BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 028317
         (210 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2Y0N|E Chain E, Crystal Structure Of The Complex Between Dosage
          Compensation Factors Msl1 And Msl3
 pdb|2Y0N|F Chain F, Crystal Structure Of The Complex Between Dosage
          Compensation Factors Msl1 And Msl3
 pdb|2Y0N|G Chain G, Crystal Structure Of The Complex Between Dosage
          Compensation Factors Msl1 And Msl3
 pdb|2Y0N|H Chain H, Crystal Structure Of The Complex Between Dosage
          Compensation Factors Msl1 And Msl3
          Length = 56

 Score = 29.3 bits (64), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 17/35 (48%)

Query: 34 EPWTTGIFGCTEDTESCWTGFFCPCVLFGRNVEKM 68
          EP  T  F   +D ES     F P V FGR + K+
Sbjct: 9  EPEVTSFFPEPDDVESLLITPFLPVVAFGRPLPKL 43


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.136    0.477 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,761,240
Number of Sequences: 62578
Number of extensions: 275870
Number of successful extensions: 468
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 468
Number of HSP's gapped (non-prelim): 1
length of query: 210
length of database: 14,973,337
effective HSP length: 95
effective length of query: 115
effective length of database: 9,028,427
effective search space: 1038269105
effective search space used: 1038269105
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 49 (23.5 bits)