 | 1008 | Ube1 ubiquitin-activating enzyme E1. This model re | 90.08 | |
| cd08300 | 368 | alcohol_DH_class_III class III alcohol dehydrogena | 90.07 | |
| COG1250 | 307 | FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo | 90.06 | |
| PRK07063 | 260 | short chain dehydrogenase; Provisional | 90.03 | |
| PRK06603 | 260 | enoyl-(acyl carrier protein) reductase; Provisiona | 90.03 | |
| PRK11730 | 715 | fadB multifunctional fatty acid oxidation complex | 89.97 | |
| PRK07232 | 752 | bifunctional malic enzyme oxidoreductase/phosphotr | 89.97 | |
| cd08245 | 330 | CAD Cinnamyl alcohol dehydrogenases (CAD) and rela | 89.93 | |
| cd05212 | 140 | NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom | 89.93 | |
| PRK12367 | 245 | short chain dehydrogenase; Provisional | 89.89 | |
| PRK12749 | 288 | quinate/shikimate dehydrogenase; Reviewed | 89.85 | |
| PRK05565 | 247 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 89.84 | |
| TIGR02437 | 714 | FadB fatty oxidation complex, alpha subunit FadB. | 89.82 | |
| PRK07577 | 234 | short chain dehydrogenase; Provisional | 89.78 | |
| PRK05875 | 276 | short chain dehydrogenase; Provisional | 89.77 | |
| PRK08277 | 278 | D-mannonate oxidoreductase; Provisional | 89.77 | |
| PRK13529 | 563 | malate dehydrogenase; Provisional | 89.76 | |
| PLN02240 | 352 | UDP-glucose 4-epimerase | 89.74 | |
| cd08277 | 365 | liver_alcohol_DH_like Liver alcohol dehydrogenase. | 89.73 | |
| PRK06196 | 315 | oxidoreductase; Provisional | 89.73 | |
| PRK14027 | 283 | quinate/shikimate dehydrogenase; Provisional | 89.7 | |
| PRK07067 | 257 | sorbitol dehydrogenase; Provisional | 89.7 | |
| PLN02896 | 353 | cinnamyl-alcohol dehydrogenase | 89.66 | |
| PRK12742 | 237 | oxidoreductase; Provisional | 89.65 | |
| PRK07984 | 262 | enoyl-(acyl carrier protein) reductase; Provisiona | 89.56 | |
| PRK05872 | 296 | short chain dehydrogenase; Provisional | 89.52 | |
| PRK08226 | 263 | short chain dehydrogenase; Provisional | 89.51 | |
| cd08281 | 371 | liver_ADH_like1 Zinc-dependent alcohol dehydrogena | 89.49 | |
| PRK05993 | 277 | short chain dehydrogenase; Provisional | 89.49 | |
| cd08242 | 319 | MDR_like Medium chain dehydrogenases/reductase (MD | 89.46 | |
| cd08296 | 333 | CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci | 89.43 | |
| PLN03154 | 348 | putative allyl alcohol dehydrogenase; Provisional | 89.42 | |
| PRK08690 | 261 | enoyl-(acyl carrier protein) reductase; Provisiona | 89.4 | |
| PRK03659 | 601 | glutathione-regulated potassium-efflux system prot | 89.36 | |
| PRK08416 | 260 | 7-alpha-hydroxysteroid dehydrogenase; Provisional | 89.33 | |
| PRK04663 | 438 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 89.27 | |
| TIGR02440 | 699 | FadJ fatty oxidation complex, alpha subunit FadJ. | 89.24 | |
| PRK13394 | 262 | 3-hydroxybutyrate dehydrogenase; Provisional | 89.23 | |
| PRK08159 | 272 | enoyl-(acyl carrier protein) reductase; Provisiona | 89.2 | |
| PLN02237 | 442 | glyceraldehyde-3-phosphate dehydrogenase B | 89.19 | |
| PRK10669 | 558 | putative cation:proton antiport protein; Provision | 89.18 | |
| PRK06720 | 169 | hypothetical protein; Provisional | 89.1 | |
| PRK06997 | 260 | enoyl-(acyl carrier protein) reductase; Provisiona | 89.08 | |
| PRK05854 | 313 | short chain dehydrogenase; Provisional | 89.04 | |
| PRK08303 | 305 | short chain dehydrogenase; Provisional | 88.99 | |
| cd08295 | 338 | double_bond_reductase_like Arabidopsis alkenal dou | 88.97 | |
| cd05283 | 337 | CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam | 88.92 | |
| COG0190 | 283 | FolD 5,10-methylene-tetrahydrofolate dehydrogenase | 88.82 | |
| cd08255 | 277 | 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ | 88.78 | |
| PRK06139 | 330 | short chain dehydrogenase; Provisional | 88.77 | |
| PRK08936 | 261 | glucose-1-dehydrogenase; Provisional | 88.76 | |
| PRK11154 | 708 | fadJ multifunctional fatty acid oxidation complex | 88.72 | |
| PRK12809 | 639 | putative oxidoreductase Fe-S binding subunit; Revi | 88.71 | |
| PRK12439 | 341 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 88.67 | |
| KOG1687 | 168 | consensus NADH-ubiquinone oxidoreductase, NUFS7/PS | 88.65 | |
| PTZ00325 | 321 | malate dehydrogenase; Provisional | 88.64 | |
| PRK06182 | 273 | short chain dehydrogenase; Validated | 88.48 | |
| cd05293 | 312 | LDH_1 A subgroup of L-lactate dehydrogenases. L-la | 88.45 | |
| PLN02653 | 340 | GDP-mannose 4,6-dehydratase | 88.43 | |
| PRK12769 | 654 | putative oxidoreductase Fe-S binding subunit; Revi | 88.38 | |
| PRK07097 | 265 | gluconate 5-dehydrogenase; Provisional | 88.32 | |
| PRK15181 | 348 | Vi polysaccharide biosynthesis protein TviC; Provi | 88.31 | |
| PRK09135 | 249 | pteridine reductase; Provisional | 88.3 | |
| PLN02514 | 357 | cinnamyl-alcohol dehydrogenase | 88.29 | |
| PRK07985 | 294 | oxidoreductase; Provisional | 88.29 | |
| PLN02695 | 370 | GDP-D-mannose-3',5'-epimerase | 88.28 | |
| PRK07370 | 258 | enoyl-(acyl carrier protein) reductase; Validated | 88.23 | |
| COG5322 | 351 | Predicted dehydrogenase [General function predicti | 88.23 | |
| PRK08324 | 681 | short chain dehydrogenase; Validated | 88.17 | |
| PRK14573 | 809 | bifunctional D-alanyl-alanine synthetase A/UDP-N-a | 88.14 | |
| PRK07666 | 239 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 88.14 | |
| PRK06113 | 255 | 7-alpha-hydroxysteroid dehydrogenase; Validated | 88.14 | |
| cd08269 | 312 | Zn_ADH9 Alcohol dehydrogenases of the MDR family. | 88.09 | |
| TIGR01316 | 449 | gltA glutamate synthase (NADPH), homotetrameric. T | 88.05 | |
| cd08231 | 361 | MDR_TM0436_like Hypothetical enzyme TM0436 resembl | 88.03 | |
| PRK06180 | 277 | short chain dehydrogenase; Provisional | 88.01 | |
| PRK07251 | 438 | pyridine nucleotide-disulfide oxidoreductase; Prov | 87.98 | |
| PRK06914 | 280 | short chain dehydrogenase; Provisional | 87.98 | |
| PRK06701 | 290 | short chain dehydrogenase; Provisional | 87.93 | |
| cd08234 | 334 | threonine_DH_like L-threonine dehydrogenase. L-thr | 87.89 | |
| COG1063 | 350 | Tdh Threonine dehydrogenase and related Zn-depende | 87.85 | |
| PRK07904 | 253 | short chain dehydrogenase; Provisional | 87.7 | |
| PLN03209 | 576 | translocon at the inner envelope of chloroplast su | 87.69 | |
| PRK07877 | 722 | hypothetical protein; Provisional | 87.68 | |
| PRK10637 | 457 | cysG siroheme synthase; Provisional | 87.66 | |
| PRK07424 | 406 | bifunctional sterol desaturase/short chain dehydro | 87.59 | |
| PRK04523 | 335 | N-acetylornithine carbamoyltransferase; Reviewed | 87.59 | |
| PRK08220 | 252 | 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | 87.58 | |
| KOG2304 | 298 | consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t | 87.56 | |
| PRK10309 | 347 | galactitol-1-phosphate dehydrogenase; Provisional | 87.54 | |
| PRK06179 | 270 | short chain dehydrogenase; Provisional | 87.52 | |
| COG0169 | 283 | AroE Shikimate 5-dehydrogenase [Amino acid transpo | 87.48 | |
| TIGR02825 | 325 | B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 | 87.47 | |
| KOG0024 | 354 | consensus Sorbitol dehydrogenase [Secondary metabo | 87.41 | |
| PRK08642 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 87.3 | |
| PRK12831 | 464 | putative oxidoreductase; Provisional | 87.25 | |
| PRK12936 | 245 | 3-ketoacyl-(acyl-carrier-protein) reductase NodG; | 87.18 | |
| PLN02827 | 378 | Alcohol dehydrogenase-like | 87.15 | |
| PRK12827 | 249 | short chain dehydrogenase; Provisional | 87.12 | |
| PRK07454 | 241 | short chain dehydrogenase; Provisional | 87.11 | |
| cd08289 | 326 | MDR_yhfp_like Yhfp putative quinone oxidoreductase | 86.95 | |
| COG1086 | 588 | Predicted nucleoside-diphosphate sugar epimerases | 86.94 | |
| cd08288 | 324 | MDR_yhdh Yhdh putative quinone oxidoreductases. Yh | 86.93 | |
| TIGR01318 | 467 | gltD_gamma_fam glutamate synthase small subunit fa | 86.91 | |
| PRK06463 | 255 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 86.88 | |
| TIGR03316 | 357 | ygeW probable carbamoyltransferase YgeW. Members o | 86.88 | |
| PLN02989 | 325 | cinnamyl-alcohol dehydrogenase family protein | 86.87 | |
| cd08260 | 345 | Zn_ADH6 Alcohol dehydrogenases of the MDR family. | 86.85 | |
| PRK07340 | 304 | ornithine cyclodeaminase; Validated | 86.84 | |
| PRK07453 | 322 | protochlorophyllide oxidoreductase; Validated | 86.78 | |
| TIGR01408 | 1008 | Ube1 ubiquitin-activating enzyme E1. This model re | 86.73 | |
| PRK12744 | 257 | short chain dehydrogenase; Provisional | 86.68 | |
| PRK12935 | 247 | acetoacetyl-CoA reductase; Provisional | 86.67 | |
| TIGR02632 | 676 | RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc | 86.67 | |
| PRK07109 | 334 | short chain dehydrogenase; Provisional | 86.65 | |
| PLN02214 | 342 | cinnamoyl-CoA reductase | 86.63 | |
| cd08293 | 345 | PTGR2 Prostaglandin reductase. Prostaglandins and | 86.63 | |
| COG1004 | 414 | Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en | 86.61 | |
| PLN03129 | 581 | NADP-dependent malic enzyme; Provisional | 86.6 | |
| PRK06327 | 475 | dihydrolipoamide dehydrogenase; Validated | 86.54 | |
| PLN02730 | 303 | enoyl-[acyl-carrier-protein] reductase | 86.53 | |
| PRK12810 | 471 | gltD glutamate synthase subunit beta; Reviewed | 86.49 | |
| PLN02427 | 386 | UDP-apiose/xylose synthase | 86.48 | |
| PRK08261 | 450 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 86.45 | |
| cd08237 | 341 | ribitol-5-phosphate_DH ribitol-5-phosphate dehydro | 86.4 | |
| PLN02657 | 390 | 3,8-divinyl protochlorophyllide a 8-vinyl reductas | 86.38 | |
| PRK05557 | 248 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 86.33 | |
| PRK12831 | 464 | putative oxidoreductase; Provisional | 86.32 | |
| TIGR03589 | 324 | PseB UDP-N-acetylglucosamine 4,6-dehydratase. This | 86.24 | |
| PLN00106 | 323 | malate dehydrogenase | 86.2 | |
| cd08294 | 329 | leukotriene_B4_DH_like 13-PGR is a bifunctional en | 86.18 | |
| PRK12814 | 652 | putative NADPH-dependent glutamate synthase small | 86.04 | |
| PRK07792 | 306 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 85.95 | |
| cd08233 | 351 | butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog | 85.95 | |
| PRK06128 | 300 | oxidoreductase; Provisional | 85.87 | |
| PLN02602 | 350 | lactate dehydrogenase | 85.83 | |
| PF00743 | 531 | FMO-like: Flavin-binding monooxygenase-like; Inter | 85.8 | |
| TIGR01316 | 449 | gltA glutamate synthase (NADPH), homotetrameric. T | 85.76 | |
| PLN02572 | 442 | UDP-sulfoquinovose synthase | 85.61 | |
| TIGR03026 | 411 | NDP-sugDHase nucleotide sugar dehydrogenase. All o | 85.6 | |
| PRK09754 | 396 | phenylpropionate dioxygenase ferredoxin reductase | 85.6 | |
| PRK07791 | 286 | short chain dehydrogenase; Provisional | 85.51 | |
| PRK05249 | 461 | soluble pyridine nucleotide transhydrogenase; Prov | 85.49 | |
| PRK13512 | 438 | coenzyme A disulfide reductase; Provisional | 85.45 | |
| PRK14804 | 311 | ornithine carbamoyltransferase; Provisional | 85.42 | |
| cd08299 | 373 | alcohol_DH_class_I_II_IV class I, II, IV alcohol d | 85.4 | |
| PTZ00317 | 559 | NADP-dependent malic enzyme; Provisional | 85.37 | |
| cd08282 | 375 | PFDH_like Pseudomonas putida aldehyde-dismutating | 85.36 | |
| COG0493 | 457 | GltD NADPH-dependent glutamate synthase beta chain | 85.32 | |
| PRK12938 | 246 | acetyacetyl-CoA reductase; Provisional | 85.23 | |
| PRK01713 | 334 | ornithine carbamoyltransferase; Provisional | 84.99 | |
| PF13380 | 116 | CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 | 84.95 | |
| TIGR01283 | 456 | nifE nitrogenase molybdenum-iron cofactor biosynth | 84.94 | |
| PRK12937 | 245 | short chain dehydrogenase; Provisional | 84.9 | |
| PRK06370 | 463 | mercuric reductase; Validated | 84.86 | |
| PTZ00058 | 561 | glutathione reductase; Provisional | 84.84 | |
| cd08274 | 350 | MDR9 Medium chain dehydrogenases/reductase (MDR)/z | 84.83 | |
| PF00185 | 158 | OTCace: Aspartate/ornithine carbamoyltransferase, | 84.82 | |
| KOG1209 | 289 | consensus 1-Acyl dihydroxyacetone phosphate reduct | 84.81 | |
| PRK06116 | 450 | glutathione reductase; Validated | 84.8 | |
| PRK06292 | 460 | dihydrolipoamide dehydrogenase; Validated | 84.7 | |
| PLN02172 | 461 | flavin-containing monooxygenase FMO GS-OX | 84.67 | |
| PRK06416 | 462 | dihydrolipoamide dehydrogenase; Reviewed | 84.61 | |
| PLN02206 | 442 | UDP-glucuronate decarboxylase | 84.56 | |
| KOG1201 | 300 | consensus Hydroxysteroid 17-beta dehydrogenase 11 | 84.55 | |
| COG0362 | 473 | Gnd 6-phosphogluconate dehydrogenase [Carbohydrate | 84.55 | |
| PRK08063 | 250 | enoyl-(acyl carrier protein) reductase; Provisiona | 84.52 | |
| PRK15182 | 425 | Vi polysaccharide biosynthesis protein TviB; Provi | 84.47 | |
| PRK05579 | 399 | bifunctional phosphopantothenoylcysteine decarboxy | 84.43 | |
| PRK07846 | 451 | mycothione reductase; Reviewed | 84.39 | |
| PRK06300 | 299 | enoyl-(acyl carrier protein) reductase; Provisiona | 84.37 | |
| PRK14183 | 281 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 84.31 | |
| cd08264 | 325 | Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam | 84.31 | |
| KOG0029 | 501 | consensus Amine oxidase [Secondary metabolites bio | 84.22 | |
| cd08285 | 351 | NADP_ADH NADP(H)-dependent alcohol dehydrogenases. | 84.18 | |
| PRK12747 | 252 | short chain dehydrogenase; Provisional | 84.14 | |
| TIGR01421 | 450 | gluta_reduc_1 glutathione-disulfide reductase, ani | 84.08 | |
| PRK07201 | 657 | short chain dehydrogenase; Provisional | 84.07 | |
| PLN02583 | 297 | cinnamoyl-CoA reductase | 84.03 | |
| PRK12550 | 272 | shikimate 5-dehydrogenase; Reviewed | 84.02 | |
| COG0460 | 333 | ThrA Homoserine dehydrogenase [Amino acid transpor | 83.99 | |
| PRK05976 | 472 | dihydrolipoamide dehydrogenase; Validated | 83.94 | |
| cd08284 | 344 | FDH_like_2 Glutathione-dependent formaldehyde dehy | 83.91 | |
| PRK08618 | 325 | ornithine cyclodeaminase; Validated | 83.85 | |
| PRK13984 | 604 | putative oxidoreductase; Provisional | 83.8 | |
| PRK06115 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 83.79 | |
| PRK09134 | 258 | short chain dehydrogenase; Provisional | 83.75 |
| >PRK08410 2-hydroxyacid dehydrogenase; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.5e-41 Score=287.99 Aligned_cols=161 Identities=24% Similarity=0.352 Sum_probs=148.0
Q ss_pred CCChhhhcCCceEEEEcCCCCCHHHHhcCCCceEEEEccccCCccchhHHhhCCcEEEecCCCCCCCchhHHHHHHHHHH
Q 028314 46 ISDVPDVIANYHLCVVKTMRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYLML 125 (210)
Q Consensus 46 ~~~~~~~~~~adv~i~~~~~~~~~~l~~~p~Lk~i~~~~aG~d~id~~~~~~~gi~v~~~~~~~~~~a~~vAE~~l~~~L 125 (210)
.+++.+.++++|+++.+..+++++.++.+|+||||++.++|+|++|+++++++||.|+|+||+ ++.+||||+++++|
T Consensus 33 ~~~~~~~~~~~d~ii~~~~~~~~~~l~~~~~Lk~I~~~~~G~d~id~~~~~~~gI~v~n~~g~---~~~~VAE~a~~l~L 109 (311)
T PRK08410 33 PEEVIERIKDANIIITNKVVIDKEVLSQLPNLKLICITATGTNNVDIEYAKKKGIAVKNVAGY---STESVAQHTFAMLL 109 (311)
T ss_pred HHHHHHHhCCCCEEEECCCCCCHHHHhhCCCCeEEEEcccccccccHHHHHhCCCEEEcCCCC---CChHHHHHHHHHHH
Confidence 456678889999998876789999999999999999999999999999999999999999999 88999999999999
Q ss_pred HHHhhHHHHHHHHHhCCCCCC--------cccccccCeEEEEecChHHHHHHHHhccCCCEEEEEcCCCCC---------
Q 028314 126 GLLRKQNEMRMAIEQKKLGVP--------TGETLLGKTVFILGFGNIGVELAKRLRPFGVKIIATKRSWAS--------- 188 (210)
Q Consensus 126 ~~~R~~~~~~~~~~~~~w~~~--------~~~~l~~~tvGIiG~G~IG~~vA~~~~~fg~~V~~~~~~~~~--------- 188 (210)
+++|++..+++.++++.|... .+++|+||||||||+|+||+++|+++++|||+|++|||+.+.
T Consensus 110 ~~~R~~~~~~~~~~~g~w~~~~~~~~~~~~~~~L~gktvGIiG~G~IG~~vA~~~~~fgm~V~~~d~~~~~~~~~~~~~~ 189 (311)
T PRK08410 110 SLLGRINYYDRYVKSGEYSESPIFTHISRPLGEIKGKKWGIIGLGTIGKRVAKIAQAFGAKVVYYSTSGKNKNEEYERVS 189 (311)
T ss_pred HHHhCHHHHHHHHHcCCCCcCCCccccCccccccCCCEEEEECCCHHHHHHHHHHhhcCCEEEEECCCccccccCceeec
Confidence 999999999999999999742 146899999999999999999999999999999999997532
Q ss_pred --CCcccCceeEEecCCCCCCCCC
Q 028314 189 --HSQVSCQSSGMLGPLSDGETHH 210 (210)
Q Consensus 189 --~~~~~~~~~~~~~Plt~~~T~h 210 (210)
+++.++|.+++.||+|+ +|+|
T Consensus 190 l~ell~~sDvv~lh~Plt~-~T~~ 212 (311)
T PRK08410 190 LEELLKTSDIISIHAPLNE-KTKN 212 (311)
T ss_pred HHHHhhcCCEEEEeCCCCc-hhhc
Confidence 15789999999999999 9997
|
|
| >PLN02928 oxidoreductase family protein | Back alignment and domain information |
|---|
| >COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06487 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK06932 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional | Back alignment and domain information |
|---|
| >PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13243 glyoxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07574 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN03139 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase | Back alignment and domain information |
|---|
| >PLN02306 hydroxypyruvate reductase | Back alignment and domain information |
|---|
| >PRK12480 D-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG0068 consensus D-3-phosphoglycerate dehydrogenase, D-isomer-specific 2-hydroxy acid dehydrogenase superfamily [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08605 D-lactate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional | Back alignment and domain information |
|---|
| >PRK06436 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional | Back alignment and domain information |
|---|
| >PRK00257 erythronate-4-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related | Back alignment and domain information |
|---|
| >PF00389 2-Hacid_dh: D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain; InterPro: IPR006139 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related | Back alignment and domain information |
|---|
| >TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit | Back alignment and domain information |
|---|
| >KOG0067 consensus Transcription factor CtBP [Transcription] | Back alignment and domain information |
|---|
| >PRK08306 dipicolinate synthase subunit A; Reviewed | Back alignment and domain information |
|---|
| >PTZ00075 Adenosylhomocysteinase; Provisional | Back alignment and domain information |
|---|
| >PRK13403 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK05479 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PLN02494 adenosylhomocysteinase | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 | Back alignment and domain information |
|---|
| >TIGR00936 ahcY adenosylhomocysteinase | Back alignment and domain information |
|---|
| >TIGR00465 ilvC ketol-acid reductoisomerase | Back alignment and domain information |
|---|
| >cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) | Back alignment and domain information |
|---|
| >PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05225 ketol-acid reductoisomerase; Validated | Back alignment and domain information |
|---|
| >PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates | Back alignment and domain information |
|---|
| >PLN02712 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 | Back alignment and domain information |
|---|
| >TIGR00518 alaDH alanine dehydrogenase | Back alignment and domain information |
|---|
| >PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02256 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 | Back alignment and domain information |
|---|
| >cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain | Back alignment and domain information |
|---|
| >PRK09414 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08818 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >PLN02712 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK14031 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit | Back alignment and domain information |
|---|
| >PLN02477 glutamate dehydrogenase | Back alignment and domain information |
|---|
| >PLN02545 3-hydroxybutyryl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK07502 cyclohexadienyl dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG0409 consensus Predicted dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B | Back alignment and domain information |
|---|
| >PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK14030 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase | Back alignment and domain information |
|---|
| >PLN02858 fructose-bisphosphate aldolase | Back alignment and domain information |
|---|
| >COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05690 molybdopterin biosynthesis protein MoeB; Provisional | Back alignment and domain information |
|---|
| >TIGR01035 hemA glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA | Back alignment and domain information |
|---|
| >PLN02272 glyceraldehyde-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 | Back alignment and domain information |
|---|
| >PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK05472 redox-sensing transcriptional repressor Rex; Provisional | Back alignment and domain information |
|---|
| >PLN02858 fructose-bisphosphate aldolase | Back alignment and domain information |
|---|
| >PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK06719 precorrin-2 dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02350 phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK00045 hemA glutamyl-tRNA reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK13302 putative L-aspartate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK00258 aroE shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00079 NADP-specific glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related | Back alignment and domain information |
|---|
| >PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06718 precorrin-2 dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated | Back alignment and domain information |
|---|
| >PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain | Back alignment and domain information |
|---|
| >COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07679 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A | Back alignment and domain information |
|---|
| >PF00044 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; InterPro: IPR020828 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate | Back alignment and domain information |
|---|
| >PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed | Back alignment and domain information |
|---|
| >COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05597 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PTZ00431 pyrroline carboxylate reductase; Provisional | Back alignment and domain information |
|---|
| >PLN00203 glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK05600 thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 | Back alignment and domain information |
|---|
| >COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC | Back alignment and domain information |
|---|
| >PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >KOG1370 consensus S-adenosylhomocysteine hydrolase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06249 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC | Back alignment and domain information |
|---|
| >PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 | Back alignment and domain information |
|---|
| >PRK12549 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00507 aroE shikimate 5-dehydrogenase | Back alignment and domain information |
|---|
| >PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK07411 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR02355 moeB molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01921 DAP-DH diaminopimelate dehydrogenase | Back alignment and domain information |
|---|
| >PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional | Back alignment and domain information |
|---|
| >cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like | Back alignment and domain information |
|---|
| >PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional | Back alignment and domain information |
|---|
| >PRK00676 hemA glutamyl-tRNA reductase; Validated | Back alignment and domain information |
|---|
| >PRK08762 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02948 phosphoribosylaminoimidazole carboxylase | Back alignment and domain information |
|---|
| >PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated | Back alignment and domain information |
|---|
| >cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins | Back alignment and domain information |
|---|
| >PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK12548 shikimate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG2380 consensus Prephenate dehydrogenase (NADP+) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 | Back alignment and domain information |
|---|
| >PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate | Back alignment and domain information |
|---|
| >PRK13940 glutamyl-tRNA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06197 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK00066 ldh L-lactate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08644 thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus | Back alignment and domain information |
|---|
| >smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain | Back alignment and domain information |
|---|
| >TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type | Back alignment and domain information |
|---|
| >PRK06153 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14982 acyl-ACP reductase; Provisional | Back alignment and domain information |
|---|
| >COG0027 PurT Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK12828 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08703 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK07523 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p | Back alignment and domain information |
|---|
| >PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional | Back alignment and domain information |
|---|
| >PTZ00245 ubiquitin activating enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >PRK06841 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) | Back alignment and domain information |
|---|
| >PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06523 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase | Back alignment and domain information |
|---|
| >PRK06398 aldose dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] | Back alignment and domain information |
|---|
| >cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E | Back alignment and domain information |
|---|
| >PTZ00117 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase | Back alignment and domain information |
|---|
| >PRK07634 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 | Back alignment and domain information |
|---|
| >PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A | Back alignment and domain information |
|---|
| >cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >PRK06057 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08223 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK06949 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK15116 sulfur acceptor protein CsdL; Provisional | Back alignment and domain information |
|---|
| >COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02780 ketoreductase/ oxidoreductase | Back alignment and domain information |
|---|
| >PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK08264 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05717 oxidoreductase; Validated | Back alignment and domain information |
|---|
| >cd08230 glucose_DH Glucose dehydrogenase | Back alignment and domain information |
|---|
| >PRK07576 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PTZ00082 L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07890 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08265 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0540 PyrB Aspartate carbamoyltransferase, catalytic chain [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06172 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08862 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09880 L-idonate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07060 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase | Back alignment and domain information |
|---|
| >PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK09186 flagellin modification protein A; Provisional | Back alignment and domain information |
|---|
| >PLN00141 Tic62-NAD(P)-related group II protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase | Back alignment and domain information |
|---|
| >PRK08339 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07831 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08628 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07806 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK05562 precorrin-2 dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06125 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PLN02740 Alcohol dehydrogenase-like | Back alignment and domain information |
|---|
| >cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 | Back alignment and domain information |
|---|
| >PRK06114 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07062 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08085 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07856 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02358 glyceraldehyde-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK06138 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07326 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06505 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06079 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PLN02586 probable cinnamyl alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK06124 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e | Back alignment and domain information |
|---|
| >PRK05867 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12429 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein | Back alignment and domain information |
|---|
| >PRK09072 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07774 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate | Back alignment and domain information |
|---|
| >cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme | Back alignment and domain information |
|---|
| >PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like | Back alignment and domain information |
|---|
| >TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PTZ00434 cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08301 alcohol_DH_plants Plant alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK12829 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >PRK07533 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] | Back alignment and domain information |
|---|
| >PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07814 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08594 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06500 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot | Back alignment and domain information |
|---|
| >PLN02178 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK08213 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07825 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12862 malic enzyme; Reviewed | Back alignment and domain information |
|---|
| >PRK08415 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional | Back alignment and domain information |
|---|
| >PLN02253 xanthoxin dehydrogenase | Back alignment and domain information |
|---|
| >PRK06198 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK08278 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02662 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05876 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05866 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0281 SfcA Malic enzyme [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK12939 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12861 malic enzyme; Reviewed | Back alignment and domain information |
|---|
| >cd01493 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APPBP1 | Back alignment and domain information |
|---|
| >PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07889 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14852 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06141 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK06194 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated | Back alignment and domain information |
|---|
| >PRK08589 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase | Back alignment and domain information |
|---|
| >TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial | Back alignment and domain information |
|---|
| >PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional | Back alignment and domain information |
|---|
| >PRK08289 glyceraldehyde-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07478 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09242 tropinone reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07035 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01408 Ube1 ubiquitin-activating enzyme E1 | Back alignment and domain information |
|---|
| >cd08300 alcohol_DH_class_III class III alcohol dehydrogenases | Back alignment and domain information |
|---|
| >COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK07063 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06603 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed | Back alignment and domain information |
|---|
| >cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins | Back alignment and domain information |
|---|
| >cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >PRK12367 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12749 quinate/shikimate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02437 FadB fatty oxidation complex, alpha subunit FadB | Back alignment and domain information |
|---|
| >PRK07577 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05875 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08277 D-mannonate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK13529 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02240 UDP-glucose 4-epimerase | Back alignment and domain information |
|---|
| >cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK06196 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK14027 quinate/shikimate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07067 sorbitol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02896 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK12742 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07984 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05872 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08226 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) | Back alignment and domain information |
|---|
| >PRK05993 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >PLN03154 putative allyl alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08690 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional | Back alignment and domain information |
|---|
| >PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ | Back alignment and domain information |
|---|
| >PRK13394 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08159 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02237 glyceraldehyde-3-phosphate dehydrogenase B | Back alignment and domain information |
|---|
| >PRK10669 putative cation:proton antiport protein; Provisional | Back alignment and domain information |
|---|
| >PRK06720 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06997 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05854 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08303 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase | Back alignment and domain information |
|---|
| >cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members | Back alignment and domain information |
|---|
| >PRK06139 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08936 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1687 consensus NADH-ubiquinone oxidoreductase, NUFS7/PSST/20 kDa subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PTZ00325 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06182 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd05293 LDH_1 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PLN02653 GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK07097 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional | Back alignment and domain information |
|---|
| >PRK09135 pteridine reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02514 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK07985 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PLN02695 GDP-D-mannose-3',5'-epimerase | Back alignment and domain information |
|---|
| >PRK07370 enoyl-(acyl carrier protein) reductase; Validated | Back alignment and domain information |
|---|
| >COG5322 Predicted dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08324 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional | Back alignment and domain information |
|---|
| >PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >TIGR01316 gltA glutamate synthase (NADPH), homotetrameric | Back alignment and domain information |
|---|
| >cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) | Back alignment and domain information |
|---|
| >PRK06180 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06914 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06701 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08234 threonine_DH_like L-threonine dehydrogenase | Back alignment and domain information |
|---|
| >COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK07904 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >PRK07877 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10637 cysG siroheme synthase; Provisional | Back alignment and domain information |
|---|
| >PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK04523 N-acetylornithine carbamoyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10309 galactitol-1-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06179 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase | Back alignment and domain information |
|---|
| >KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12831 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed | Back alignment and domain information |
|---|
| >PLN02827 Alcohol dehydrogenase-like | Back alignment and domain information |
|---|
| >PRK12827 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07454 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases | Back alignment and domain information |
|---|
| >COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases | Back alignment and domain information |
|---|
| >TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial | Back alignment and domain information |
|---|
| >PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03316 ygeW probable carbamoyltransferase YgeW | Back alignment and domain information |
|---|
| >PLN02989 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >PRK07340 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK07453 protochlorophyllide oxidoreductase; Validated | Back alignment and domain information |
|---|
| >TIGR01408 Ube1 ubiquitin-activating enzyme E1 | Back alignment and domain information |
|---|
| >PRK12744 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12935 acetoacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK07109 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02214 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >cd08293 PTGR2 Prostaglandin reductase | Back alignment and domain information |
|---|
| >COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PLN03129 NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK06327 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02730 enoyl-[acyl-carrier-protein] reductase | Back alignment and domain information |
|---|
| >PRK12810 gltD glutamate synthase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >PLN02427 UDP-apiose/xylose synthase | Back alignment and domain information |
|---|
| >PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase | Back alignment and domain information |
|---|
| >PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK12831 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase | Back alignment and domain information |
|---|
| >PLN00106 malate dehydrogenase | Back alignment and domain information |
|---|
| >cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity | Back alignment and domain information |
|---|
| >PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase | Back alignment and domain information |
|---|
| >PRK06128 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PLN02602 lactate dehydrogenase | Back alignment and domain information |
|---|
| >PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] | Back alignment and domain information |
|---|
| >TIGR01316 gltA glutamate synthase (NADPH), homotetrameric | Back alignment and domain information |
|---|
| >PLN02572 UDP-sulfoquinovose synthase | Back alignment and domain information |
|---|
| >TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase | Back alignment and domain information |
|---|
| >PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07791 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13512 coenzyme A disulfide reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14804 ornithine carbamoyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases | Back alignment and domain information |
|---|
| >PTZ00317 NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) | Back alignment and domain information |
|---|
| >COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK12938 acetyacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK01713 ornithine carbamoyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A | Back alignment and domain information |
|---|
| >TIGR01283 nifE nitrogenase molybdenum-iron cofactor biosynthesis protein NifE | Back alignment and domain information |
|---|
| >PRK12937 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06370 mercuric reductase; Validated | Back alignment and domain information |
|---|
| >PTZ00058 glutathione reductase; Provisional | Back alignment and domain information |
|---|
| >cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >PF00185 OTCace: Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain; InterPro: IPR006131 This family contains two related enzymes: Aspartate carbamoyltransferase (2 | Back alignment and domain information |
|---|
| >KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK06116 glutathione reductase; Validated | Back alignment and domain information |
|---|
| >PRK06292 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02172 flavin-containing monooxygenase FMO GS-OX | Back alignment and domain information |
|---|
| >PRK06416 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PLN02206 UDP-glucuronate decarboxylase | Back alignment and domain information |
|---|
| >KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08063 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional | Back alignment and domain information |
|---|
| >PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated | Back alignment and domain information |
|---|
| >PRK07846 mycothione reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK06300 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases | Back alignment and domain information |
|---|
| >PRK12747 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial | Back alignment and domain information |
|---|
| >PRK07201 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02583 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK12550 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05976 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 | Back alignment and domain information |
|---|
| >PRK08618 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK13984 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06115 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK09134 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 210 | ||||
| 2g76_A | 335 | Crystal Structure Of Human 3-Phosphoglycerate Dehyd | 4e-12 | ||
| 2d0i_A | 333 | Crystal Structure Ph0520 Protein From Pyrococcus Ho | 7e-12 | ||
| 2ekl_A | 313 | Structure Of St1218 Protein From Sulfolobus Tokodai | 8e-11 | ||
| 1gdh_A | 320 | Crystal Structure Of A Nad-Dependent D-Glycerate De | 3e-08 | ||
| 3ddn_A | 528 | Crystal Structure Of Hydroxypyruvic Acid Phosphate | 1e-07 | ||
| 1ygy_A | 529 | Crystal Structure Of D-3-Phosphoglycerate Dehydroge | 1e-07 | ||
| 4dgs_A | 340 | The Crystals Structure Of Dehydrogenase From Rhizob | 7e-07 | ||
| 2ome_A | 336 | Crystal Structure Of Human Ctbp2 Dehydrogenase Comp | 7e-07 | ||
| 2gcg_A | 330 | Ternary Crystal Structure Of Human Glyoxylate Reduc | 8e-07 | ||
| 4g2n_A | 345 | Crystal Structure Of Putative D-Isomer Specific 2-H | 9e-07 | ||
| 2h1s_A | 328 | Crystal Structure Of A GlyoxylateHYDROXYPYRUVATE RE | 1e-06 | ||
| 2fss_A | 365 | Candida Boidinii Formate Dehydrogenase (Fdh) K47e M | 6e-06 | ||
| 2j6i_A | 364 | Candida Boidinii Formate Dehydrogenase (Fdh) C-Term | 6e-06 | ||
| 1hl3_A | 358 | CtbpBARS IN TERNARY COMPLEX WITH NAD(H) AND PIDLSKK | 7e-06 | ||
| 1hku_A | 358 | CtbpBARS: A DUAL-Function Protein Involved In Trans | 7e-06 | ||
| 1mx3_A | 347 | Crystal Structure Of Ctbp Dehydrogenase Core Holo F | 9e-06 | ||
| 1dxy_A | 333 | Structure Of D-2-Hydroxyisocaproate Dehydrogenase L | 1e-05 | ||
| 3ba1_A | 333 | Structure Of Hydroxyphenylpyruvate Reductase From C | 1e-05 | ||
| 1wwk_A | 307 | Crystal Structure Of Phosphoglycerate Dehydrogenase | 1e-05 | ||
| 3ga0_A | 358 | Ctbp1BARS GLY172->glu Mutant Structure: Impairing N | 5e-05 | ||
| 2dbr_A | 334 | Crystal Structure Of Glyoxylate Reductase (Ph0597) | 8e-05 | ||
| 2dbq_A | 334 | Crystal Structure Of Glyoxylate Reductase (Ph0597) | 1e-04 | ||
| 3fn4_A | 401 | Apo-form Of Nad-dependent Formate Dehydrogenase Fro | 3e-04 | ||
| 2gsd_A | 402 | Nad-dependent Formate Dehydrogenase From Bacterium | 3e-04 | ||
| 3kb6_A | 334 | Crystal Structure Of D-lactate Dehydrogenase From A | 3e-04 | ||
| 2go1_A | 401 | Nad-Dependent Formate Dehydrogenase From Pseudomona | 3e-04 | ||
| 2nac_A | 393 | High Resolution Structures Of Holo And Apo Formate | 3e-04 | ||
| 2gug_A | 401 | Nad-dependent Formate Dehydrogenase From Pseudomona | 4e-04 | ||
| 2cuk_A | 311 | Crystal Structure Of Tt0316 Protein From Thermus Th | 7e-04 |
| >pdb|2G76|A Chain A, Crystal Structure Of Human 3-Phosphoglycerate Dehydrogenase Length = 335 | Back alignment and structure |
|
| >pdb|2D0I|A Chain A, Crystal Structure Ph0520 Protein From Pyrococcus Horikoshii Ot3 Length = 333 | Back alignment and structure |
| >pdb|2EKL|A Chain A, Structure Of St1218 Protein From Sulfolobus Tokodaii Length = 313 | Back alignment and structure |
| >pdb|1GDH|A Chain A, Crystal Structure Of A Nad-Dependent D-Glycerate Dehydrogenase At 2.4 Angstroms Resolution Length = 320 | Back alignment and structure |
| >pdb|3DDN|A Chain A, Crystal Structure Of Hydroxypyruvic Acid Phosphate Bound D-3- Phosphoglycerate Dehydrogenase In Mycobacterium Tuberculosis Length = 528 | Back alignment and structure |
| >pdb|1YGY|A Chain A, Crystal Structure Of D-3-Phosphoglycerate Dehydrogenase From Mycobacterium Tuberculosis Length = 529 | Back alignment and structure |
| >pdb|4DGS|A Chain A, The Crystals Structure Of Dehydrogenase From Rhizobium Meliloti Length = 340 | Back alignment and structure |
| >pdb|2OME|A Chain A, Crystal Structure Of Human Ctbp2 Dehydrogenase Complexed With Nad(H) Length = 336 | Back alignment and structure |
| >pdb|2GCG|A Chain A, Ternary Crystal Structure Of Human Glyoxylate ReductaseHYDROXYPYRUVATE REDUCTASE Length = 330 | Back alignment and structure |
| >pdb|4G2N|A Chain A, Crystal Structure Of Putative D-Isomer Specific 2-Hydroxyacid Dehydrogenase, Nad-Binding From Polaromonas Sp. Js6 66 Length = 345 | Back alignment and structure |
| >pdb|2H1S|A Chain A, Crystal Structure Of A GlyoxylateHYDROXYPYRUVATE REDUCTASE FROM HOMO Sapiens Length = 328 | Back alignment and structure |
| >pdb|2FSS|A Chain A, Candida Boidinii Formate Dehydrogenase (Fdh) K47e Mutant Length = 365 | Back alignment and structure |
| >pdb|2J6I|A Chain A, Candida Boidinii Formate Dehydrogenase (Fdh) C-Terminal Mutant Length = 364 | Back alignment and structure |
| >pdb|1HL3|A Chain A, CtbpBARS IN TERNARY COMPLEX WITH NAD(H) AND PIDLSKK PEPTIDE Length = 358 | Back alignment and structure |
| >pdb|1HKU|A Chain A, CtbpBARS: A DUAL-Function Protein Involved In Transcription Corepression And Golgi Membrane Fission Length = 358 | Back alignment and structure |
| >pdb|1MX3|A Chain A, Crystal Structure Of Ctbp Dehydrogenase Core Holo Form Length = 347 | Back alignment and structure |
| >pdb|1DXY|A Chain A, Structure Of D-2-Hydroxyisocaproate Dehydrogenase Length = 333 | Back alignment and structure |
| >pdb|3BA1|A Chain A, Structure Of Hydroxyphenylpyruvate Reductase From Coleus Blu Length = 333 | Back alignment and structure |
| >pdb|1WWK|A Chain A, Crystal Structure Of Phosphoglycerate Dehydrogenase From Pyrococcus Horikoshii Ot3 Length = 307 | Back alignment and structure |
| >pdb|3GA0|A Chain A, Ctbp1BARS GLY172->glu Mutant Structure: Impairing Nad(H) Binding And Dimerization Length = 358 | Back alignment and structure |
| >pdb|2DBR|A Chain A, Crystal Structure Of Glyoxylate Reductase (Ph0597) From Pyrococcus Horikoshii Ot3, Complexed With Nadp (P1) Length = 334 | Back alignment and structure |
| >pdb|2DBQ|A Chain A, Crystal Structure Of Glyoxylate Reductase (Ph0597) From Pyrococcus Horikoshii Ot3, Complexed With Nadp (I41) Length = 334 | Back alignment and structure |
| >pdb|3FN4|A Chain A, Apo-form Of Nad-dependent Formate Dehydrogenase From Bacterium Moraxella Sp.c-1 In Closed Conformation Length = 401 | Back alignment and structure |
| >pdb|2GSD|A Chain A, Nad-dependent Formate Dehydrogenase From Bacterium Moraxella Sp.c2 In Complex With Nad And Azide Length = 402 | Back alignment and structure |
| >pdb|3KB6|A Chain A, Crystal Structure Of D-lactate Dehydrogenase From Aquifex Aeolicus Complexed With Nad And Lactic Acid Length = 334 | Back alignment and structure |
| >pdb|2GO1|A Chain A, Nad-Dependent Formate Dehydrogenase From Pseudomonas Sp.101 Length = 401 | Back alignment and structure |
| >pdb|2NAC|A Chain A, High Resolution Structures Of Holo And Apo Formate Dehydrogenase Length = 393 | Back alignment and structure |
| >pdb|2GUG|A Chain A, Nad-dependent Formate Dehydrogenase From Pseudomonas Sp.101 In Complex With Formate Length = 401 | Back alignment and structure |
| >pdb|2CUK|A Chain A, Crystal Structure Of Tt0316 Protein From Thermus Thermophilus Hb8 Length = 311 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 210 | |||
| 2nac_A | 393 | NAD-dependent formate dehydrogenase; oxidoreductas | 2e-27 | |
| 3jtm_A | 351 | Formate dehydrogenase, mitochondrial; mitochondrio | 3e-27 | |
| 1qp8_A | 303 | Formate dehydrogenase; oxidoreductase; HET: NDP; 2 | 3e-26 | |
| 2pi1_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 3e-26 | |
| 2g76_A | 335 | 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor | 3e-26 | |
| 2j6i_A | 364 | Formate dehydrogenase; oxidoreductase, D-specific- | 7e-26 | |
| 2ekl_A | 313 | D-3-phosphoglycerate dehydrogenase; structural gen | 7e-26 | |
| 1wwk_A | 307 | Phosphoglycerate dehydrogenase; riken structural g | 1e-25 | |
| 1ygy_A | 529 | PGDH, D-3-phosphoglycerate dehydrogenase; oxidored | 6e-25 | |
| 2d0i_A | 333 | Dehydrogenase; structural genomics, NPPSFA, nation | 7e-25 | |
| 3gvx_A | 290 | Glycerate dehydrogenase related protein; NYSGXRC, | 8e-25 | |
| 1mx3_A | 347 | CTBP1, C-terminal binding protein 1; nuclear prote | 2e-24 | |
| 2dbq_A | 334 | Glyoxylate reductase; D-3-phosphoglycerate dehydro | 3e-24 | |
| 3evt_A | 324 | Phosphoglycerate dehydrogenase; structural genomic | 3e-24 | |
| 2cuk_A | 311 | Glycerate dehydrogenase/glyoxylate reductase; stru | 4e-24 | |
| 1xdw_A | 331 | NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas | 9e-24 | |
| 1j4a_A | 333 | D-LDH, D-lactate dehydrogenase; NAD-dependent dehy | 1e-23 | |
| 1dxy_A | 333 | D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc | 1e-23 | |
| 1sc6_A | 404 | PGDH, D-3-phosphoglycerate dehydrogenase; alloster | 3e-23 | |
| 1gdh_A | 320 | D-glycerate dehydrogenase; oxidoreductase(CHOH (D) | 7e-23 | |
| 3k5p_A | 416 | D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, | 8e-23 | |
| 4e5n_A | 330 | Thermostable phosphite dehydrogenase; D-2-hydroxya | 9e-23 | |
| 4dgs_A | 340 | Dehydrogenase; structural genomics, PSI-biology, N | 5e-22 | |
| 3ba1_A | 333 | HPPR, hydroxyphenylpyruvate reductase; two domain | 6e-21 | |
| 3gg9_A | 352 | D-3-phosphoglycerate dehydrogenase oxidoreductase; | 8e-21 | |
| 2w2k_A | 348 | D-mandelate dehydrogenase; 2-hydroxyacid dehydroge | 9e-21 | |
| 3oet_A | 381 | Erythronate-4-phosphate dehydrogenase; structural | 1e-20 | |
| 4g2n_A | 345 | D-isomer specific 2-hydroxyacid dehydrogenase, Na; | 1e-20 | |
| 2gcg_A | 330 | Glyoxylate reductase/hydroxypyruvate reductase; NA | 1e-20 | |
| 2o4c_A | 380 | Erythronate-4-phosphate dehydrogenase; erythronate | 1e-19 | |
| 3hg7_A | 324 | D-isomer specific 2-hydroxyacid dehydrogenase FAM | 5e-14 | |
| 3pp8_A | 315 | Glyoxylate/hydroxypyruvate reductase A; structural | 3e-12 | |
| 3d4o_A | 293 | Dipicolinate synthase subunit A; NP_243269.1, stru | 3e-08 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 9e-06 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 7e-05 | |
| 1leh_A | 364 | Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi | 3e-04 | |
| 1c1d_A | 355 | L-phenylalanine dehydrogenase; amino acid dehydrog | 4e-04 |
| >2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Length = 393 | Back alignment and structure |
|---|
Score = 106 bits (267), Expect = 2e-27
Identities = 36/158 (22%), Positives = 63/158 (39%), Gaps = 15/158 (9%)
Query: 39 IQVDVVPISDVPD-----VIANYHLCVVKTM---RLDSNCISRANQMKLIMQFGVGLEGV 90
+ V D PD + + + + + L I++A +KL + G+G + V
Sbjct: 68 HTLVVTSDKDGPDSVFERELVDADVVISQPFWPAYLTPERIAKAKNLKLALTAGIGSDHV 127
Query: 91 DINAATRCGIKVARIPGDVTGNAASCAELTIYLMLGLLRKQNEMRMAIEQ----KKLGVP 146
D+ +A + VA + N+ S AE + ++L L+R + V
Sbjct: 128 DLQSAIDRNVTVAEVTY---CNSISVAEHVVMMILSLVRNYLPSHEWARKGGWNIADCVS 184
Query: 147 TGETLLGKTVFILGFGNIGVELAKRLRPFGVKIIATKR 184
L V + G IG+ + +RL PF V + T R
Sbjct: 185 HAYDLEAMHVGTVAAGRIGLAVLRRLAPFDVHLHYTDR 222
|
| >3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Length = 351 | Back alignment and structure |
|---|
| >1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Length = 303 | Back alignment and structure |
|---|
| >2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Length = 335 | Back alignment and structure |
|---|
| >2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Length = 364 | Back alignment and structure |
|---|
| >2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Length = 313 | Back alignment and structure |
|---|
| >1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Length = 307 | Back alignment and structure |
|---|
| >1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Length = 529 | Back alignment and structure |
|---|
| >2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Length = 333 | Back alignment and structure |
|---|
| >3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Length = 290 | Back alignment and structure |
|---|
| >1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Length = 347 | Back alignment and structure |
|---|
| >2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Length = 334 | Back alignment and structure |
|---|
| >3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Length = 324 | Back alignment and structure |
|---|
| >2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Length = 311 | Back alignment and structure |
|---|
| >1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Length = 331 | Back alignment and structure |
|---|
| >1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Length = 333 | Back alignment and structure |
|---|
| >1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Length = 333 | Back alignment and structure |
|---|
| >1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Length = 404 | Back alignment and structure |
|---|
| >1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Length = 320 | Back alignment and structure |
|---|
| >3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Length = 416 | Back alignment and structure |
|---|
| >4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Length = 330 | Back alignment and structure |
|---|
| >4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Length = 340 | Back alignment and structure |
|---|
| >3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Length = 333 | Back alignment and structure |
|---|
| >3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Length = 352 | Back alignment and structure |
|---|
| >2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Length = 348 | Back alignment and structure |
|---|
| >3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Length = 381 | Back alignment and structure |
|---|
| >4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Length = 345 | Back alignment and structure |
|---|
| >2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Length = 330 | Back alignment and structure |
|---|
| >2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Length = 380 | Back alignment and structure |
|---|
| >3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Length = 324 | Back alignment and structure |
|---|
| >3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Length = 315 | Back alignment and structure |
|---|
| >3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Length = 293 | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Length = 286 | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Length = 286 | Back alignment and structure |
|---|
| >1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Length = 364 | Back alignment and structure |
|---|
| >1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Length = 355 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 210 | |||
| 3kb6_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 100.0 | |
| 4g2n_A | 345 | D-isomer specific 2-hydroxyacid dehydrogenase, Na; | 100.0 | |
| 3hg7_A | 324 | D-isomer specific 2-hydroxyacid dehydrogenase FAM | 100.0 | |
| 2pi1_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 100.0 | |
| 3evt_A | 324 | Phosphoglycerate dehydrogenase; structural genomic | 100.0 | |
| 4e5n_A | 330 | Thermostable phosphite dehydrogenase; D-2-hydroxya | 100.0 | |
| 2yq5_A | 343 | D-isomer specific 2-hydroxyacid dehydrogenase; oxi | 100.0 | |
| 4dgs_A | 340 | Dehydrogenase; structural genomics, PSI-biology, N | 100.0 | |
| 3k5p_A | 416 | D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, | 100.0 | |
| 3pp8_A | 315 | Glyoxylate/hydroxypyruvate reductase A; structural | 100.0 | |
| 1sc6_A | 404 | PGDH, D-3-phosphoglycerate dehydrogenase; alloster | 100.0 | |
| 1j4a_A | 333 | D-LDH, D-lactate dehydrogenase; NAD-dependent dehy | 100.0 | |
| 2g76_A | 335 | 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor | 100.0 | |
| 1dxy_A | 333 | D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc | 100.0 | |
| 1wwk_A | 307 | Phosphoglycerate dehydrogenase; riken structural g | 100.0 | |
| 3jtm_A | 351 | Formate dehydrogenase, mitochondrial; mitochondrio | 100.0 | |
| 2ekl_A | 313 | D-3-phosphoglycerate dehydrogenase; structural gen | 100.0 | |
| 1xdw_A | 331 | NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas | 100.0 | |
| 3gg9_A | 352 | D-3-phosphoglycerate dehydrogenase oxidoreductase; | 100.0 | |
| 2cuk_A | 311 | Glycerate dehydrogenase/glyoxylate reductase; stru | 100.0 | |
| 1gdh_A | 320 | D-glycerate dehydrogenase; oxidoreductase(CHOH (D) | 100.0 | |
| 4hy3_A | 365 | Phosphoglycerate oxidoreductase; PSI-biology, stru | 100.0 | |
| 2nac_A | 393 | NAD-dependent formate dehydrogenase; oxidoreductas | 100.0 | |
| 1mx3_A | 347 | CTBP1, C-terminal binding protein 1; nuclear prote | 100.0 | |
| 3ba1_A | 333 | HPPR, hydroxyphenylpyruvate reductase; two domain | 100.0 | |
| 2gcg_A | 330 | Glyoxylate reductase/hydroxypyruvate reductase; NA | 100.0 | |
| 2w2k_A | 348 | D-mandelate dehydrogenase; 2-hydroxyacid dehydroge | 100.0 | |
| 2j6i_A | 364 | Formate dehydrogenase; oxidoreductase, D-specific- | 100.0 | |
| 2d0i_A | 333 | Dehydrogenase; structural genomics, NPPSFA, nation | 100.0 | |
| 2dbq_A | 334 | Glyoxylate reductase; D-3-phosphoglycerate dehydro | 100.0 | |
| 1ygy_A | 529 | PGDH, D-3-phosphoglycerate dehydrogenase; oxidored | 100.0 | |
| 1qp8_A | 303 | Formate dehydrogenase; oxidoreductase; HET: NDP; 2 | 100.0 | |
| 3gvx_A | 290 | Glycerate dehydrogenase related protein; NYSGXRC, | 100.0 | |
| 3oet_A | 381 | Erythronate-4-phosphate dehydrogenase; structural | 100.0 | |
| 2o4c_A | 380 | Erythronate-4-phosphate dehydrogenase; erythronate | 99.97 | |
| 3d4o_A | 293 | Dipicolinate synthase subunit A; NP_243269.1, stru | 99.9 | |
| 2rir_A | 300 | Dipicolinate synthase, A chain; structural genomic | 99.84 | |
| 1v8b_A | 479 | Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 | 99.6 | |
| 3d64_A | 494 | Adenosylhomocysteinase; structural genomics, ssgci | 99.6 | |
| 2vhw_A | 377 | Alanine dehydrogenase; NAD, secreted, oxidoreducta | 99.44 | |
| 1x13_A | 401 | NAD(P) transhydrogenase subunit alpha; NAD(H)-bind | 99.24 | |
| 1l7d_A | 384 | Nicotinamide nucleotide transhydrogenase, subunit | 99.19 | |
| 3ce6_A | 494 | Adenosylhomocysteinase; protein-substrate complex, | 99.15 | |
| 2eez_A | 369 | Alanine dehydrogenase; TTHA0216, structural genomi | 99.02 | |
| 3h9u_A | 436 | Adenosylhomocysteinase; NAD CO-factor complex, str | 98.93 | |
| 1gpj_A | 404 | Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro | 98.73 | |
| 3n58_A | 464 | Adenosylhomocysteinase; ssgcid, hydrolase, structu | 98.69 | |
| 1gtm_A | 419 | Glutamate dehydrogenase; oxidoreductase, NAD, NADP | 98.64 | |
| 3gvp_A | 435 | Adenosylhomocysteinase 3; protein CO-factor comple | 98.58 | |
| 1c1d_A | 355 | L-phenylalanine dehydrogenase; amino acid dehydrog | 98.23 | |
| 2pv7_A | 298 | T-protein [includes: chorismate mutase (EC 5.4.99 | 98.07 | |
| 2raf_A | 209 | Putative dinucleotide-binding oxidoreductase; NP_7 | 98.0 | |
| 3ond_A | 488 | Adenosylhomocysteinase; plant protein, enzyme-subs | 97.98 | |
| 3dtt_A | 245 | NADP oxidoreductase; structural genomics, joint ce | 97.94 | |
| 4dio_A | 405 | NAD(P) transhydrogenase subunit alpha PART 1; stru | 97.92 | |
| 2d5c_A | 263 | AROE, shikimate 5-dehydrogenase; substrate, dimer, | 97.92 | |
| 1pjc_A | 361 | Protein (L-alanine dehydrogenase); oxidoreductase, | 97.9 | |
| 3p2y_A | 381 | Alanine dehydrogenase/pyridine nucleotide transhy; | 97.86 | |
| 1leh_A | 364 | Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi | 97.82 | |
| 1np3_A | 338 | Ketol-acid reductoisomerase; A DEEP figure-OF-eigh | 97.8 | |
| 3doj_A | 310 | AT3G25530, dehydrogenase-like protein; gamma-hydro | 97.74 | |
| 3fr7_A | 525 | Putative ketol-acid reductoisomerase (OS05G057370 | 97.72 | |
| 4gbj_A | 297 | 6-phosphogluconate dehydrogenase NAD-binding; stru | 97.63 | |
| 4ezb_A | 317 | Uncharacterized conserved protein; structural geno | 97.61 | |
| 3l6d_A | 306 | Putative oxidoreductase; structural genomics, prot | 97.55 | |
| 2hk9_A | 275 | Shikimate dehydrogenase; shikimate pathway, drug d | 97.54 | |
| 3ggo_A | 314 | Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b | 97.54 | |
| 4dll_A | 320 | 2-hydroxy-3-oxopropionate reductase; structural ge | 97.5 | |
| 3qha_A | 296 | Putative oxidoreductase; seattle structural genomi | 97.48 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 97.41 | |
| 3q2o_A | 389 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 97.38 | |
| 2yjz_A | 201 | Metalloreductase steap4; oxidoreductase, metabolic | 96.49 | |
| 3qsg_A | 312 | NAD-binding phosphogluconate dehydrogenase-like P; | 97.35 | |
| 3g0o_A | 303 | 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine | 97.34 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 97.33 | |
| 3obb_A | 300 | Probable 3-hydroxyisobutyrate dehydrogenase; struc | 97.33 | |
| 3ktd_A | 341 | Prephenate dehydrogenase; structural genomics, joi | 97.23 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 97.12 | |
| 4e21_A | 358 | 6-phosphogluconate dehydrogenase (decarboxylating; | 97.11 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 97.1 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 97.06 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 97.03 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 97.02 | |
| 3c24_A | 286 | Putative oxidoreductase; YP_511008.1, structural g | 97.02 | |
| 4e12_A | 283 | Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 | 96.99 | |
| 2h78_A | 302 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 | 96.99 | |
| 3d1l_A | 266 | Putative NADP oxidoreductase BF3122; structural ge | 96.91 | |
| 4huj_A | 220 | Uncharacterized protein; PSI-biology, nysgrc, stru | 96.91 | |
| 2vns_A | 215 | Metalloreductase steap3; metal-binding, transmembr | 96.91 | |
| 1zej_A | 293 | HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural | 96.86 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 96.86 | |
| 3orq_A | 377 | N5-carboxyaminoimidazole ribonucleotide synthetas; | 96.84 | |
| 3h9e_O | 346 | Glyceraldehyde-3-phosphate dehydrogenase, testis-; | 96.84 | |
| 3don_A | 277 | Shikimate dehydrogenase; alpha-beta structure, ros | 96.84 | |
| 3k6j_A | 460 | Protein F01G10.3, confirmed by transcript evidenc; | 96.83 | |
| 1jw9_B | 249 | Molybdopterin biosynthesis MOEB protein; MOEB: mod | 96.77 | |
| 2zyd_A | 480 | 6-phosphogluconate dehydrogenase, decarboxylating; | 96.71 | |
| 2uyy_A | 316 | N-PAC protein; long-chain dehydrogenase, cytokine; | 96.71 | |
| 2ahr_A | 259 | Putative pyrroline carboxylate reductase; pyrrolin | 96.68 | |
| 3cky_A | 301 | 2-hydroxymethyl glutarate dehydrogenase; rossmann | 96.65 | |
| 2rcy_A | 262 | Pyrroline carboxylate reductase; malaria, structur | 96.62 | |
| 4gwg_A | 484 | 6-phosphogluconate dehydrogenase, decarboxylating; | 96.62 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 96.54 | |
| 3b1f_A | 290 | Putative prephenate dehydrogenase; enzyme, 4-hydro | 96.54 | |
| 1vpd_A | 299 | Tartronate semialdehyde reductase; structural geno | 96.52 | |
| 2egg_A | 297 | AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff | 96.48 | |
| 1nyt_A | 271 | Shikimate 5-dehydrogenase; alpha/beta domains, WID | 96.45 | |
| 3phh_A | 269 | Shikimate dehydrogenase; shikimate pathway, helico | 96.45 | |
| 3tri_A | 280 | Pyrroline-5-carboxylate reductase; amino acid bios | 96.42 | |
| 1f0y_A | 302 | HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive | 96.4 | |
| 1nvt_A | 287 | Shikimate 5'-dehydrogenase; structural genomics, P | 96.4 | |
| 2dpo_A | 319 | L-gulonate 3-dehydrogenase; structural genomics, N | 96.39 | |
| 3aog_A | 440 | Glutamate dehydrogenase; NAD(H), oxidoreducta; HET | 96.39 | |
| 1v9l_A | 421 | Glutamate dehydrogenase; protein-NAD complex, oxid | 96.38 | |
| 3dfu_A | 232 | Uncharacterized protein from 6-phosphogluconate de | 96.34 | |
| 3p2o_A | 285 | Bifunctional protein fold; structural genomics, ce | 96.29 | |
| 2p4q_A | 497 | 6-phosphogluconate dehydrogenase, decarboxylating; | 96.22 | |
| 2ew2_A | 316 | 2-dehydropantoate 2-reductase, putative; alpha-str | 96.2 | |
| 3l07_A | 285 | Bifunctional protein fold; structural genomics, ID | 96.18 | |
| 2c2x_A | 281 | Methylenetetrahydrofolate dehydrogenase- methenylt | 96.18 | |
| 2yfq_A | 421 | Padgh, NAD-GDH, NAD-specific glutamate dehydrogena | 96.17 | |
| 1b0a_A | 288 | Protein (fold bifunctional protein); folate, dehyd | 96.15 | |
| 1bg6_A | 359 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L | 96.14 | |
| 3k92_A | 424 | NAD-GDH, NAD-specific glutamate dehydrogenase; ROC | 96.12 | |
| 1y81_A | 138 | Conserved hypothetical protein; hyperthermophIle, | 96.11 | |
| 1yb4_A | 295 | Tartronic semialdehyde reductase; structural genom | 96.11 | |
| 2iz1_A | 474 | 6-phosphogluconate dehydrogenase, decarboxylating; | 96.11 | |
| 1edz_A | 320 | 5,10-methylenetetrahydrofolate dehydrogenase; nucl | 96.1 | |
| 3aoe_E | 419 | Glutamate dehydrogenase; rossmann fold, NADH, oxid | 96.1 | |
| 1evy_A | 366 | Glycerol-3-phosphate dehydrogenase; rossmann fold, | 96.1 | |
| 1zud_1 | 251 | Adenylyltransferase THIF; thiamin, thiazole, prote | 96.1 | |
| 3ngx_A | 276 | Bifunctional protein fold; methylenetetrahydrofola | 96.05 | |
| 4a5o_A | 286 | Bifunctional protein fold; oxidoreductase, hydrola | 96.04 | |
| 4a26_A | 300 | Putative C-1-tetrahydrofolate synthase, cytoplasm; | 96.02 | |
| 2izz_A | 322 | Pyrroline-5-carboxylate reductase 1; amino-acid bi | 96.01 | |
| 3o8q_A | 281 | Shikimate 5-dehydrogenase I alpha; structural geno | 96.0 | |
| 3pid_A | 432 | UDP-glucose 6-dehydrogenase; rossmann fold, oxidor | 95.94 | |
| 2tmg_A | 415 | Protein (glutamate dehydrogenase); metabolic role, | 95.91 | |
| 1a4i_A | 301 | Methylenetetrahydrofolate dehydrogenase / methenyl | 95.91 | |
| 1p77_A | 272 | Shikimate 5-dehydrogenase; NADPH, oxidoreductase; | 95.88 | |
| 4fcc_A | 450 | Glutamate dehydrogenase; protein complex, rossmann | 95.79 | |
| 3pwz_A | 272 | Shikimate dehydrogenase 3; alpha-beta, oxidoreduct | 95.76 | |
| 3tnl_A | 315 | Shikimate dehydrogenase; structural genomics, cent | 95.73 | |
| 4e4t_A | 419 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 95.73 | |
| 1z82_A | 335 | Glycerol-3-phosphate dehydrogenase; TM0378, struct | 95.69 | |
| 1kyq_A | 274 | Met8P, siroheme biosynthesis protein Met8; homodim | 95.66 | |
| 3dfz_A | 223 | SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase | 95.65 | |
| 2q3e_A | 467 | UDP-glucose 6-dehydrogenase; hexamer, structural g | 95.65 | |
| 3lk7_A | 451 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; a | 95.64 | |
| 3k96_A | 356 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA | 95.52 | |
| 3jyo_A | 283 | Quinate/shikimate dehydrogenase; enzyme-cofactor c | 95.5 | |
| 3u62_A | 253 | Shikimate dehydrogenase; shikimate pathway, oxidor | 95.5 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 95.49 | |
| 1zcj_A | 463 | Peroxisomal bifunctional enzyme; peroxisomal multi | 95.45 | |
| 1x0v_A | 354 | GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase | 95.45 | |
| 3fbt_A | 282 | Chorismate mutase and shikimate 5-dehydrogenase fu | 95.43 | |
| 2duw_A | 145 | Putative COA-binding protein; ligand binding prote | 95.42 | |
| 2i99_A | 312 | MU-crystallin homolog; thyroid hormine binding pro | 95.41 | |
| 3mog_A | 483 | Probable 3-hydroxybutyryl-COA dehydrogenase; struc | 95.41 | |
| 1yj8_A | 375 | Glycerol-3-phosphate dehydrogenase; SGPP, structur | 95.4 | |
| 3mw9_A | 501 | GDH 1, glutamate dehydrogenase 1; allostery, inhib | 95.31 | |
| 2qyt_A | 317 | 2-dehydropantoate 2-reductase; APC81190, porphyrom | 95.31 | |
| 3ghy_A | 335 | Ketopantoate reductase protein; oxidoreductase, NA | 95.3 | |
| 2z2v_A | 365 | Hypothetical protein PH1688; L-lysine dehydrogenas | 95.29 | |
| 3t4e_A | 312 | Quinate/shikimate dehydrogenase; structural genomi | 95.25 | |
| 2bma_A | 470 | Glutamate dehydrogenase (NADP+); malaria, drug des | 95.2 | |
| 4a7p_A | 446 | UDP-glucose dehydrogenase; oxidoreductase, carbohy | 95.13 | |
| 3ado_A | 319 | Lambda-crystallin; L-gulonate 3-dehydrogenase, str | 95.13 | |
| 3two_A | 348 | Mannitol dehydrogenase; cinnamyl-alcohol dehydroge | 95.09 | |
| 2cdc_A | 366 | Glucose dehydrogenase glucose 1-dehydrogenase, DHG | 95.08 | |
| 2aef_A | 234 | Calcium-gated potassium channel MTHK; rossmann fol | 95.07 | |
| 1yqd_A | 366 | Sinapyl alcohol dehydrogenase; lignin, monolignol, | 95.07 | |
| 1bgv_A | 449 | Glutamate dehydrogenase; oxidoreductase; HET: GLU; | 95.03 | |
| 3g79_A | 478 | NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; | 95.02 | |
| 3h8v_A | 292 | Ubiquitin-like modifier-activating enzyme 5; rossm | 95.0 | |
| 3l9w_A | 413 | Glutathione-regulated potassium-efflux system Pro | 94.91 | |
| 2y0c_A | 478 | BCEC, UDP-glucose dehydrogenase; oxidoreductase, c | 94.89 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 94.86 | |
| 1piw_A | 360 | Hypothetical zinc-type alcohol dehydrogenase- like | 94.82 | |
| 3ulk_A | 491 | Ketol-acid reductoisomerase; branched-chain amino | 94.75 | |
| 3r3j_A | 456 | Glutamate dehydrogenase; rossman fold, oxidoreduct | 94.68 | |
| 2ewd_A | 317 | Lactate dehydrogenase,; protein-substrate_cofactor | 94.53 | |
| 3rui_A | 340 | Ubiquitin-like modifier-activating enzyme ATG7; au | 94.53 | |
| 3hwr_A | 318 | 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A | 94.52 | |
| 4fs3_A | 256 | Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; | 94.49 | |
| 1lu9_A | 287 | Methylene tetrahydromethanopterin dehydrogenase; a | 94.46 | |
| 1uuf_A | 369 | YAHK, zinc-type alcohol dehydrogenase-like protein | 94.38 | |
| 3nrc_A | 280 | Enoyl-[acyl-carrier-protein] reductase (NADH); ros | 94.33 | |
| 3ojo_A | 431 | CAP5O; rossmann fold, complex with cofactor NAD an | 94.33 | |
| 1pjq_A | 457 | CYSG, siroheme synthase; rossman fold, nucleotide | 94.31 | |
| 2o3j_A | 481 | UDP-glucose 6-dehydrogenase; structural genomics, | 94.27 | |
| 2we8_A | 386 | Xanthine dehydrogenase; oxidoreductase; 2.30A {Myc | 94.25 | |
| 1pqw_A | 198 | Polyketide synthase; rossmann fold, dimer, structu | 94.23 | |
| 2wtb_A | 725 | MFP2, fatty acid multifunctional protein (ATMFP2); | 94.22 | |
| 1y8q_A | 346 | Ubiquitin-like 1 activating enzyme E1A; SUMO, hete | 94.22 | |
| 3vtz_A | 269 | Glucose 1-dehydrogenase; rossmann fold, oxidoreduc | 94.2 | |
| 2cf5_A | 357 | Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign | 94.15 | |
| 1rjw_A | 339 | ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD | 94.15 | |
| 1lld_A | 319 | L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N | 94.13 | |
| 3rd5_A | 291 | Mypaa.01249.C; ssgcid, structural genomics, seattl | 94.12 | |
| 3e5r_O | 337 | PP38, glyceraldehyde-3-phosphate dehydrogenase, cy | 94.11 | |
| 1ff9_A | 450 | Saccharopine reductase; lysine biosynthesis, alpha | 94.11 | |
| 2x5o_A | 439 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; A | 94.11 | |
| 3v8b_A | 283 | Putative dehydrogenase, possibly 3-oxoacyl-[acyl- | 94.1 | |
| 4gcm_A | 312 | TRXR, thioredoxin reductase; FAD/NAD-linked reduct | 94.1 | |
| 1e3i_A | 376 | Alcohol dehydrogenase, class II; HET: NAD; 2.08A { | 94.04 | |
| 1e3j_A | 352 | NADP(H)-dependent ketose reductase; oxidoreductase | 94.03 | |
| 3eag_A | 326 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME | 94.01 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 94.0 | |
| 1pl8_A | 356 | Human sorbitol dehydrogenase; NAD, oxidoreductase; | 94.0 | |
| 2axq_A | 467 | Saccharopine dehydrogenase; rossmann fold variant, | 93.98 | |
| 2jhf_A | 374 | Alcohol dehydrogenase E chain; oxidoreductase, met | 93.96 | |
| 1cdo_A | 374 | Alcohol dehydrogenase; oxidoreductase, oxidoreduct | 93.95 | |
| 3s2e_A | 340 | Zinc-containing alcohol dehydrogenase superfamily; | 93.93 | |
| 3uog_A | 363 | Alcohol dehydrogenase; structural genomics, protei | 93.92 | |
| 1wdk_A | 715 | Fatty oxidation complex alpha subunit; alpha2BETA2 | 93.91 | |
| 2d8a_A | 348 | PH0655, probable L-threonine 3-dehydrogenase; pyro | 93.91 | |
| 3bio_A | 304 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 93.84 | |
| 3on5_A | 362 | BH1974 protein; structural genomics, joint center | 93.84 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 93.79 | |
| 1p0f_A | 373 | NADP-dependent alcohol dehydrogenase; ADH topology | 93.76 | |
| 3k5i_A | 403 | Phosphoribosyl-aminoimidazole carboxylase; purine | 93.75 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 93.73 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 93.7 | |
| 2fzw_A | 373 | Alcohol dehydrogenase class III CHI chain; S-nitro | 93.67 | |
| 3cps_A | 354 | Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g | 93.6 | |
| 2z1m_A | 345 | GDP-D-mannose dehydratase; short-chain dehydrogena | 93.58 | |
| 3goh_A | 315 | Alcohol dehydrogenase, zinc-containing; NP_718042. | 93.57 | |
| 2dq4_A | 343 | L-threonine 3-dehydrogenase; NAD-dependent, oxidor | 93.55 | |
| 1iz0_A | 302 | Quinone oxidoreductase; APO-enzyme, riken structur | 93.49 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 93.47 | |
| 4gsl_A | 615 | Ubiquitin-like modifier-activating enzyme ATG7; ub | 93.47 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 93.46 | |
| 1vl6_A | 388 | Malate oxidoreductase; TM0542, NAD-dependent malic | 93.44 | |
| 3abi_A | 365 | Putative uncharacterized protein PH1688; L-lysine | 93.39 | |
| 2hcy_A | 347 | Alcohol dehydrogenase 1; tetramer of asymmetric di | 93.38 | |
| 4a5l_A | 314 | Thioredoxin reductase; oxidoreductase, redox metab | 93.37 | |
| 2o23_A | 265 | HADH2 protein; HSD17B10, schad, ERAB, type II HADH | 93.35 | |
| 1npy_A | 271 | Hypothetical shikimate 5-dehydrogenase-like protei | 93.31 | |
| 2h6e_A | 344 | ADH-4, D-arabinose 1-dehydrogenase; rossman fold, | 93.3 | |
| 2dph_A | 398 | Formaldehyde dismutase; dismutation of aldehydes, | 93.29 | |
| 1o5i_A | 249 | 3-oxoacyl-(acyl carrier protein) reductase; TM1169 | 93.28 | |
| 1v3u_A | 333 | Leukotriene B4 12- hydroxydehydrogenase/prostaglan | 93.28 | |
| 3qy9_A | 243 | DHPR, dihydrodipicolinate reductase; rossmann fold | 93.25 | |
| 3uko_A | 378 | Alcohol dehydrogenase class-3; alcohol dehydrogena | 93.22 | |
| 2h7i_A | 269 | Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi | 93.21 | |
| 2pd4_A | 275 | Enoyl-[acyl-carrier-protein] reductase [NADH]; ant | 93.19 | |
| 1j5p_A | 253 | Aspartate dehydrogenase; TM1643, structural genomi | 93.19 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 93.18 | |
| 3vh1_A | 598 | Ubiquitin-like modifier-activating enzyme ATG7; au | 93.14 | |
| 1kol_A | 398 | Formaldehyde dehydrogenase; oxidoreductase; HET: N | 93.12 | |
| 2d59_A | 144 | Hypothetical protein PH1109; COA binding, structur | 93.1 | |
| 1f06_A | 320 | MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH | 93.07 | |
| 3ip1_A | 404 | Alcohol dehydrogenase, zinc-containing; structural | 93.06 | |
| 3d3w_A | 244 | L-xylulose reductase; uronate cycle, short-chain d | 93.02 | |
| 2vt3_A | 215 | REX, redox-sensing transcriptional repressor REX; | 93.02 | |
| 4b7c_A | 336 | Probable oxidoreductase; NADP cofactor, rossmann f | 93.0 | |
| 3fpc_A | 352 | NADP-dependent alcohol dehydrogenase; oxydoreducta | 92.99 | |
| 3hja_A | 356 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n | 92.97 | |
| 1cyd_A | 244 | Carbonyl reductase; short-chain dehydrogenase, oxi | 92.97 | |
| 3grp_A | 266 | 3-oxoacyl-(acyl carrierprotein) reductase; structu | 92.96 | |
| 3ppi_A | 281 | 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de | 92.95 | |
| 3db2_A | 354 | Putative NADPH-dependent oxidoreductase; two domai | 92.95 | |
| 3f1l_A | 252 | Uncharacterized oxidoreductase YCIK; E. coli, NADP | 92.93 | |
| 3orf_A | 251 | Dihydropteridine reductase; alpha-beta-alpha sandw | 92.91 | |
| 3tpc_A | 257 | Short chain alcohol dehydrogenase-related dehydro; | 92.88 | |
| 1ooe_A | 236 | Dihydropteridine reductase; structural genomics, P | 92.88 | |
| 2dtx_A | 264 | Glucose 1-dehydrogenase related protein; rossmann | 92.86 | |
| 3rwb_A | 247 | TPLDH, pyridoxal 4-dehydrogenase; short chain dehy | 92.83 | |
| 4eye_A | 342 | Probable oxidoreductase; structural genomics, niai | 92.83 | |
| 3vps_A | 321 | TUNA, NAD-dependent epimerase/dehydratase; tunicam | 92.82 | |
| 2wsb_A | 254 | Galactitol dehydrogenase; oxidoreductase, SDR, ros | 92.8 | |
| 3un1_A | 260 | Probable oxidoreductase; structural genomics, PSI- | 92.8 | |
| 2hjr_A | 328 | Malate dehydrogenase; malaria, structural genomics | 92.78 | |
| 3qiv_A | 253 | Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR | 92.78 | |
| 1h2b_A | 359 | Alcohol dehydrogenase; oxidoreductase, archaea, hy | 92.76 | |
| 2b5w_A | 357 | Glucose dehydrogenase; nucleotide binding motif, o | 92.75 | |
| 1tlt_A | 319 | Putative oxidoreductase (virulence factor MVIM HO; | 92.75 | |
| 3gms_A | 340 | Putative NADPH:quinone reductase; structural genom | 92.73 | |
| 3h7a_A | 252 | Short chain dehydrogenase; oxidoreductase, PSI-2, | 92.72 | |
| 1vj0_A | 380 | Alcohol dehydrogenase, zinc-containing; TM0436, st | 92.71 | |
| 3nzo_A | 399 | UDP-N-acetylglucosamine 4,6-dehydratase; structura | 92.69 | |
| 4ej6_A | 370 | Putative zinc-binding dehydrogenase; structural ge | 92.69 | |
| 3ek2_A | 271 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 92.68 | |
| 1f8f_A | 371 | Benzyl alcohol dehydrogenase; rossmann fold, oxido | 92.68 | |
| 1iuk_A | 140 | Hypothetical protein TT1466; structural genomics, | 92.67 | |
| 1h5q_A | 265 | NADP-dependent mannitol dehydrogenase; oxidoreduct | 92.64 | |
| 3awd_A | 260 | GOX2181, putative polyol dehydrogenase; oxidoreduc | 92.63 | |
| 3nv9_A | 487 | Malic enzyme; rossmann fold, oxidoreductase; 2.25A | 92.63 | |
| 4h15_A | 261 | Short chain alcohol dehydrogenase-related dehydro; | 92.62 | |
| 3tzq_B | 271 | Short-chain type dehydrogenase/reductase; ssgcid, | 92.62 | |
| 2j3h_A | 345 | NADP-dependent oxidoreductase P1; double bond redu | 92.62 | |
| 3uxy_A | 266 | Short-chain dehydrogenase/reductase SDR; structura | 92.61 | |
| 3euw_A | 344 | MYO-inositol dehydrogenase; protein structure init | 92.58 | |
| 3rft_A | 267 | Uronate dehydrogenase; apoenzyme, rossmann fold, N | 92.57 | |
| 3e03_A | 274 | Short chain dehydrogenase; structural genomics, PS | 92.57 | |
| 3m6i_A | 363 | L-arabinitol 4-dehydrogenase; medium chain dehydro | 92.57 | |
| 2dt5_A | 211 | AT-rich DNA-binding protein; REX, NADH, NAD, rossm | 92.54 | |
| 1dhr_A | 241 | Dihydropteridine reductase; oxidoreductase(acting | 92.53 | |
| 1xg5_A | 279 | ARPG836; short chain dehydrogenase, human, SGC, st | 92.52 | |
| 1vl8_A | 267 | Gluconate 5-dehydrogenase; TM0441, structural geno | 92.52 | |
| 2q1w_A | 333 | Putative nucleotide sugar epimerase/ dehydratase; | 92.5 | |
| 3oig_A | 266 | Enoyl-[acyl-carrier-protein] reductase [NADH]; fat | 92.48 | |
| 2fwm_X | 250 | 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e | 92.45 | |
| 3gwf_A | 540 | Cyclohexanone monooxygenase; flavoprotein biocatal | 92.45 | |
| 1rkx_A | 357 | CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; | 92.44 | |
| 3fbg_A | 346 | Putative arginate lyase; structural genomics, unkn | 92.44 | |
| 2q2v_A | 255 | Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore | 92.44 | |
| 4hkt_A | 331 | Inositol 2-dehydrogenase; structural genomics, nys | 92.43 | |
| 2c07_A | 285 | 3-oxoacyl-(acyl-carrier protein) reductase; oxidor | 92.43 | |
| 3k31_A | 296 | Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI | 92.42 | |
| 3sc4_A | 285 | Short chain dehydrogenase (A0QTM2 homolog); ssgcid | 92.41 | |
| 3vtf_A | 444 | UDP-glucose 6-dehydrogenase; two discrete alpha/be | 92.36 | |
| 1yb1_A | 272 | 17-beta-hydroxysteroid dehydrogenase type XI; shor | 92.33 | |
| 2d1y_A | 256 | Hypothetical protein TT0321; strucrtural genomics, | 92.3 | |
| 2pd6_A | 264 | Estradiol 17-beta-dehydrogenase 8; short-chain deh | 92.27 | |
| 2a9f_A | 398 | Putative malic enzyme ((S)-malate:NAD+ oxidoreduct | 92.27 | |
| 1uzm_A | 247 | 3-oxoacyl-[acyl-carrier protein] reductase; beta-k | 92.27 | |
| 3qwb_A | 334 | Probable quinone oxidoreductase; rossmann fold, qu | 92.27 | |
| 3i1j_A | 247 | Oxidoreductase, short chain dehydrogenase/reducta; | 92.24 | |
| 1u8f_O | 335 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l | 92.23 | |
| 1yb5_A | 351 | Quinone oxidoreductase; medium-chain dehydrogenase | 92.22 | |
| 3afn_B | 258 | Carbonyl reductase; alpha/beta/alpha, rossmann-fol | 92.21 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 92.21 | |
| 3kvo_A | 346 | Hydroxysteroid dehydrogenase-like protein 2; HSDL2 | 92.2 | |
| 1u7z_A | 226 | Coenzyme A biosynthesis bifunctional protein coabc | 92.2 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 92.18 | |
| 2a35_A | 215 | Hypothetical protein PA4017; alpha-beta-alpha sand | 92.17 | |
| 3ai3_A | 263 | NADPH-sorbose reductase; rossmann-fold, NADPH-depe | 92.16 | |
| 2ew8_A | 249 | (S)-1-phenylethanol dehydrogenase; transferase; 2. | 92.15 | |
| 3ak4_A | 263 | NADH-dependent quinuclidinone reductase; SDR, (R)- | 92.14 | |
| 1pzg_A | 331 | LDH, lactate dehydrogenase; apicomplexa, APAD, tet | 92.14 | |
| 3q2i_A | 354 | Dehydrogenase; rossmann fold, UDP-sugar binding, N | 92.13 | |
| 2nm0_A | 253 | Probable 3-oxacyl-(acyl-carrier-protein) reductas; | 92.1 | |
| 3tl2_A | 315 | Malate dehydrogenase; center for structural genomi | 92.09 | |
| 3gem_A | 260 | Short chain dehydrogenase; structural genomics, AP | 92.08 | |
| 4fn4_A | 254 | Short chain dehydrogenase; NADH-binding, rossmann | 92.05 | |
| 4fc7_A | 277 | Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman | 92.05 | |
| 3t7c_A | 299 | Carveol dehydrogenase; structural genomics, seattl | 92.05 | |
| 4imr_A | 275 | 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor | 92.02 | |
| 1hdc_A | 254 | 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi | 92.02 | |
| 1iy8_A | 267 | Levodione reductase; oxidoreductase; HET: NAD; 1.6 | 92.0 | |
| 4e6p_A | 259 | Probable sorbitol dehydrogenase (L-iditol 2-dehyd; | 91.97 | |
| 3slg_A | 372 | PBGP3 protein; structural genomics, seattle struct | 91.95 | |
| 1zk4_A | 251 | R-specific alcohol dehydrogenase; short chain redu | 91.94 | |
| 1fmc_A | 255 | 7 alpha-hydroxysteroid dehydrogenase; short-chain | 91.93 | |
| 1xq6_A | 253 | Unknown protein; structural genomics, protein stru | 91.92 | |
| 3p7m_A | 321 | Malate dehydrogenase; putative dehydrogenase, enzy | 91.9 | |
| 3imf_A | 257 | Short chain dehydrogenase; structural genomics, in | 91.89 | |
| 3pxx_A | 287 | Carveol dehydrogenase; structural genomics, seattl | 91.88 | |
| 3r1i_A | 276 | Short-chain type dehydrogenase/reductase; structur | 91.86 | |
| 1zem_A | 262 | Xylitol dehydrogenase; rossmann fold, dinucleotide | 91.86 | |
| 1w6u_A | 302 | 2,4-dienoyl-COA reductase, mitochondrial precursor | 91.85 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 91.85 | |
| 3n74_A | 261 | 3-ketoacyl-(acyl-carrier-protein) reductase; seatt | 91.84 | |
| 3qlj_A | 322 | Short chain dehydrogenase; structural genomics, se | 91.83 | |
| 3ijr_A | 291 | Oxidoreductase, short chain dehydrogenase/reducta; | 91.82 | |
| 1sny_A | 267 | Sniffer CG10964-PA; alpha and beta protein, rossma | 91.82 | |
| 1uls_A | 245 | Putative 3-oxoacyl-acyl carrier protein reductase; | 91.81 | |
| 1xu9_A | 286 | Corticosteroid 11-beta-dehydrogenase, isozyme 1; h | 91.8 | |
| 2wyu_A | 261 | Enoyl-[acyl carrier protein] reductase; oxidoreduc | 91.79 | |
| 3s55_A | 281 | Putative short-chain dehydrogenase/reductase; stru | 91.78 | |
| 3uve_A | 286 | Carveol dehydrogenase ((+)-trans-carveol dehydrog; | 91.78 | |
| 4eso_A | 255 | Putative oxidoreductase; NADP, structural genomics | 91.78 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 91.77 | |
| 2eih_A | 343 | Alcohol dehydrogenase; zinc ION binding protein, s | 91.76 | |
| 3sxp_A | 362 | ADP-L-glycero-D-mannoheptose-6-epimerase; rossman | 91.76 | |
| 3jyn_A | 325 | Quinone oxidoreductase; rossmann fold, protein-NAD | 91.76 | |
| 2ae2_A | 260 | Protein (tropinone reductase-II); oxidoreductase, | 91.72 | |
| 1qsg_A | 265 | Enoyl-[acyl-carrier-protein] reductase; enoyl redu | 91.7 | |
| 4a7p_A | 446 | UDP-glucose dehydrogenase; oxidoreductase, carbohy | 91.7 | |
| 3lf2_A | 265 | Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross | 91.69 | |
| 2c0c_A | 362 | Zinc binding alcohol dehydrogenase, domain contain | 91.69 | |
| 3lyl_A | 247 | 3-oxoacyl-(acyl-carrier-protein) reductase; alpha | 91.69 | |
| 3svt_A | 281 | Short-chain type dehydrogenase/reductase; ssgcid, | 91.67 | |
| 3tjr_A | 301 | Short chain dehydrogenase; structural genomics, se | 91.66 | |
| 2bgk_A | 278 | Rhizome secoisolariciresinol dehydrogenase; oxidor | 91.66 | |
| 2jah_A | 247 | Clavulanic acid dehydrogenase; short-chain dehydro | 91.66 | |
| 3zv4_A | 281 | CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox | 91.65 | |
| 2z1n_A | 260 | Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 | 91.65 | |
| 2j8z_A | 354 | Quinone oxidoreductase; medium-chain dehydrogenase | 91.64 | |
| 3ucx_A | 264 | Short chain dehydrogenase; ssgcid, seattle structu | 91.63 | |
| 3ftp_A | 270 | 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid | 91.61 | |
| 3f9i_A | 249 | 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto | 91.58 | |
| 1t2d_A | 322 | LDH-P, L-lactate dehydrogenase; ternary complex, o | 91.58 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 91.58 | |
| 2p91_A | 285 | Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD | 91.58 | |
| 1qor_A | 327 | Quinone oxidoreductase; HET: NAP; 2.20A {Escherich | 91.56 | |
| 3sx2_A | 278 | Putative 3-ketoacyl-(acyl-carrier-protein) reduct; | 91.55 | |
| 3uox_A | 545 | Otemo; baeyer-villiger monooxygenase, oxidoreducta | 91.55 | |
| 1hxh_A | 253 | 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b | 91.54 | |
| 2a4k_A | 263 | 3-oxoacyl-[acyl carrier protein] reductase; reduct | 91.53 | |
| 1tt5_A | 531 | APPBP1, amyloid protein-binding protein 1; cell cy | 91.53 | |
| 2zat_A | 260 | Dehydrogenase/reductase SDR family member 4; alpha | 91.51 | |
| 4iin_A | 271 | 3-ketoacyl-acyl carrier protein reductase (FABG); | 91.51 | |
| 4fgs_A | 273 | Probable dehydrogenase protein; PSI-biology, nysgr | 91.48 | |
| 2dvm_A | 439 | Malic enzyme, 439AA long hypothetical malate oxido | 91.48 | |
| 3grk_A | 293 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 91.48 | |
| 2b4q_A | 276 | Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier | 91.48 | |
| 3gvi_A | 324 | Malate dehydrogenase; NAD, oxidoreductase, tricarb | 91.47 | |
| 4dqx_A | 277 | Probable oxidoreductase protein; structural genomi | 91.47 | |
| 2ag5_A | 246 | DHRS6, dehydrogenase/reductase (SDR family) member | 91.46 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 91.44 | |
| 2b69_A | 343 | UDP-glucuronate decarboxylase 1; UDP-glucoronic ac | 91.44 | |
| 2rhc_B | 277 | Actinorhodin polyketide ketoreductase; oxidoreduct | 91.44 | |
| 1sby_A | 254 | Alcohol dehydrogenase; ternary complex, NAD, trifl | 91.43 | |
| 3uce_A | 223 | Dehydrogenase; rossmann fold, oxidoreductase; HET: | 91.41 | |
| 3ctm_A | 279 | Carbonyl reductase; alcohol dehydrogenase, short-c | 91.4 | |
| 1ldn_A | 316 | L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA | 91.4 | |
| 2o2s_A | 315 | Enoyl-acyl carrier reductase; enoyl reductase, tri | 91.39 | |
| 1ae1_A | 273 | Tropinone reductase-I; oxidoreductase, tropane alk | 91.39 | |
| 2q1s_A | 377 | Putative nucleotide sugar epimerase/ dehydratase; | 91.39 | |
| 3zwc_A | 742 | Peroxisomal bifunctional enzyme; beta oxidation pa | 91.38 | |
| 4dup_A | 353 | Quinone oxidoreductase; PSI-biology, structural ge | 91.35 | |
| 1nff_A | 260 | Putative oxidoreductase RV2002; directed evolution | 91.35 | |
| 3e9m_A | 330 | Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, | 91.33 | |
| 3vku_A | 326 | L-LDH, L-lactate dehydrogenase; rossmann fold, NAD | 91.32 | |
| 1yxm_A | 303 | Pecra, peroxisomal trans 2-enoyl COA reductase; pe | 91.31 | |
| 3e9n_A | 245 | Putative short-chain dehydrogenase/reductase; stru | 91.31 | |
| 1yde_A | 270 | Retinal dehydrogenase/reductase 3; oxidoreductase, | 91.27 | |
| 2o7s_A | 523 | DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat | 91.25 | |
| 4hv4_A | 494 | UDP-N-acetylmuramate--L-alanine ligase; MURC, yers | 91.25 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 91.22 | |
| 1sb8_A | 352 | WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN | 91.22 | |
| 3ec7_A | 357 | Putative dehydrogenase; alpha-beta, structural gen | 91.21 | |
| 4gkb_A | 258 | 3-oxoacyl-[acyl-carrier protein] reductase; putati | 91.2 | |
| 3uf0_A | 273 | Short-chain dehydrogenase/reductase SDR; gluconate | 91.18 | |
| 4da9_A | 280 | Short-chain dehydrogenase/reductase; structural ge | 91.18 | |
| 3op4_A | 248 | 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto | 91.16 | |
| 3hdj_A | 313 | Probable ornithine cyclodeaminase; APC62486, borde | 91.16 | |
| 4dry_A | 281 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 91.16 | |
| 3pk0_A | 262 | Short-chain dehydrogenase/reductase SDR; ssgcid, s | 91.14 | |
| 1xa0_A | 328 | Putative NADPH dependent oxidoreductases; structur | 91.13 | |
| 3evn_A | 329 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 91.11 | |
| 3ioy_A | 319 | Short-chain dehydrogenase/reductase SDR; structura | 91.09 | |
| 3h5n_A | 353 | MCCB protein; ubiquitin-activating enzyme, microci | 91.06 | |
| 3l6e_A | 235 | Oxidoreductase, short-chain dehydrogenase/reducta; | 91.03 | |
| 1jvb_A | 347 | NAD(H)-dependent alcohol dehydrogenase; archaeon, | 91.02 | |
| 1omo_A | 322 | Alanine dehydrogenase; two-domain, beta-sandwich-d | 91.02 | |
| 2gdz_A | 267 | NAD+-dependent 15-hydroxyprostaglandin dehydrogen; | 91.01 | |
| 1kjq_A | 391 | GART 2, phosphoribosylglycinamide formyltransferas | 91.01 | |
| 1gee_A | 261 | Glucose 1-dehydrogenase; short-chain dehydrogenase | 91.0 | |
| 3nyw_A | 250 | Putative oxidoreductase; fatty acid synthesis,3-ox | 90.98 | |
| 4ap3_A | 549 | Steroid monooxygenase; oxidoreductase, baeyer-vill | 90.95 | |
| 3pqe_A | 326 | L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas | 90.93 | |
| 3pgx_A | 280 | Carveol dehydrogenase; structural genomics, seattl | 90.92 | |
| 3keo_A | 212 | Redox-sensing transcriptional repressor REX; DNA b | 90.92 | |
| 3gvc_A | 277 | Oxidoreductase, probable short-chain type dehydrog | 90.91 | |
| 1y8q_B | 640 | Anthracycline-, ubiquitin-like 2 activating enzyme | 90.89 | |
| 2qq5_A | 260 | DHRS1, dehydrogenase/reductase SDR family member 1 | 90.89 | |
| 3rih_A | 293 | Short chain dehydrogenase or reductase; structural | 90.88 | |
| 3tox_A | 280 | Short chain dehydrogenase; structural genomics, PS | 90.86 | |
| 3ksu_A | 262 | 3-oxoacyl-acyl carrier protein reductase; structur | 90.85 | |
| 3gaf_A | 256 | 7-alpha-hydroxysteroid dehydrogenase; seattle stru | 90.81 | |
| 1tt7_A | 330 | YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st | 90.79 | |
| 3t4x_A | 267 | Oxidoreductase, short chain dehydrogenase/reducta; | 90.79 | |
| 3p19_A | 266 | BFPVVD8, putative blue fluorescent protein; rossma | 90.73 | |
| 2hq1_A | 247 | Glucose/ribitol dehydrogenase; CTH-1438, structura | 90.71 | |
| 3c1a_A | 315 | Putative oxidoreductase; ZP_00056571.1, oxidoreduc | 90.7 | |
| 2zb4_A | 357 | Prostaglandin reductase 2; rossmann fold, alternat | 90.67 | |
| 4egf_A | 266 | L-xylulose reductase; structural genomics, ssgcid, | 90.67 | |
| 3cxt_A | 291 | Dehydrogenase with different specificities; rossma | 90.67 | |
| 1wly_A | 333 | CAAR, 2-haloacrylate reductase; NADPH-dependent ox | 90.65 | |
| 2pnf_A | 248 | 3-oxoacyl-[acyl-carrier-protein] reductase; short | 90.65 | |
| 3gdg_A | 267 | Probable NADP-dependent mannitol dehydrogenase; ro | 90.65 | |
| 3uuw_A | 308 | Putative oxidoreductase with NAD(P)-binding rossm | 90.6 | |
| 4ibo_A | 271 | Gluconate dehydrogenase; enzyme function initiativ | 90.6 | |
| 1x1t_A | 260 | D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S | 90.56 | |
| 1xq1_A | 266 | Putative tropinone reducatse; structural genomics, | 90.51 | |
| 3v2h_A | 281 | D-beta-hydroxybutyrate dehydrogenase; structural g | 90.49 | |
| 1yo6_A | 250 | Putative carbonyl reductase sniffer; tyrosine-depe | 90.47 | |
| 4g81_D | 255 | Putative hexonate dehydrogenase; enzyme function i | 90.46 | |
| 2f00_A | 491 | UDP-N-acetylmuramate--L-alanine ligase; amide bond | 90.43 | |
| 1oaa_A | 259 | Sepiapterin reductase; tetrahydrobiopterin, oxidor | 90.36 | |
| 3tfo_A | 264 | Putative 3-oxoacyl-(acyl-carrier-protein) reducta; | 90.34 | |
| 4gx0_A | 565 | TRKA domain protein; membrane protein, ION channel | 90.32 | |
| 3jv7_A | 345 | ADH-A; dehydrogenase, nucleotide binding, rossmann | 90.3 | |
| 3m2t_A | 359 | Probable dehydrogenase; PSI, SGXNY, structural gen | 90.29 | |
| 3cea_A | 346 | MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore | 90.27 | |
| 3rc1_A | 350 | Sugar 3-ketoreductase; sugar biosynthesis, TDP bin | 90.27 | |
| 2ptg_A | 319 | Enoyl-acyl carrier reductase; apicomplexa, enoyl ( | 90.26 | |
| 3tsc_A | 277 | Putative oxidoreductase; structural genomics, seat | 90.24 | |
| 1d7o_A | 297 | Enoyl-[acyl-carrier protein] reductase (NADH) PRE; | 90.19 | |
| 3o26_A | 311 | Salutaridine reductase; short chain dehydrogenase/ | 90.19 | |
| 1ja9_A | 274 | 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p | 90.19 | |
| 2wm3_A | 299 | NMRA-like family domain containing protein 1; unkn | 90.16 | |
| 4b79_A | 242 | PA4098, probable short-chain dehydrogenase; oxidor | 90.15 | |
| 1xkq_A | 280 | Short-chain reductase family member (5D234); parra | 90.14 | |
| 3enk_A | 341 | UDP-glucose 4-epimerase; seattle structural genomi | 90.14 | |
| 3oec_A | 317 | Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; | 90.14 | |
| 3e18_A | 359 | Oxidoreductase; dehydrogenase, NAD-binding, struct | 90.11 | |
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 90.07 | |
| 3tl3_A | 257 | Short-chain type dehydrogenase/reductase; ssgcid, | 90.03 | |
| 2vn8_A | 375 | Reticulon-4-interacting protein 1; mitochondrion, | 90.02 | |
| 3nkl_A | 141 | UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo | 89.96 | |
| 3r3s_A | 294 | Oxidoreductase; structural genomics, csgid, center | 89.96 | |
| 3sju_A | 279 | Keto reductase; short-chain dehydrogenase, oxidore | 89.93 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 89.9 | |
| 1ys4_A | 354 | Aspartate-semialdehyde dehydrogenase; oxidoreducta | 89.83 | |
| 1spx_A | 278 | Short-chain reductase family member (5L265); paral | 89.82 |
| >3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} | Back alignment and structure |
|---|
Probab=100.00 E-value=5e-41 Score=287.56 Aligned_cols=192 Identities=22% Similarity=0.320 Sum_probs=162.5
Q ss_pred ceEEEeCCCCCCchhhHHHHhhcCCCeEEecCCCCC-hhhhcCCceEEEEc-CCCCCHHHHhcCCCceEEEEccccCCcc
Q 028314 13 TRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISD-VPDVIANYHLCVVK-TMRLDSNCISRANQMKLIMQFGVGLEGV 90 (210)
Q Consensus 13 ~~ili~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~-~~~~~~~adv~i~~-~~~~~~~~l~~~p~Lk~i~~~~aG~d~i 90 (210)
|+|+++....++ .++.++.++.+ .+++...+..+ ..+.++++|++++. ..++++++++++|+||||++.|+|+|+|
T Consensus 1 Mkil~~~~~~~~-~p~~~e~l~~~-~~~~~~~~~~~~~~~~l~~ad~i~v~~~~~i~~~~l~~~p~Lk~I~~~~~G~d~i 78 (334)
T 3kb6_A 1 MNVLFTSVPQED-VPFYQEALKDL-SLKIYTTDVSKVPENELKKAELISVFVYDKLTEELLSKMPRLKLIHTRSVGFDHI 78 (334)
T ss_dssp -CEEECSCCTTH-HHHHHHHTTTS-CEEECSSCGGGSCHHHHHHCSEEEECTTSCBCHHHHHTCTTCCEEEESSSCCTTB
T ss_pred CEEEEeCCCccc-CHHHHHHHHhC-CcEEEeCCcccCCHHHhcCCCEEEEeCCCCCCHHHHhcCCCCcEEEECCcccchh
Confidence 689998755433 55556666554 34443333222 23557889988874 5679999999999999999999999999
Q ss_pred chhHHhhCCcEEEecCCCCCCCchhHHHHHHHHHHHHHhhHHHHHHHHHhCCCCCC---cccccccCeEEEEecChHHHH
Q 028314 91 DINAATRCGIKVARIPGDVTGNAASCAELTIYLMLGLLRKQNEMRMAIEQKKLGVP---TGETLLGKTVFILGFGNIGVE 167 (210)
Q Consensus 91 d~~~~~~~gi~v~~~~~~~~~~a~~vAE~~l~~~L~~~R~~~~~~~~~~~~~w~~~---~~~~l~~~tvGIiG~G~IG~~ 167 (210)
|++++.++||.|+|+||+ ++.+||||+++++|++.|++..+++.++++.|... .+.+|+|+||||||+|+||++
T Consensus 79 d~~~~~~~gI~v~n~p~~---~~~~vAE~~~~l~L~~~r~~~~~~~~~~~~~~~~~~~~~~~~l~g~tvGIiG~G~IG~~ 155 (334)
T 3kb6_A 79 DLDYCKKKGILVTHIPAY---SPESVAEHTFAMILTLVKRLKRIEDRVKKLNFSQDSEILARELNRLTLGVIGTGRIGSR 155 (334)
T ss_dssp CHHHHHHHTCEEECCTTS---CHHHHHHHHHHHHHHHHTTHHHHHHHHHTTCCCCCGGGCBCCGGGSEEEEECCSHHHHH
T ss_pred cHHHHHHCCCEEEECCCc---CcHHHHHHHHHHHHHHhhccccccccccccccccccccccceecCcEEEEECcchHHHH
Confidence 999999999999999999 88999999999999999999999999999987643 668999999999999999999
Q ss_pred HHHHhccCCCEEEEEcCCCCCC-------------CcccCceeEEecCCCCCCCCC
Q 028314 168 LAKRLRPFGVKIIATKRSWASH-------------SQVSCQSSGMLGPLSDGETHH 210 (210)
Q Consensus 168 vA~~~~~fg~~V~~~~~~~~~~-------------~~~~~~~~~~~~Plt~~~T~h 210 (210)
+|+++++|||+|++||++.++. ++.++|.+++.||+|+ +|+|
T Consensus 156 va~~~~~fg~~v~~~d~~~~~~~~~~~~~~~~l~ell~~sDivslh~Plt~-~T~~ 210 (334)
T 3kb6_A 156 VAMYGLAFGMKVLCYDVVKREDLKEKGCVYTSLDELLKESDVISLHVPYTK-ETHH 210 (334)
T ss_dssp HHHHHHHTTCEEEEECSSCCHHHHHTTCEECCHHHHHHHCSEEEECCCCCT-TTTT
T ss_pred HHHhhcccCceeeecCCccchhhhhcCceecCHHHHHhhCCEEEEcCCCCh-hhcc
Confidence 9999999999999999976532 5778999999999999 9998
|
| >4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} | Back alignment and structure |
|---|
| >3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} | Back alignment and structure |
|---|
| >3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* | Back alignment and structure |
|---|
| >2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* | Back alignment and structure |
|---|
| >4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A | Back alignment and structure |
|---|
| >1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* | Back alignment and structure |
|---|
| >1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* | Back alignment and structure |
|---|
| >2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A | Back alignment and structure |
|---|
| >2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} | Back alignment and structure |
|---|
| >3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} | Back alignment and structure |
|---|
| >2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A | Back alignment and structure |
|---|
| >1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* | Back alignment and structure |
|---|
| >3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* | Back alignment and structure |
|---|
| >2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A | Back alignment and structure |
|---|
| >2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B | Back alignment and structure |
|---|
| >2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A | Back alignment and structure |
|---|
| >2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* | Back alignment and structure |
|---|
| >1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* | Back alignment and structure |
|---|
| >1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 | Back alignment and structure |
|---|
| >3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* | Back alignment and structure |
|---|
| >2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* | Back alignment and structure |
|---|
| >1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* | Back alignment and structure |
|---|
| >1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* | Back alignment and structure |
|---|
| >3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* | Back alignment and structure |
|---|
| >2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* | Back alignment and structure |
|---|
| >1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 | Back alignment and structure |
|---|
| >3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A | Back alignment and structure |
|---|
| >3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* | Back alignment and structure |
|---|
| >1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* | Back alignment and structure |
|---|
| >2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* | Back alignment and structure |
|---|
| >3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} | Back alignment and structure |
|---|
| >4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* | Back alignment and structure |
|---|
| >1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A | Back alignment and structure |
|---|
| >3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 | Back alignment and structure |
|---|
| >1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 | Back alignment and structure |
|---|
| >3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* | Back alignment and structure |
|---|
| >4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A | Back alignment and structure |
|---|
| >3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* | Back alignment and structure |
|---|
| >4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} | Back alignment and structure |
|---|
| >3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* | Back alignment and structure |
|---|
| >2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* | Back alignment and structure |
|---|
| >3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} | Back alignment and structure |
|---|
| >4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* | Back alignment and structure |
|---|
| >3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* | Back alignment and structure |
|---|
| >1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A | Back alignment and structure |
|---|
| >3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* | Back alignment and structure |
|---|
| >3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* | Back alignment and structure |
|---|
| >3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* | Back alignment and structure |
|---|
| >2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* | Back alignment and structure |
|---|
| >2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A | Back alignment and structure |
|---|
| >3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} | Back alignment and structure |
|---|
| >2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A | Back alignment and structure |
|---|
| >1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* | Back alignment and structure |
|---|
| >3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* | Back alignment and structure |
|---|
| >1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A | Back alignment and structure |
|---|
| >1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 | Back alignment and structure |
|---|
| >3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} | Back alignment and structure |
|---|
| >2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A | Back alignment and structure |
|---|
| >2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} | Back alignment and structure |
|---|
| >1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 | Back alignment and structure |
|---|
| >1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 | Back alignment and structure |
|---|
| >3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A | Back alignment and structure |
|---|
| >1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 | Back alignment and structure |
|---|
| >1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* | Back alignment and structure |
|---|
| >1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* | Back alignment and structure |
|---|
| >3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* | Back alignment and structure |
|---|
| >1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A | Back alignment and structure |
|---|
| >3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A | Back alignment and structure |
|---|
| >4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} | Back alignment and structure |
|---|
| >2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* | Back alignment and structure |
|---|
| >3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* | Back alignment and structure |
|---|
| >3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* | Back alignment and structure |
|---|
| >2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A | Back alignment and structure |
|---|
| >1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* | Back alignment and structure |
|---|
| >1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* | Back alignment and structure |
|---|
| >4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E | Back alignment and structure |
|---|
| >3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* | Back alignment and structure |
|---|
| >4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A | Back alignment and structure |
|---|
| >1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 | Back alignment and structure |
|---|
| >3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} | Back alignment and structure |
|---|
| >2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A | Back alignment and structure |
|---|
| >3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A | Back alignment and structure |
|---|
| >3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* | Back alignment and structure |
|---|
| >3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} SCOP: c.2.1.7 c.58.1.1 PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* | Back alignment and structure |
|---|
| >2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* | Back alignment and structure |
|---|
| >2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} | Back alignment and structure |
|---|
| >3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* | Back alignment and structure |
|---|
| >3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* | Back alignment and structure |
|---|
| >2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A | Back alignment and structure |
|---|
| >1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* | Back alignment and structure |
|---|
| >1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A | Back alignment and structure |
|---|
| >3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} | Back alignment and structure |
|---|
| >3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* | Back alignment and structure |
|---|
| >3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* | Back alignment and structure |
|---|
| >2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A | Back alignment and structure |
|---|
| >3ulk_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, rossmann fold, acetolactate, oxidoreductase; HET: CSX NDP; 2.30A {Escherichia coli} PDB: 1yrl_A* | Back alignment and structure |
|---|
| >3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A | Back alignment and structure |
|---|
| >3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* | Back alignment and structure |
|---|
| >3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A | Back alignment and structure |
|---|
| >1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* | Back alignment and structure |
|---|
| >1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* | Back alignment and structure |
|---|
| >3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* | Back alignment and structure |
|---|
| >1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* | Back alignment and structure |
|---|
| >2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2we8_A Xanthine dehydrogenase; oxidoreductase; 2.30A {Mycobacterium smegmatis} PDB: 2we7_A | Back alignment and structure |
|---|
| >1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 | Back alignment and structure |
|---|
| >2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* | Back alignment and structure |
|---|
| >3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* | Back alignment and structure |
|---|
| >1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A | Back alignment and structure |
|---|
| >1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* | Back alignment and structure |
|---|
| >3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} | Back alignment and structure |
|---|
| >3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O | Back alignment and structure |
|---|
| >1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A | Back alignment and structure |
|---|
| >2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* | Back alignment and structure |
|---|
| >3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* | Back alignment and structure |
|---|
| >1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A | Back alignment and structure |
|---|
| >2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... | Back alignment and structure |
|---|
| >1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* | Back alignment and structure |
|---|
| >3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} | Back alignment and structure |
|---|
| >1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* | Back alignment and structure |
|---|
| >2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* | Back alignment and structure |
|---|
| >3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3on5_A BH1974 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, oxidoreductase; 2.80A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* | Back alignment and structure |
|---|
| >3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* | Back alignment and structure |
|---|
| >3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* | Back alignment and structure |
|---|
| >2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* | Back alignment and structure |
|---|
| >3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* | Back alignment and structure |
|---|
| >1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A | Back alignment and structure |
|---|
| >4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* | Back alignment and structure |
|---|
| >3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* | Back alignment and structure |
|---|
| >2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* | Back alignment and structure |
|---|
| >1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} | Back alignment and structure |
|---|
| >1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* | Back alignment and structure |
|---|
| >3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... | Back alignment and structure |
|---|
| >2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* | Back alignment and structure |
|---|
| >1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A | Back alignment and structure |
|---|
| >1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* | Back alignment and structure |
|---|
| >1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* | Back alignment and structure |
|---|
| >3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* | Back alignment and structure |
|---|
| >2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* | Back alignment and structure |
|---|
| >4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* | Back alignment and structure |
|---|
| >3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A | Back alignment and structure |
|---|
| >3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} | Back alignment and structure |
|---|
| >1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A | Back alignment and structure |
|---|
| >3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} | Back alignment and structure |
|---|
| >3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A | Back alignment and structure |
|---|
| >3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A | Back alignment and structure |
|---|
| >3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* | Back alignment and structure |
|---|
| >4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} | Back alignment and structure |
|---|
| >2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* | Back alignment and structure |
|---|
| >3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* | Back alignment and structure |
|---|
| >1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 | Back alignment and structure |
|---|
| >3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* | Back alignment and structure |
|---|
| >3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A | Back alignment and structure |
|---|
| >1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} | Back alignment and structure |
|---|
| >3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* | Back alignment and structure |
|---|
| >3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* | Back alignment and structure |
|---|
| >3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* | Back alignment and structure |
|---|
| >3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} | Back alignment and structure |
|---|
| >2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* | Back alignment and structure |
|---|
| >1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* | Back alignment and structure |
|---|
| >1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* | Back alignment and structure |
|---|
| >2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* | Back alignment and structure |
|---|
| >1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* | Back alignment and structure |
|---|
| >3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} | Back alignment and structure |
|---|
| >2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A | Back alignment and structure |
|---|
| >4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* | Back alignment and structure |
|---|
| >3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} | Back alignment and structure |
|---|
| >1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A | Back alignment and structure |
|---|
| >3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* | Back alignment and structure |
|---|
| >3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 | Back alignment and structure |
|---|
| >1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* | Back alignment and structure |
|---|
| >2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* | Back alignment and structure |
|---|
| >3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* | Back alignment and structure |
|---|
| >3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* | Back alignment and structure |
|---|
| >2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* | Back alignment and structure |
|---|
| >3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} | Back alignment and structure |
|---|
| >4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* | Back alignment and structure |
|---|
| >1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A | Back alignment and structure |
|---|
| >3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A | Back alignment and structure |
|---|
| >1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* | Back alignment and structure |
|---|
| >1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* | Back alignment and structure |
|---|
| >3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} | Back alignment and structure |
|---|
| >3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* | Back alignment and structure |
|---|
| >1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... | Back alignment and structure |
|---|
| >2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* | Back alignment and structure |
|---|
| >3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* | Back alignment and structure |
|---|
| >4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} | Back alignment and structure |
|---|
| >2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* | Back alignment and structure |
|---|
| >2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* | Back alignment and structure |
|---|
| >1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* | Back alignment and structure |
|---|
| >4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} | Back alignment and structure |
|---|
| >3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* | Back alignment and structure |
|---|
| >2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* | Back alignment and structure |
|---|
| >3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* | Back alignment and structure |
|---|
| >2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* | Back alignment and structure |
|---|
| >3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* | Back alignment and structure |
|---|
| >2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* | Back alignment and structure |
|---|
| >3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
| >2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* | Back alignment and structure |
|---|
| >1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* | Back alignment and structure |
|---|
| >2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* | Back alignment and structure |
|---|
| >4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A | Back alignment and structure |
|---|
| >4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} | Back alignment and structure |
|---|
| >2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* | Back alignment and structure |
|---|
| >3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* | Back alignment and structure |
|---|
| >2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* | Back alignment and structure |
|---|
| >4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* | Back alignment and structure |
|---|
| >2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* | Back alignment and structure |
|---|
| >1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* | Back alignment and structure |
|---|
| >3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} | Back alignment and structure |
|---|
| >1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* | Back alignment and structure |
|---|
| >2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* | Back alignment and structure |
|---|
| >1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* | Back alignment and structure |
|---|
| >3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* | Back alignment and structure |
|---|
| >4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} | Back alignment and structure |
|---|
| >1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* | Back alignment and structure |
|---|
| >3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* | Back alignment and structure |
|---|
| >4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* | Back alignment and structure |
|---|
| >3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* | Back alignment and structure |
|---|
| >3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E | Back alignment and structure |
|---|
| >3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} | Back alignment and structure |
|---|
| >4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} | Back alignment and structure |
|---|
| >3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} | Back alignment and structure |
|---|
| >3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A | Back alignment and structure |
|---|
| >3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* | Back alignment and structure |
|---|
| >1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A | Back alignment and structure |
|---|
| >2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* | Back alignment and structure |
|---|
| >1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* | Back alignment and structure |
|---|
| >3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* | Back alignment and structure |
|---|
| >3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* | Back alignment and structure |
|---|
| >3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* | Back alignment and structure |
|---|
| >3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A | Back alignment and structure |
|---|
| >2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} | Back alignment and structure |
|---|
| >3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* | Back alignment and structure |
|---|
| >3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} | Back alignment and structure |
|---|
| >2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* | Back alignment and structure |
|---|
| >4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} | Back alignment and structure |
|---|
| >2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* | Back alignment and structure |
|---|
| >3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A | Back alignment and structure |
|---|
| >3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} | Back alignment and structure |
|---|
| >4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* | Back alignment and structure |
|---|
| >1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A | Back alignment and structure |
|---|
| >3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >2f00_A UDP-N-acetylmuramate--L-alanine ligase; amide bond ligase, ATPase, bacterial cell WALL; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* | Back alignment and structure |
|---|
| >3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* | Back alignment and structure |
|---|
| >3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* | Back alignment and structure |
|---|
| >3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* | Back alignment and structure |
|---|
| >2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} | Back alignment and structure |
|---|
| >3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* | Back alignment and structure |
|---|
| >3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A | Back alignment and structure |
|---|
| >4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} | Back alignment and structure |
|---|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A | Back alignment and structure |
|---|
| >3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
| >3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} | Back alignment and structure |
|---|
| >3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} | Back alignment and structure |
|---|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* | Back alignment and structure |
|---|
| >1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 210 | ||||
| d1j4aa2 | 134 | c.23.12.1 (A:2-103,A:301-332) D-lactate dehydrogen | 3e-13 | |
| d1qp8a2 | 121 | c.23.12.1 (A:1-82,A:264-302) Putative formate dehy | 5e-10 | |
| d1mx3a2 | 133 | c.23.12.1 (A:27-125,A:319-352) Transcription corep | 1e-08 | |
| d1gdha2 | 129 | c.23.12.1 (A:2-100,A:292-321) D-glycerate dehydrog | 2e-07 | |
| d1dxya2 | 131 | c.23.12.1 (A:1-100,A:300-330) D-2-hydroxyisocaproa | 4e-07 | |
| d1sc6a2 | 132 | c.23.12.1 (A:7-107,A:296-326) Phosphoglycerate deh | 6e-07 | |
| d2naca2 | 186 | c.23.12.1 (A:1-147,A:336-374) Formate dehydrogenas | 7e-07 | |
| d1ygya2 | 130 | c.23.12.1 (A:3-98,A:283-316) Phosphoglycerate dehy | 9e-07 | |
| d1gdha1 | 191 | c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyp | 3e-04 | |
| d1hwxa1 | 293 | c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow ( | 3e-04 | |
| d1li4a1 | 163 | c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolas | 5e-04 | |
| d1c1da1 | 201 | c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {R | 0.001 |
| >d1j4aa2 c.23.12.1 (A:2-103,A:301-332) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Length = 134 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Flavodoxin-like superfamily: Formate/glycerate dehydrogenase catalytic domain-like family: Formate/glycerate dehydrogenases, substrate-binding domain domain: D-lactate dehydrogenase species: Lactobacillus helveticus [TaxId: 1587]
Score = 61.9 bits (150), Expect = 3e-13
Identities = 18/135 (13%), Positives = 44/135 (32%), Gaps = 15/135 (11%)
Query: 13 TRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYH----LCVVKTMRLDS 68
T++ + KE+ + ++V+ P+ +A + V + + +
Sbjct: 1 TKIFAYAIR-EDEKPFLKEWEDAHKDVEVEYTDKLLTPETVALAKGADGVVVYQQLDYIA 59
Query: 69 NCISRANQMKLIM--QFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYLMLG 126
+ + VG++ +D+ A G ++ +P S + M+
Sbjct: 60 ETLQALADNGITKMSLRNVGVDNIDMAKAKELGFQITNVPV------YSYTTHAVRNMVV 113
Query: 127 LLRKQNEMRMAIEQK 141
N +E K
Sbjct: 114 KAFDNN--LELVEGK 126
|
| >d1qp8a2 c.23.12.1 (A:1-82,A:264-302) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 121 | Back information, alignment and structure |
|---|
| >d1mx3a2 c.23.12.1 (A:27-125,A:319-352) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
| >d1gdha2 c.23.12.1 (A:2-100,A:292-321) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Length = 129 | Back information, alignment and structure |
|---|
| >d1dxya2 c.23.12.1 (A:1-100,A:300-330) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Length = 131 | Back information, alignment and structure |
|---|
| >d1sc6a2 c.23.12.1 (A:7-107,A:296-326) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 132 | Back information, alignment and structure |
|---|
| >d2naca2 c.23.12.1 (A:1-147,A:336-374) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Length = 186 | Back information, alignment and structure |
|---|
| >d1ygya2 c.23.12.1 (A:3-98,A:283-316) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 130 | Back information, alignment and structure |
|---|
| >d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Length = 191 | Back information, alignment and structure |
|---|
| >d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Length = 293 | Back information, alignment and structure |
|---|
| >d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 163 | Back information, alignment and structure |
|---|
| >d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Length = 201 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 210 | |||
| d1qp8a2 | 121 | Putative formate dehydrogenase {Archaeon Pyrobacul | 99.92 | |
| d1ygya2 | 130 | Phosphoglycerate dehydrogenase {Mycobacterium tube | 99.92 | |
| d1ygya1 | 184 | Phosphoglycerate dehydrogenase {Mycobacterium tube | 99.92 | |
| d1qp8a1 | 181 | Putative formate dehydrogenase {Archaeon Pyrobacul | 99.91 | |
| d1mx3a1 | 193 | Transcription corepressor CtbP {Human (Homo sapien | 99.91 | |
| d1j4aa1 | 197 | D-lactate dehydrogenase {Lactobacillus helveticus | 99.91 | |
| d1dxya1 | 199 | D-2-hydroxyisocaproate dehydrogenase {Lactobacillu | 99.91 | |
| d1sc6a1 | 188 | Phosphoglycerate dehydrogenase {Escherichia coli [ | 99.9 | |
| d1gdha1 | 191 | D-glycerate dehydrogenase {Hyphomicrobium methylov | 99.89 | |
| d2naca1 | 188 | Formate dehydrogenase {Pseudomonas sp., strain 101 | 99.88 | |
| d1dxya2 | 131 | D-2-hydroxyisocaproate dehydrogenase {Lactobacillu | 99.87 | |
| d1sc6a2 | 132 | Phosphoglycerate dehydrogenase {Escherichia coli [ | 99.85 | |
| d1j4aa2 | 134 | D-lactate dehydrogenase {Lactobacillus helveticus | 99.83 | |
| d1gdha2 | 129 | D-glycerate dehydrogenase {Hyphomicrobium methylov | 99.81 | |
| d1mx3a2 | 133 | Transcription corepressor CtbP {Human (Homo sapien | 99.81 | |
| d2naca2 | 186 | Formate dehydrogenase {Pseudomonas sp., strain 101 | 99.79 | |
| d1li4a1 | 163 | S-adenosylhomocystein hydrolase {Human (Homo sapie | 98.84 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 98.15 | |
| d1v8ba1 | 163 | S-adenosylhomocystein hydrolase {Plasmodium falcip | 97.94 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 97.89 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 97.88 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 97.87 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 97.77 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 97.77 | |
| d3etja2 | 78 | N5-carboxyaminoimidazole ribonucleotide synthetase | 97.76 | |
| d1c1da1 | 201 | Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ | 97.71 | |
| d1i36a2 | 152 | Conserved hypothetical protein MTH1747 {Archaeon M | 97.68 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 97.62 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 97.43 | |
| d1kjqa2 | 111 | Glycinamide ribonucleotide transformylase PurT, N- | 97.26 | |
| d1v9la1 | 242 | Glutamate dehydrogenase {Pyrobaculum islandicum [T | 97.26 | |
| d1leha1 | 230 | Leucine dehydrogenase {Bacillus sphaericus [TaxId: | 97.11 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 97.05 | |
| d1yqga2 | 152 | Pyrroline-5-carboxylate reductase ProC {Neisseria | 97.03 | |
| d1j5pa4 | 132 | Hypothetical protein TM1643 {Thermotoga maritima [ | 96.99 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 96.97 | |
| d2ahra2 | 152 | Pyrroline-5-carboxylate reductase ProC {Streptococ | 96.93 | |
| d1hwxa1 | 293 | Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: | 96.83 | |
| d1gtma1 | 239 | Glutamate dehydrogenase {Archaeon Pyrococcus furio | 96.8 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 96.8 | |
| d2cvza2 | 156 | Hydroxyisobutyrate dehydrogenase {Thermus thermoph | 96.79 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 96.79 | |
| d1wdka3 | 186 | Fatty oxidation complex alpha subunit, middle doma | 96.78 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 96.77 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 96.76 | |
| d1kyqa1 | 150 | Bifunctional dehydrogenase/ferrochelatase Met8p, N | 96.67 | |
| d1bgva1 | 255 | Glutamate dehydrogenase {Clostridium symbiosum [Ta | 96.6 | |
| d1b26a1 | 234 | Glutamate dehydrogenase {Thermotoga maritima [TaxI | 96.58 | |
| d2i76a2 | 153 | Hypothetical protein TM1727 {Thermotoga maritima [ | 96.51 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 96.4 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 96.36 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 96.31 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 96.27 | |
| d1f06a1 | 170 | Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb | 96.26 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 96.22 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 96.19 | |
| d1llua2 | 166 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 96.14 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 96.1 | |
| d1np3a2 | 182 | Class I ketol-acid reductoisomerase (KARI) {Pseudo | 96.06 | |
| d1cf2o1 | 171 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 95.9 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 95.9 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 95.87 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 95.82 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 95.75 | |
| d1jw9b_ | 247 | Molybdenum cofactor biosynthesis protein MoeB {Esc | 95.72 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 95.68 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 95.63 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 95.6 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 95.59 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 95.49 | |
| d2czca2 | 172 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 95.41 | |
| d2o23a1 | 248 | Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho | 95.39 | |
| d1rjwa2 | 168 | Alcohol dehydrogenase {Bacillus stearothermophilus | 95.3 | |
| d1gtea4 | 196 | Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su | 95.27 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 95.25 | |
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 95.22 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 95.16 | |
| d1i0za1 | 160 | Lactate dehydrogenase {Human (Homo sapiens), heart | 95.15 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 95.14 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 95.11 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 95.1 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 95.06 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 95.05 | |
| d2ldxa1 | 159 | Lactate dehydrogenase {Mouse (Mus musculus) [TaxId | 94.99 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 94.99 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 94.95 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 94.94 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 94.91 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 94.9 | |
| d1uxja1 | 142 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 94.86 | |
| d1nvta1 | 177 | Shikimate 5-dehydrogenase AroE {Archaeon Methanoco | 94.72 | |
| d1vi2a1 | 182 | Putative shikimate dehydrogenase YdiB {Escherichia | 94.7 | |
| d1pr9a_ | 244 | Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 | 94.68 | |
| d1qmga2 | 226 | Class II ketol-acid reductoisomerase (KARI) {Spina | 94.68 | |
| d1ae1a_ | 258 | Tropinone reductase {Jimsonweed (Datura stramonium | 94.66 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 94.64 | |
| d1dssg1 | 169 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 94.64 | |
| d1l7da1 | 183 | Nicotinamide nucleotide transhydrogenase dI compon | 94.61 | |
| d2h7ma1 | 268 | Enoyl-ACP reductase {Mycobacterium tuberculosis, T | 94.61 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 94.6 | |
| d1d7oa_ | 297 | Enoyl-ACP reductase {Oil seed rape (Brassica napus | 94.47 | |
| d1h5qa_ | 260 | Mannitol dehydrogenase {Mushroom (Agaricus bisporu | 94.46 | |
| d1ulua_ | 256 | Enoyl-ACP reductase {Thermus thermophilus [TaxId: | 94.43 | |
| d2pd4a1 | 274 | Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 | 94.41 | |
| d2gv8a2 | 107 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 94.4 | |
| d1p77a1 | 171 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 94.39 | |
| d1hyha1 | 146 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 94.36 | |
| d1p0fa2 | 174 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 94.33 | |
| d1p3da1 | 96 | UDP-N-acetylmuramate-alanine ligase MurC {Haemophi | 94.3 | |
| d1hdgo1 | 169 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 94.3 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 94.28 | |
| d1n1ea2 | 189 | Glycerol-3- phosphate dehydrogenase {Trypanosome ( | 94.24 | |
| d1xu9a_ | 269 | 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom | 94.22 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 94.13 | |
| d1cyda_ | 242 | Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 | 94.11 | |
| d1uzma1 | 237 | beta-keto acyl carrier protein reductase {Mycobact | 94.09 | |
| d2g82a1 | 168 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 94.09 | |
| d2a4ka1 | 241 | beta-keto acyl carrier protein reductase {Thermus | 94.05 | |
| d1iz0a2 | 171 | Quinone oxidoreductase {Thermus thermophilus [TaxI | 94.04 | |
| d1kola2 | 195 | Formaldehyde dehydrogenase {Pseudomonas putida [Ta | 93.98 | |
| d1gado1 | 166 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 93.97 | |
| d1hdca_ | 254 | 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre | 93.92 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 93.9 | |
| d1yb5a2 | 174 | Quinone oxidoreductase {Human (Homo sapiens) [TaxI | 93.88 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 93.88 | |
| d1qsga_ | 258 | Enoyl-ACP reductase {Escherichia coli [TaxId: 562] | 93.88 | |
| d1y6ja1 | 142 | Lactate dehydrogenase {Clostridium thermocellum [T | 93.86 | |
| d1xeaa1 | 167 | Putative oxidoreductase VCA1048 {Vibrio cholerae [ | 93.78 | |
| d1guza1 | 142 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 93.73 | |
| d1vl8a_ | 251 | Gluconate 5-dehydrogenase {Thermotoga maritima [Ta | 93.73 | |
| d1ydea1 | 250 | Retinal dehydrogenase/reductase 3 {Human (Homo sap | 93.64 | |
| d1vm6a3 | 128 | Dihydrodipicolinate reductase {Thermotoga maritima | 93.56 | |
| d1t2da1 | 150 | Lactate dehydrogenase {Malaria parasite (Plasmodiu | 93.41 | |
| d1o5ia_ | 234 | beta-keto acyl carrier protein reductase {Thermoto | 93.34 | |
| d1ulsa_ | 242 | beta-keto acyl carrier protein reductase {Thermus | 93.34 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 93.33 | |
| d1g0oa_ | 272 | 1,3,8-trihydroxynaphtalene reductase (THNR, naphto | 93.32 | |
| d1a4ia1 | 170 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 93.29 | |
| d1xq1a_ | 259 | Tropinone reductase {Thale cress (Arabidopsis thal | 93.29 | |
| d1id1a_ | 153 | Rck domain from putative potassium channel Kch {Es | 93.26 | |
| d1xkqa_ | 272 | Hypothetical protein R05D8.7 {Caenorhabditis elega | 93.22 | |
| d2jhfa2 | 176 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 93.22 | |
| d1rkxa_ | 356 | CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc | 93.13 | |
| d2ae2a_ | 259 | Tropinone reductase {Jimsonweed (Datura stramonium | 93.08 | |
| d2ag5a1 | 245 | Dehydrogenase/reductase SDR family member 6, DHRS6 | 93.01 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 93.0 | |
| d1q7ba_ | 243 | beta-keto acyl carrier protein reductase {Escheric | 92.98 | |
| d1obfo1 | 173 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 92.95 | |
| d1b0aa1 | 166 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 92.94 | |
| d2fy8a1 | 129 | Potassium channel-related protein MthK {Archaeon M | 92.93 | |
| d1nffa_ | 244 | Putative oxidoreductase Rv2002 {Mycobacterium tube | 92.85 | |
| d2c07a1 | 251 | beta-keto acyl carrier protein reductase {Malaria | 92.83 | |
| d1o8ca2 | 77 | Hypothetical protein YhdH {Escherichia coli [TaxId | 92.81 | |
| d1u8fo1 | 169 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 92.79 | |
| d1geea_ | 261 | Glucose dehydrogenase {Bacillus megaterium [TaxId: | 92.79 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 92.78 | |
| d1xgka_ | 350 | Negative transcriptional regulator NmrA {Aspergill | 92.72 | |
| d2ew8a1 | 247 | (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb | 92.7 | |
| d1h2ba2 | 172 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 92.69 | |
| d1qyca_ | 307 | Phenylcoumaran benzylic ether reductase {Loblolly | 92.67 | |
| d2d1ya1 | 248 | Hypothetical protein TTHA0369 {Thermus thermophilu | 92.6 | |
| d1bdba_ | 276 | Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps | 92.6 | |
| d1k2wa_ | 256 | Sorbitol dehydrogenase {Rhodobacter sphaeroides [T | 92.6 | |
| d1llda1 | 143 | Lactate dehydrogenase {Bifidobacterium longum, str | 92.57 | |
| d2b4ro1 | 166 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 92.4 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 92.33 | |
| d1x1ta1 | 260 | D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas | 92.31 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 92.3 | |
| d1ja9a_ | 259 | 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl | 92.23 | |
| d1j6ua1 | 89 | UDP-N-acetylmuramate-alanine ligase MurC {Thermoto | 92.21 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 92.21 | |
| d3cmco1 | 171 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 92.18 | |
| d1tlta1 | 164 | Virulence factor MviM {Escherichia coli [TaxId: 56 | 92.17 | |
| d1yxma1 | 297 | Peroxisomal trans 2-enoyl CoA reductase {Human (Ho | 92.17 | |
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 92.09 | |
| d1a5za1 | 140 | Lactate dehydrogenase {Thermotoga maritima [TaxId: | 92.08 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 92.06 | |
| d1zk4a1 | 251 | R-specific alcohol dehydrogenase {Lactobacillus br | 91.98 | |
| d1yovb1 | 426 | UBA3 {Human (Homo sapiens) [TaxId: 9606]} | 91.84 | |
| d1edza1 | 171 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 91.78 | |
| d1iy8a_ | 258 | Levodione reductase {Corynebacterium aquaticum [Ta | 91.72 | |
| d1hyea1 | 145 | MJ0490, lactate/malate dehydrogenase {Archaeon Met | 91.56 | |
| d1vl6a1 | 222 | Malate oxidoreductase (malic enzyme) {Thermotoga m | 91.54 | |
| d1hxha_ | 253 | 3beta/17beta hydroxysteroid dehydrogenase {Comamon | 91.54 | |
| d1xhla_ | 274 | Hypothetical protein F25D1.5 {Caenorhabditis elega | 91.54 | |
| d1spxa_ | 264 | Glucose dehydrogenase (5l265) {Nematode (Caenorhab | 91.54 | |
| d1c0pa1 | 268 | D-aminoacid oxidase, N-terminal domain {Rhodotorul | 91.5 | |
| d1sbya1 | 254 | Drosophila alcohol dehydrogenase {Fly (Drosophila | 91.41 | |
| d2dt5a2 | 126 | Transcriptional repressor Rex, C-terminal domain { | 91.3 | |
| d1tt7a2 | 167 | Hypothetical protein YhfP {Bacillus subtilis [TaxI | 91.26 | |
| d1qora2 | 179 | Quinone oxidoreductase {Escherichia coli [TaxId: 5 | 91.24 | |
| d1ojua1 | 142 | Malate dehydrogenase {Archaeon Archaeoglobus fulgi | 90.98 | |
| d1yova1 | 529 | Amyloid beta precursor protein-binding protein 1, | 90.86 | |
| d1gu7a2 | 189 | 2,4-dienoyl-CoA reductase {Yeast (Candida tropical | 90.74 | |
| d1q1ra1 | 185 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 90.51 | |
| d1ebfa1 | 168 | Homoserine dehydrogenase {Baker's yeast (Saccharom | 90.5 | |
| d1djqa2 | 156 | Trimethylamine dehydrogenase, C-terminal domain {M | 90.48 | |
| d2fzwa2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 90.48 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 90.15 | |
| d1gz6a_ | 302 | (3R)-hydroxyacyl-CoA dehydrogenase domain of estra | 90.06 | |
| d1pqwa_ | 183 | Putative enoyl reductase domain of polyketide synt | 90.06 | |
| d1v3va2 | 182 | Leukotriene b4 12-hydroxydehydrogenase/prostagland | 90.01 | |
| d1h6da1 | 221 | Glucose-fructose oxidoreductase, N-terminal domain | 89.96 | |
| d1nvmb1 | 157 | Acetaldehyde dehydrogenase (acylating) {Pseudomona | 89.85 | |
| d1o89a2 | 177 | Hypothetical protein YhdH {Escherichia coli [TaxId | 89.67 | |
| d1mlda1 | 144 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 89.63 | |
| d1zh8a1 | 181 | Hypothetical protein TM0312 {Thermotoga maritima [ | 89.59 | |
| d1xhca1 | 167 | NADH oxidase /nitrite reductase {Pyrococcus furios | 89.56 | |
| d1o6za1 | 142 | Malate dehydrogenase {Archaeon Haloarcula marismor | 89.51 | |
| d2gv8a1 | 335 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 89.35 | |
| d1trba1 | 190 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 89.21 | |
| d1trba2 | 126 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 89.16 | |
| d1w4xa2 | 235 | Phenylacetone monooxygenase {Thermobifida fusca [T | 88.98 | |
| d1jvba2 | 170 | Alcohol dehydrogenase {Archaeon Sulfolobus solfata | 88.54 | |
| d1cdoa2 | 175 | Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI | 88.47 | |
| d1sb8a_ | 341 | UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo | 87.65 | |
| d2bcgg1 | 297 | Guanine nucleotide dissociation inhibitor, GDI {Ba | 87.64 | |
| d1m6ia2 | 137 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 87.63 | |
| d1lqta1 | 216 | Ferredoxin:NADP reductase FprA {Mycobacterium tube | 87.62 | |
| d1pvva2 | 163 | Ornithine transcarbamoylase {Archaeon Pyrococcus f | 87.38 | |
| d1y1pa1 | 342 | Aldehyde reductase II {Sporobolomyces salmonicolor | 87.28 | |
| d1aoga2 | 117 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 87.27 | |
| d2cmda1 | 145 | Malate dehydrogenase {Escherichia coli [TaxId: 562 | 87.22 | |
| d1xa0a2 | 176 | B. subtilis YhfP homologue {Bacillus stearothermop | 87.13 | |
| d2dw4a2 | 449 | Lysine-specific histone demethylase 1, LSD1 {Human | 87.13 | |
| d1dxla1 | 221 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 86.71 | |
| d2bkaa1 | 232 | TAT-interacting protein TIP30 {Human (Homo sapiens | 86.54 | |
| d1dlja3 | 108 | UDP-glucose dehydrogenase (UDPGDH), C-terminal (UD | 86.5 | |
| d1cjca1 | 225 | Adrenodoxin reductase of mitochondrial p450 system | 86.35 | |
| d1w4xa1 | 298 | Phenylacetone monooxygenase {Thermobifida fusca [T | 86.31 | |
| d1lc0a1 | 172 | Biliverdin reductase {Rat (Rattus norvegicus) [Tax | 86.27 | |
| d1vdca1 | 192 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 86.24 | |
| d1mv8a3 | 136 | GDP-mannose 6-dehydrogenase, GDP-binding domain {P | 86.22 | |
| d1v59a1 | 233 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 86.17 | |
| d1ps9a2 | 162 | 2,4-dienoyl-CoA reductase, C-terminal domain {Esch | 86.07 | |
| d1h6va1 | 235 | Mammalian thioredoxin reductase {Rat (Rattus norve | 85.93 | |
| d1y81a1 | 116 | Hypothetical protein PF0725 {Pyrococcus furiosus [ | 85.62 | |
| d1lvla1 | 220 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 84.57 | |
| d2hjsa1 | 144 | Usg-1 protein homolog PA3116 {Pseudomonas aerugino | 84.4 | |
| d1yl7a1 | 135 | Dihydrodipicolinate reductase {Mycobacterium tuber | 84.37 | |
| d1gtea3 | 153 | Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su | 84.32 | |
| d1dxha2 | 185 | Ornithine transcarbamoylase {Pseudomonas aeruginos | 84.26 | |
| d1t4ba1 | 146 | Aspartate beta-semialdehyde dehydrogenase {Escheri | 84.25 | |
| d2q46a1 | 252 | Hypothetical protein At5g02240 (T7H20_290) {Thale | 84.14 | |
| d2c5aa1 | 363 | GDP-mannose-3', 5'-epimerase {Thale cress (Arabido | 83.73 | |
| d1vlva2 | 161 | Ornithine transcarbamoylase {Thermotoga maritima [ | 83.45 | |
| d3grsa1 | 221 | Glutathione reductase {Human (Homo sapiens) [TaxId | 83.18 | |
| d1d5ta1 | 336 | Guanine nucleotide dissociation inhibitor, GDI {Co | 83.07 | |
| d1otha2 | 170 | Ornithine transcarbamoylase {Human (Homo sapiens) | 82.93 | |
| d1r0ka2 | 150 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z | 82.63 | |
| d2d59a1 | 139 | Hypothetical protein PH1109 {Pyrococcus horikoshii | 82.42 | |
| d1o0sa1 | 308 | Mitochondrial NAD(P)-dependent malic enzyme {Pig r | 82.42 | |
| d1q0qa2 | 151 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E | 81.8 | |
| d1fl2a2 | 126 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 81.58 | |
| d1pj3a1 | 294 | Mitochondrial NAD(P)-dependent malic enzyme {Human | 81.22 | |
| d1oaaa_ | 259 | Sepiapterin reductase {Mouse (Mus musculus) [TaxId | 80.9 | |
| d1ryia1 | 276 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 80.23 | |
| d1ml4a2 | 157 | Aspartate carbamoyltransferase catalytic subunit { | 80.2 | |
| d1vdca2 | 130 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 80.1 | |
| d2cvoa1 | 183 | Putative semialdehyde dehydrogenase {Rice (Oryza s | 80.1 |
| >d1qp8a2 c.23.12.1 (A:1-82,A:264-302) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Flavodoxin-like superfamily: Formate/glycerate dehydrogenase catalytic domain-like family: Formate/glycerate dehydrogenases, substrate-binding domain domain: Putative formate dehydrogenase species: Archaeon Pyrobaculum aerophilum [TaxId: 13773]
Probab=99.92 E-value=2.7e-28 Score=178.00 Aligned_cols=121 Identities=17% Similarity=0.213 Sum_probs=97.6
Q ss_pred ceEEEeCCCCCCchhhHHHHhhcCCCeEEecCCCCChhhhcCCceEEEEcCCCCCHHHHhcCCCceEEEEccccCCccch
Q 028314 13 TRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYHLCVVKTMRLDSNCISRANQMKLIMQFGVGLEGVDI 92 (210)
Q Consensus 13 ~~ili~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~adv~i~~~~~~~~~~l~~~p~Lk~i~~~~aG~d~id~ 92 (210)
|||+++.+..++ . ++.++... ++.. ...++++|+++. ++++++.++++|+||||++.++|+||+|.
T Consensus 1 Mki~v~~~lp~e---~-~e~L~~~~--~v~~------~~d~~~~d~~l~--~~~~~~~l~~~~~Lk~i~~~~aG~D~i~~ 66 (121)
T d1qp8a2 1 MELYVNFELPPE---A-EEELRKYF--KIVR------GGDLGNVEAALV--SRITAEELAKMPRLKFIQVVTAGLDHLPW 66 (121)
T ss_dssp CEEECCSCCCHH---H-HHHHHTTC--EEEC------SSCCTTBCCCCB--SCCCHHHHHHCTTCCCEEBSSSCCTTSCC
T ss_pred CEEEEeCCCCHH---H-HHHhhhcc--eEee------cccccccceeee--eccCHHHHhcCCCceEEEecccCcCCCCH
Confidence 688888775432 2 33333322 2221 123567787775 67999999999999999999999999999
Q ss_pred hHHhhCCcEEEecCCCCCCCchhHHHHHHHHHHHHHhhHHHHHHHHHhCCCCCCcccccccCeEEEEecChHHHHHHHHh
Q 028314 93 NAATRCGIKVARIPGDVTGNAASCAELTIYLMLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFILGFGNIGVELAKRL 172 (210)
Q Consensus 93 ~~~~~~gi~v~~~~~~~~~~a~~vAE~~l~~~L~~~R~~~~~~~~~~~~~w~~~~~~~l~~~tvGIiG~G~IG~~vA~~~ 172 (210)
+.+ +++|.|+|++|+ |+.+||||+++++|++.| +++|+|+|+|||++|+|+
T Consensus 67 ~~~-~~~i~v~n~~g~---~~~~vae~~~~~il~~~r-------------------------~l~i~G~G~iG~~iA~r~ 117 (121)
T d1qp8a2 67 ESI-PPHVTVAGNAGS---NGYGNERVWRQMVMEAVR-------------------------NLITYATGGRPRNIAKRE 117 (121)
T ss_dssp TTS-CTTSCEECCCSS---SSSSCHHHHHHHHHHHHH-------------------------HHHHHHTTSCCSCBCCGG
T ss_pred HHh-ccCeEEEECCCC---ChHHHHHHHHHHHHHhcC-------------------------CEEEEcCCHHHHHHHHHH
Confidence 987 579999999999 999999999999999997 368999999999999999
Q ss_pred ccCC
Q 028314 173 RPFG 176 (210)
Q Consensus 173 ~~fg 176 (210)
++||
T Consensus 118 ~a~G 121 (121)
T d1qp8a2 118 DYIG 121 (121)
T ss_dssp GTC-
T ss_pred HhcC
Confidence 9998
|
| >d1ygya2 c.23.12.1 (A:3-98,A:283-316) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} | Back information, alignment and structure |
|---|
| >d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1dxya2 c.23.12.1 (A:1-100,A:300-330) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1sc6a2 c.23.12.1 (A:7-107,A:296-326) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j4aa2 c.23.12.1 (A:2-103,A:301-332) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d1gdha2 c.23.12.1 (A:2-100,A:292-321) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} | Back information, alignment and structure |
|---|
| >d1mx3a2 c.23.12.1 (A:27-125,A:319-352) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2naca2 c.23.12.1 (A:1-147,A:336-374) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} | Back information, alignment and structure |
|---|
| >d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} | Back information, alignment and structure |
|---|
| >d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} | Back information, alignment and structure |
|---|
| >d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} | Back information, alignment and structure |
|---|
| >d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} | Back information, alignment and structure |
|---|
| >d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} | Back information, alignment and structure |
|---|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} | Back information, alignment and structure |
|---|
| >d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} | Back information, alignment and structure |
|---|
| >d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} | Back information, alignment and structure |
|---|
| >d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
| >d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|
| >d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} | Back information, alignment and structure |
|---|
| >d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} | Back information, alignment and structure |
|---|
| >d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} | Back information, alignment and structure |
|---|
| >d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} | Back information, alignment and structure |
|---|
| >d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} | Back information, alignment and structure |
|---|
| >d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} | Back information, alignment and structure |
|---|
| >d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dlja3 c.26.3.1 (A:295-402) UDP-glucose dehydrogenase (UDPGDH), C-terminal (UDP-binding) domain {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1mv8a3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1dxha2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1otha2 c.78.1.1 (A:185-354) Ornithine transcarbamoylase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} | Back information, alignment and structure |
|---|
| >d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} | Back information, alignment and structure |
|---|
| >d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|