Query         028341
Match_columns 210
No_of_seqs    144 out of 285
Neff          4.0 
Searched_HMMs 46136
Date          Fri Mar 29 10:00:34 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/028341.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/028341hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4259 Putative nucleic acid-  99.8 3.7E-19   8E-24  156.2   9.9  125   54-183   108-259 (260)
  2 KOG4259 Putative nucleic acid-  99.5 4.1E-14 8.8E-19  124.6   7.8   87   73-162   148-259 (260)
  3 KOG1861 Leucine permease trans  14.7 1.1E+02  0.0024   30.8   1.9   23  164-186   230-252 (540)
  4 PF02042 RWP-RK:  RWP-RK domain  11.3 1.4E+02  0.0029   21.1   1.1   12  127-138    31-42  (52)
  5 PF06884 DUF1264:  Protein of u  11.3   2E+02  0.0044   24.9   2.4   12  127-138   146-157 (171)
  6 PF10642 Tom5:  Mitochondrial i  10.9 2.5E+02  0.0055   19.6   2.4   19   89-107     2-21  (49)
  7 PF05673 DUF815:  Protein of un   6.9 4.5E+02  0.0097   24.0   2.9    9  131-139   206-214 (249)
  8 PF04081 DNA_pol_delta_4:  DNA    6.8 3.1E+02  0.0068   22.6   1.7   38   75-113    60-100 (124)
  9 PF12824 MRP-L20:  Mitochondria   6.2 3.3E+02  0.0072   23.0   1.6   14  146-159   135-148 (164)
 10 PF13331 DUF4093:  Domain of un   6.1 1.2E+03   0.026   17.6   4.5   11  128-138    68-78  (87)

No 1  
>KOG4259 consensus Putative nucleic acid-binding protein Hcc-1/proliferation associated cytokine-inducible protein, contains SAP domain [Cell cycle control, cell division, chromosome partitioning]
Probab=99.79  E-value=3.7e-19  Score=156.19  Aligned_cols=125  Identities=34%  Similarity=0.421  Sum_probs=80.5

Q ss_pred             CCCCCcceeccCCCCCCCCCCCCChHHHHHHHHh---hhCCCCCCCH---HHHHHHHHhhhCCCCCCCC-------C---
Q 028341           54 GNDSKTAVTITAVSPVSGDADLVTDTQKKIRRAE---RFGMPVQMSE---EEKRNTRAERFGTGSKTQG-------S---  117 (210)
Q Consensus        54 ~~~~kk~vkIt~~~~~~~~~~~lSd~EKk~~RAe---RFGip~~lse---~eKkk~RAeRFGl~~~~~~-------s---  117 (210)
                      ...++++|.|+++.    -............|++   ||+.|+++-+   .+++.+||+||||+.....       +   
T Consensus       108 ~~~Eks~v~~tstg----k~~E~paet~~~srae~~~rf~~Pvvae~k~a~e~laaRAkRFgIp~d~t~i~sadnKas~a  183 (260)
T KOG4259|consen  108 ISKEKSQVPETSTG----KEAEEPAETTEESRAEVSNRFSSPVVAEEKTAQEKLAARAKRFGIPVDDTQIKSADNKASSA  183 (260)
T ss_pred             hhhccccccccccc----cccccchhhhhhhhcccccccCCCcccccccchHHHHHHHHhcCCCCchHHHHhhccchhhh
Confidence            44577777777743    1123344555666666   7777665533   3666777777776643210       0   


Q ss_pred             -----CcccchHHHHHHHHHHhhCCCCCCC--cc---hHHHHHHHHhhhcCCCCCCCchHHHHH-HHHHhccCCCCC
Q 028341          118 -----EVSKTSEELKRKARAERFGLPVPSS--VS---EEEAKRKARLARFAPYPKTDSVEEDKR-KARALRFSKTSS  183 (210)
Q Consensus       118 -----~~~K~~eeeKlKkRAERFG~~~~~~--~~---~eeeKkkkRaERFG~~~~~d~~ee~Kk-kkRaeRFg~~~~  183 (210)
                           ........+++|.||+|||+++++.  ..   +-..|+++|++|||. .-.+...|+|+ ++|+||||+..+
T Consensus       184 ~~fG~~~~~p~a~dklk~rAqrfg~~v~s~Sr~s~~de~~~kl~arkkRfgg-titde~tEAKKaRaRaERFgtA~~  259 (260)
T KOG4259|consen  184 ANFGNKIQQPLASDKLKNRAQRFGPQVRSNSRSSQRDENAPKLSARKKRFGG-TITDEPTEAKKARARAERFGTAAK  259 (260)
T ss_pred             hhcCCcccchhhhHHHHHHHHhcCCCCCcccccCccccccchhhhhHHhcCC-CCCCchhhHHHHHHHHHHhcccCC
Confidence                 0111245679999999999999865  12   223599999999994 23455677777 999999998765


No 2  
>KOG4259 consensus Putative nucleic acid-binding protein Hcc-1/proliferation associated cytokine-inducible protein, contains SAP domain [Cell cycle control, cell division, chromosome partitioning]
Probab=99.50  E-value=4.1e-14  Score=124.65  Aligned_cols=87  Identities=37%  Similarity=0.524  Sum_probs=61.6

Q ss_pred             CCCCChHHHHHHHHhhhCCCCCC-----------------------CHHHHHHHHHhhhCCCCCCCCCCcccch-HHHHH
Q 028341           73 ADLVTDTQKKIRRAERFGMPVQM-----------------------SEEEKRNTRAERFGTGSKTQGSEVSKTS-EELKR  128 (210)
Q Consensus        73 ~~~lSd~EKk~~RAeRFGip~~l-----------------------se~eKkk~RAeRFGl~~~~~~s~~~K~~-eeeKl  128 (210)
                      .-+.+.++++.+||+|||||+..                       -..++++.||+|||+..+.. +..++.. ..-+|
T Consensus       148 ae~k~a~e~laaRAkRFgIp~d~t~i~sadnKas~a~~fG~~~~~p~a~dklk~rAqrfg~~v~s~-Sr~s~~de~~~kl  226 (260)
T KOG4259|consen  148 AEEKTAQEKLAARAKRFGIPVDDTQIKSADNKASSAANFGNKIQQPLASDKLKNRAQRFGPQVRSN-SRSSQRDENAPKL  226 (260)
T ss_pred             cccccchHHHHHHHHhcCCCCchHHHHhhccchhhhhhcCCcccchhhhHHHHHHHHhcCCCCCcc-cccCccccccchh
Confidence            44566778999999999999632                       13789999999999986532 2222211 22489


Q ss_pred             HHHHHhhCCCCCCCcchHHHHH-HHHhhhcCCCCC
Q 028341          129 KARAERFGLPVPSSVSEEEAKR-KARLARFAPYPK  162 (210)
Q Consensus       129 KkRAERFG~~~~~~~~~eeeKk-kkRaERFG~~~~  162 (210)
                      ++|++|||-..-  ....+.|+ ++|+||||++++
T Consensus       227 ~arkkRfggtit--de~tEAKKaRaRaERFgtA~~  259 (260)
T KOG4259|consen  227 SARKKRFGGTIT--DEPTEAKKARARAERFGTAAK  259 (260)
T ss_pred             hhhHHhcCCCCC--CchhhHHHHHHHHHHhcccCC
Confidence            999999993322  23456666 999999998653


No 3  
>KOG1861 consensus Leucine permease transcriptional regulator [Transcription]
Probab=14.66  E-value=1.1e+02  Score=30.80  Aligned_cols=23  Identities=52%  Similarity=0.582  Sum_probs=17.4

Q ss_pred             CchHHHHHHHHHhccCCCCCCcc
Q 028341          164 DSVEEDKRKARALRFSKTSSSSV  186 (210)
Q Consensus       164 d~~ee~KkkkRaeRFg~~~~~~~  186 (210)
                      ..|++++++.|+.||....+.+.
T Consensus       230 ~~d~e~rr~~Ra~RF~~~~s~s~  252 (540)
T KOG1861|consen  230 GSDEEARRKRRARRFSQGGSRST  252 (540)
T ss_pred             CchHHHHHHHHHHHHhhcccccc
Confidence            56888889999999976666443


No 4  
>PF02042 RWP-RK:  RWP-RK domain;  InterPro: IPR003035 This domain is named RWP-RK after a conserved motif at the C terminus of the domain. The domain is found in algal minus dominance proteins as well as plant proteins involved in nitrogen-controlled development [].
Probab=11.33  E-value=1.4e+02  Score=21.06  Aligned_cols=12  Identities=42%  Similarity=0.827  Sum_probs=7.1

Q ss_pred             HHHHHHHhhCCC
Q 028341          127 KRKARAERFGLP  138 (210)
Q Consensus       127 KlKkRAERFG~~  138 (210)
                      .+|++.-++||.
T Consensus        31 ~LKr~CR~~GI~   42 (52)
T PF02042_consen   31 TLKRRCRRLGIP   42 (52)
T ss_pred             HHHHHHHHcCCC
Confidence            356666666664


No 5  
>PF06884 DUF1264:  Protein of unknown function (DUF1264);  InterPro: IPR010686 This family contains a number of bacterial and eukaryotic proteins of unknown function that are approximately 200 residues long. Some family members are annotated as putative lipoproteins.
Probab=11.29  E-value=2e+02  Score=24.94  Aligned_cols=12  Identities=50%  Similarity=0.736  Sum_probs=6.8

Q ss_pred             HHHHHHHhhCCC
Q 028341          127 KRKARAERFGLP  138 (210)
Q Consensus       127 KlKkRAERFG~~  138 (210)
                      -.+.|=+|||+.
T Consensus       146 lv~~RD~r~gv~  157 (171)
T PF06884_consen  146 LVKERDERFGVD  157 (171)
T ss_pred             HHHHHHHhcCCC
Confidence            345566666654


No 6  
>PF10642 Tom5:  Mitochondrial import receptor subunit or translocase;  InterPro: IPR019603  This entry represents a short family of yeast proteins. Tom5 is one of three very small translocases of the mitochondrial outer membrane. Tom5 links mitochondrial preprotein receptors to the general import pore []. Although Tom5 has allegedly been identified in vertebrates this could not be confirmed. 
Probab=10.87  E-value=2.5e+02  Score=19.56  Aligned_cols=19  Identities=47%  Similarity=0.597  Sum_probs=12.2

Q ss_pred             hCC-CCCCCHHHHHHHHHhh
Q 028341           89 FGM-PVQMSEEEKRNTRAER  107 (210)
Q Consensus        89 FGi-p~~lse~eKkk~RAeR  107 (210)
                      ||. +..+|++|++...++-
T Consensus         2 Fgg~~~qpS~eE~k~~e~~A   21 (49)
T PF10642_consen    2 FGGPPPQPSEEEIKAAEAQA   21 (49)
T ss_pred             CCCCCCCCCHHHHHHHHHHH
Confidence            666 3456777777766653


No 7  
>PF05673 DUF815:  Protein of unknown function (DUF815);  InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function.
Probab=6.94  E-value=4.5e+02  Score=23.96  Aligned_cols=9  Identities=56%  Similarity=0.958  Sum_probs=4.4

Q ss_pred             HHHhhCCCC
Q 028341          131 RAERFGLPV  139 (210)
Q Consensus       131 RAERFG~~~  139 (210)
                      =++++|+..
T Consensus       206 ~~~~~g~~~  214 (249)
T PF05673_consen  206 YAERYGLEL  214 (249)
T ss_pred             HHHHcCCCC
Confidence            445555544


No 8  
>PF04081 DNA_pol_delta_4:  DNA polymerase delta, subunit 4 ;  InterPro: IPR007218 DNA polymerase is responsible for effective DNA replication. The function of the delta subunit 4 of DNA polymerase is not yet known.; GO: 0006260 DNA replication, 0005634 nucleus
Probab=6.84  E-value=3.1e+02  Score=22.63  Aligned_cols=38  Identities=21%  Similarity=0.382  Sum_probs=21.0

Q ss_pred             CCChHHHHHH---HHhhhCCCCCCCHHHHHHHHHhhhCCCCC
Q 028341           75 LVTDTQKKIR---RAERFGMPVQMSEEEKRNTRAERFGTGSK  113 (210)
Q Consensus        75 ~lSd~EKk~~---RAeRFGip~~lse~eKkk~RAeRFGl~~~  113 (210)
                      .++..++.+.   -.-.||-..-+| --++=.||++|||+.|
T Consensus        60 ~~~~~e~~Lr~FDl~~~yGPC~Git-Rl~RW~RA~~lgL~PP  100 (124)
T PF04081_consen   60 DLSQHEKILRQFDLSSQYGPCIGIT-RLERWERAKRLGLNPP  100 (124)
T ss_pred             hhhHHHHHHHHhccccccCCccCch-HHHHHHHHHHcCCCCC
Confidence            3455554443   123344332232 3456789999999865


No 9  
>PF12824 MRP-L20:  Mitochondrial ribosomal protein subunit L20;  InterPro: IPR024388 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This entry represents the essential mitochondrial ribosomal protein L20 family from fungi [].
Probab=6.23  E-value=3.3e+02  Score=23.04  Aligned_cols=14  Identities=36%  Similarity=0.503  Sum_probs=7.3

Q ss_pred             HHHHHHHHhhhcCC
Q 028341          146 EEAKRKARLARFAP  159 (210)
Q Consensus       146 eeeKkkkRaERFG~  159 (210)
                      .+.++....+|.|.
T Consensus       135 ~~~~le~~k~rWg~  148 (164)
T PF12824_consen  135 MEARLEAIKSRWGP  148 (164)
T ss_pred             HHHHHHHHHHhccH
Confidence            34445555556664


No 10 
>PF13331 DUF4093:  Domain of unknown function (DUF4093)
Probab=6.06  E-value=1.2e+03  Score=17.57  Aligned_cols=11  Identities=27%  Similarity=0.440  Sum_probs=5.5

Q ss_pred             HHHHHHhhCCC
Q 028341          128 RKARAERFGLP  138 (210)
Q Consensus       128 lKkRAERFG~~  138 (210)
                      +.+|...||+.
T Consensus        68 llkrLN~f~it   78 (87)
T PF13331_consen   68 LLKRLNMFGIT   78 (87)
T ss_pred             HHHHHHHcCCC
Confidence            44555555554


Done!