Citrus Sinensis ID: 028334


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210
MENPKVQEILEKQLLTVAKAVEEKLDEEIAAIDRLDDDDLEALRERRLQQMKKMAEKRNRWISLGHGDYSEIQAEKDFFSVVKASDRVVCHFYRENWPCKVMDKHMSILAKKHIETRFVKIHAEKSPFLAERLKIVVLPTLALIKNAKVDDYVVGFDELGGTDEFSTEELEERLAKAQVIFLEGESSVKSGAETRRSVRQSTNPDSSDSE
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEccccHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHHccccEEEEECcccccHHHHHcccccccEEEEEEccEEEEEEEEcccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccc
******Q*****QLLTVAKAV*******IAAIDRLDDDDLEALRERRLQ*********NRWISLGHGDYSEIQAEKDFFSVVKASDRVVCHFYRENWPCKVMDKHMSILAKKHIETRFVKIHAEKSPFLAERLKIVVLPTLALIKNAKVDDYVVGFDELGGTDEFSTEELEERLAKAQVIFL****************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENPKVQEILEKQLLTVxxxxxxxxxxxxxxxxxxxxxDxxxxxxxxxxxxxxxxxxxxxWISLGHGDYSEIQAEKDFFSVVKASDRVVCHFYRENWPCKVMDKHMSILAKKHIETRFVKIHAEKSPFLAERLKIVVLPTLALIKNAKVDDYVVGFDELGGTDEFSTEELEERLAKAQVIFLEGESSVKSGAETRRSVRQSTNPDSSDSE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Thioredoxin domain-containing protein 9 homolog confidentO64628
Thioredoxin domain-containing protein 9 Significantly diminishes the chaperonin TCP1 complex ATPase activity, thus negatively impacts protein folding, including that of actin or tubulin.probableQ9CQ79
Thioredoxin domain-containing protein 9 Significantly diminishes the chaperonin TCP1 complex ATPase activity, thus negatively impacts protein folding, including that of actin or tubulin.probableO18883

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DBC, chain A
Confidence level:very confident
Coverage over the Query: 63-185
View the alignment between query and template
View the model in PyMOL
Template: 1A0R, chain P
Confidence level:very confident
Coverage over the Query: 24-182
View the alignment between query and template
View the model in PyMOL