Query         028382
Match_columns 210
No_of_seqs    152 out of 197
Neff          4.3 
Searched_HMMs 46136
Date          Fri Mar 29 10:38:53 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/028382.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/028382hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF04640 PLATZ:  PLATZ transcri 100.0 2.2E-40 4.9E-45  244.1   5.5   72   66-137     1-72  (72)
  2 PF00643 zf-B_box:  B-box zinc   96.6 0.00044 9.6E-09   44.6  -0.3   38   24-65      5-42  (42)
  3 cd00021 BBOX B-Box-type zinc f  96.0  0.0044 9.5E-08   38.8   1.7   37   24-64      2-38  (39)
  4 smart00336 BBOX B-Box-type zin  95.0   0.018 3.9E-07   36.4   2.0   36   24-63      5-40  (42)
  5 PRK01343 zinc-binding protein;  89.0    0.11 2.3E-06   37.3  -0.2   29  114-142     9-38  (57)
  6 PF03884 DUF329:  Domain of unk  88.2    0.06 1.3E-06   38.5  -2.0   29  114-142     2-35  (57)
  7 PF12855 Ecl1:  Life-span regul  87.6    0.11 2.5E-06   35.1  -0.8   28  114-141     6-36  (43)
  8 COG3024 Uncharacterized protei  87.0    0.18   4E-06   37.0  -0.1   29  114-142     7-40  (65)
  9 PRK00418 DNA gyrase inhibitor;  86.9    0.16 3.4E-06   37.0  -0.5   29  114-142     6-39  (62)
 10 PF10013 DUF2256:  Uncharacteri  79.1    0.56 1.2E-05   31.8  -0.2   23  114-136     8-39  (42)
 11 PF02207 zf-UBR:  Putative zinc  78.6    0.98 2.1E-05   32.6   0.9   34   35-68     11-48  (71)
 12 PF09889 DUF2116:  Uncharacteri  70.2     1.2 2.5E-05   32.1  -0.5   25  114-138     3-27  (59)
 13 PF13240 zinc_ribbon_2:  zinc-r  65.4     2.7   6E-05   24.6   0.5   16  117-132     2-17  (23)
 14 COG4338 Uncharacterized protei  60.3    0.73 1.6E-05   32.5  -3.0   24  113-136    11-43  (54)
 15 KOG2177 Predicted E3 ubiquitin  56.9     6.4 0.00014   32.0   1.5   39   24-67     88-127 (386)
 16 cd02340 ZZ_NBR1_like Zinc fing  55.9     7.4 0.00016   25.8   1.4   28   38-65     15-43  (43)
 17 smart00396 ZnF_UBR1 Putative z  55.1      13 0.00028   27.0   2.7   31   32-62      8-42  (71)
 18 PF13248 zf-ribbon_3:  zinc-rib  54.1     6.5 0.00014   23.3   0.8   19  114-132     2-20  (26)
 19 PF06467 zf-FCS:  MYM-type Zinc  48.7     4.6  0.0001   25.8  -0.5   25  112-136     4-40  (43)
 20 COG4068 Uncharacterized protei  41.1     7.7 0.00017   28.4  -0.3   23  114-136     8-30  (64)
 21 PRK05707 DNA polymerase III su  38.9      23  0.0005   32.6   2.3   93    9-102     4-113 (328)
 22 KOG4367 Predicted Zn-finger pr  36.5     9.6 0.00021   37.8  -0.6   35   23-61    224-259 (699)
 23 KOG4582 Uncharacterized conser  35.8      24 0.00052   32.0   1.9   57    8-67    132-199 (278)
 24 PF04438 zf-HIT:  HIT zinc fing  33.8      12 0.00026   23.3  -0.3   22  115-136     3-29  (30)
 25 TIGR00412 redox_disulf_2 small  32.2      65  0.0014   22.8   3.3   32   73-105    33-66  (76)
 26 PF04570 DUF581:  Protein of un  28.7      17 0.00036   26.1  -0.3   28  113-140    15-51  (58)
 27 cd02341 ZZ_ZZZ3 Zinc finger, Z  26.2      35 0.00076   23.3   1.0   28   38-65     16-48  (48)
 28 PF12773 DZR:  Double zinc ribb  21.2      40 0.00086   22.1   0.5   12  114-125    12-23  (50)
 29 smart00746 TRASH metallochaper  21.1      49  0.0011   18.2   0.8   10  128-137    24-33  (39)

No 1  
>PF04640 PLATZ:  PLATZ transcription factor;  InterPro: IPR006734 This family includes a conserved region in several uncharacterised plant proteins.
Probab=100.00  E-value=2.2e-40  Score=244.09  Aligned_cols=72  Identities=69%  Similarity=1.204  Sum_probs=71.1

Q ss_pred             EeccccceeeechhhhhhcccceeEEEECCcEEEEeecCCCCCCCCCCcccccccccccCCCCeeeeeccee
Q 028382           66 RRSSYHDVVRVGEIQNIMDISGVQTYVINSARVVFLNERPQPRSGKGVAHICEICGRSLLDPFRFCSLGCKL  137 (210)
Q Consensus        66 RRssY~dVVrv~dIqkl~D~S~IQtYvINsakVVfLn~RPq~r~~kg~~~~C~~C~R~L~d~~~FCSl~CKv  137 (210)
                      |||||||||||+|||||||||+||||+|||+||||||+|||+++.+++++.|++|+|+|+|+|+||||+|||
T Consensus         1 Rr~sY~dVVrv~di~kl~D~s~IQtY~iNs~kVVfLn~Rpq~~~~~~~~~~C~~C~R~L~d~~~fCSl~CKv   72 (72)
T PF04640_consen    1 RRYSYHDVVRVSDIQKLLDCSGIQTYVINSAKVVFLNPRPQSRPSKGSGNICETCHRSLQDPYRFCSLSCKV   72 (72)
T ss_pred             CcccccceEEHHHhHhhccccccEEEEeCCceEEEEccCCcCCCCCCCCCccCCCCCCCCCCCeEEeeeEEC
Confidence            799999999999999999999999999999999999999999999999999999999999999999999996


No 2  
>PF00643 zf-B_box:  B-box zinc finger;  InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents B-box-type zinc finger domains, which are around 40 residues in length. B-box zinc fingers can be divided into two groups, where types 1 and 2 B-box domains differ in their consensus sequence and in the spacing of the 7-8 zinc-binding residues. Several proteins contain both types 1 and 2 B-boxes, suggesting some level of cooperativity between these two domains. B-box domains are found in over 1500 proteins from a variety of organisms. They are found in TRIM (tripartite motif) proteins that consist of an N-terminal RING finger (originally called an A-box), followed by 1-2 B-box domains and a coiled-coil domain (also called RBCC for Ring, B-box, Coiled-Coil). TRIM proteins contain a type 2 B-box domain, and may also contain a type 1 B-box. In proteins that do not contain RING or coiled-coil domains, the B-box domain is primarily type 2. Many type 2 B-box proteins are involved in ubiquitinylation. Proteins containing a B-box zinc finger domain include transcription factors, ribonucleoproteins and proto-oncoproteins; for example, MID1, MID2, TRIM9, TNL, TRIM36, TRIM63, TRIFIC, NCL1 and CONSTANS-like proteins []. The microtubule-associated E3 ligase MID1 (6.3.2 from EC) contains a type 1 B-box zinc finger domain. MID1 specifically binds Alpha-4, which in turn recruits the catalytic subunit of phosphatase 2A (PP2Ac). This complex is required for targeting of PP2Ac for proteasome-mediated degradation. The MID1 B-box coordinates two zinc ions and adopts a beta/beta/alpha cross-brace structure similar to that of ZZ, PHD, RING and FYVE zinc fingers [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 3DDT_B 2D8U_A 3Q1D_A 2EGM_A 2YVR_B 2DJA_A 2DQ5_A 2JUN_A 2YRG_A 2DID_A ....
Probab=96.61  E-value=0.00044  Score=44.64  Aligned_cols=38  Identities=34%  Similarity=0.884  Sum_probs=29.9

Q ss_pred             hccccCCCCCCCCceecccCCCccCcCcccCCCCCCCceEEE
Q 028382           24 VCRTHGDAARSECNMYCLDCNDQAFCFYCRSSKHKDHQVIQI   65 (210)
Q Consensus        24 ~C~~H~~~~knE~N~FCldC~~~~~C~~C~~~~H~~HrvlQI   65 (210)
                      .|..|..   .+.++||.+|.. .+|..|....|++|.++.|
T Consensus         5 ~C~~H~~---~~~~~~C~~C~~-~~C~~C~~~~H~~H~~~~i   42 (42)
T PF00643_consen    5 KCPEHPE---EPLSLFCEDCNE-PLCSECTVSGHKGHKIVPI   42 (42)
T ss_dssp             B-SSTTT---SBEEEEETTTTE-EEEHHHHHTSTTTSEEEEC
T ss_pred             cCccCCc---cceEEEecCCCC-ccCccCCCCCCCCCEEeEC
Confidence            5888865   238899999985 9999997667999988754


No 3  
>cd00021 BBOX B-Box-type zinc finger; zinc binding domain (CHC3H2); often present in combination with other motifs, like RING zinc finger, NHL motif, coiled-coil or RFP domain in functionally unrelated proteins, most likely mediating protein-protein interaction.
Probab=95.96  E-value=0.0044  Score=38.79  Aligned_cols=37  Identities=24%  Similarity=0.671  Sum_probs=28.4

Q ss_pred             hccccCCCCCCCCceecccCCCccCcCcccCCCCCCCceEE
Q 028382           24 VCRTHGDAARSECNMYCLDCNDQAFCFYCRSSKHKDHQVIQ   64 (210)
Q Consensus        24 ~C~~H~~~~knE~N~FCldC~~~~~C~~C~~~~H~~HrvlQ   64 (210)
                      .|+.|..   +.-.+||.+|.. .+|..|....|++|.++-
T Consensus         2 ~C~~H~~---~~~~~fC~~~~~-~iC~~C~~~~H~~H~~~~   38 (39)
T cd00021           2 LCDEHGE---EPLSLFCETDRA-LLCVDCDLSVHSGHRRVP   38 (39)
T ss_pred             CCCccCC---cceEEEeCccCh-hhhhhcChhhcCCCCEee
Confidence            4777753   235899999985 899999666699997764


No 4  
>smart00336 BBOX B-Box-type zinc finger.
Probab=94.97  E-value=0.018  Score=36.39  Aligned_cols=36  Identities=31%  Similarity=0.937  Sum_probs=27.9

Q ss_pred             hccccCCCCCCCCceecccCCCccCcCcccCCCCCCCceE
Q 028382           24 VCRTHGDAARSECNMYCLDCNDQAFCFYCRSSKHKDHQVI   63 (210)
Q Consensus        24 ~C~~H~~~~knE~N~FCldC~~~~~C~~C~~~~H~~Hrvl   63 (210)
                      .|..|..   ..-.+||.+|.. .+|..|....|++|+++
T Consensus         5 ~C~~h~~---~~~~~~C~~c~~-~iC~~C~~~~H~~H~~~   40 (42)
T smart00336        5 KCDSHGD---EPAEFFCEECGA-LLCRTCDEAEHRGHTVV   40 (42)
T ss_pred             cCCCCCC---CceEEECCCCCc-ccccccChhhcCCCcee
Confidence            4777764   235899999985 99999965679999775


No 5  
>PRK01343 zinc-binding protein; Provisional
Probab=89.01  E-value=0.11  Score=37.29  Aligned_cols=29  Identities=28%  Similarity=0.637  Sum_probs=23.4

Q ss_pred             cccccccccccCCCC-eeeeecceeCeeec
Q 028382          114 AHICEICGRSLLDPF-RFCSLGCKLAGIKR  142 (210)
Q Consensus       114 ~~~C~~C~R~L~d~~-~FCSl~CKv~~~~~  142 (210)
                      ...|-+|++.....+ -|||-.||..++.+
T Consensus         9 ~~~CP~C~k~~~~~~rPFCS~RC~~iDLg~   38 (57)
T PRK01343          9 TRPCPECGKPSTREAYPFCSERCRDIDLNR   38 (57)
T ss_pred             CCcCCCCCCcCcCCCCcccCHHHhhhhHHH
Confidence            468999999987665 59999999866543


No 6  
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=88.19  E-value=0.06  Score=38.46  Aligned_cols=29  Identities=48%  Similarity=1.000  Sum_probs=18.2

Q ss_pred             cccccccccccCC----CCe-eeeecceeCeeec
Q 028382          114 AHICEICGRSLLD----PFR-FCSLGCKLAGIKR  142 (210)
Q Consensus       114 ~~~C~~C~R~L~d----~~~-FCSl~CKv~~~~~  142 (210)
                      +..|-+|++...-    +|+ |||-.||+..+.+
T Consensus         2 ~v~CP~C~k~~~~~~~n~~rPFCS~RCk~iDLg~   35 (57)
T PF03884_consen    2 TVKCPICGKPVEWSPENPFRPFCSERCKLIDLGR   35 (57)
T ss_dssp             EEE-TTT--EEE-SSSSS--SSSSHHHHHHHHS-
T ss_pred             cccCCCCCCeecccCCCCcCCcccHhhcccCHHH
Confidence            4579999999875    676 9999999877654


No 7  
>PF12855 Ecl1:  Life-span regulatory factor;  InterPro: IPR024368  The fungal proteins in this entry are involved in the regulation of chronological life-span [, ]. Overexpression of these proteins has been shown to extend the chronological life-span of wild-type strains. The mechanism by which this happens is not known, but microarray data suggests that they may function as pleiptropic stress regulators.
Probab=87.57  E-value=0.11  Score=35.06  Aligned_cols=28  Identities=25%  Similarity=0.656  Sum_probs=23.6

Q ss_pred             ccccccccccc---CCCCeeeeecceeCeee
Q 028382          114 AHICEICGRSL---LDPFRFCSLGCKLAGIK  141 (210)
Q Consensus       114 ~~~C~~C~R~L---~d~~~FCSl~CKv~~~~  141 (210)
                      .+.|.+|+|.+   .+...|||-.|++.+..
T Consensus         6 ~~yC~~Cdk~~~~~~~~~lYCSe~Cr~~D~~   36 (43)
T PF12855_consen    6 NDYCIVCDKQIDPPDDGSLYCSEECRLKDQE   36 (43)
T ss_pred             hhHHHHhhccccCCCCCccccCHHHHhHhhh
Confidence            46799999999   66789999999986653


No 8  
>COG3024 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=87.04  E-value=0.18  Score=37.02  Aligned_cols=29  Identities=41%  Similarity=0.953  Sum_probs=23.3

Q ss_pred             cccccccccccCC----CCe-eeeecceeCeeec
Q 028382          114 AHICEICGRSLLD----PFR-FCSLGCKLAGIKR  142 (210)
Q Consensus       114 ~~~C~~C~R~L~d----~~~-FCSl~CKv~~~~~  142 (210)
                      +..|-+||+...-    +|| |||-.||+-.+.+
T Consensus         7 ~v~CP~Cgkpv~w~~~s~frPFCSkRCklIDLg~   40 (65)
T COG3024           7 TVPCPTCGKPVVWGEESPFRPFCSKRCKLIDLGE   40 (65)
T ss_pred             cccCCCCCCcccccccCCcCcchhHhhhhcchhh
Confidence            4579999998864    665 9999999877654


No 9  
>PRK00418 DNA gyrase inhibitor; Reviewed
Probab=86.86  E-value=0.16  Score=37.01  Aligned_cols=29  Identities=38%  Similarity=0.944  Sum_probs=22.6

Q ss_pred             cccccccccccC----CCCe-eeeecceeCeeec
Q 028382          114 AHICEICGRSLL----DPFR-FCSLGCKLAGIKR  142 (210)
Q Consensus       114 ~~~C~~C~R~L~----d~~~-FCSl~CKv~~~~~  142 (210)
                      ...|-+|++...    .+|+ |||-.||+..+.+
T Consensus         6 ~v~CP~C~k~~~w~~~~~~rPFCS~RCk~IDLg~   39 (62)
T PRK00418          6 TVNCPTCGKPVEWGEISPFRPFCSKRCQLIDLGE   39 (62)
T ss_pred             cccCCCCCCcccccCCCCcCCcccHHHHhhhHHH
Confidence            567999999874    3565 9999999876644


No 10 
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=79.15  E-value=0.56  Score=31.81  Aligned_cols=23  Identities=39%  Similarity=1.139  Sum_probs=19.9

Q ss_pred             cccccccccccC---------CCCeeeeecce
Q 028382          114 AHICEICGRSLL---------DPFRFCSLGCK  136 (210)
Q Consensus       114 ~~~C~~C~R~L~---------d~~~FCSl~CK  136 (210)
                      ..+|.+|+|.+.         |...|||-.|.
T Consensus         8 ~K~C~~C~rpf~WRKKW~~~Wd~VkYCS~rCR   39 (42)
T PF10013_consen    8 SKICPVCGRPFTWRKKWARCWDEVKYCSDRCR   39 (42)
T ss_pred             CCcCcccCCcchHHHHHHHhchhhccHHHHhc
Confidence            568999999995         56899999997


No 11 
>PF02207 zf-UBR:  Putative zinc finger in N-recognin (UBR box);  InterPro: IPR003126 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The N-end rule-based degradation signal, which targets a protein for ubiquitin-dependent proteolysis, comprises a destabilising amino-terminal residue and a specific internal lysine residue. This entry describes a putative zinc finger in N-recognin, a recognition component of the N-end rule pathway []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0004842 ubiquitin-protein ligase activity, 0008270 zinc ion binding; PDB: 3NY1_B 3NIS_F 3NIM_A 3NIK_A 3NII_A 3NIH_A 3NIL_D 3NIN_B 3NIJ_A 3NIT_A ....
Probab=78.58  E-value=0.98  Score=32.61  Aligned_cols=34  Identities=32%  Similarity=0.616  Sum_probs=25.7

Q ss_pred             CCceecccCCC---ccCcCcc-cCCCCCCCceEEEEec
Q 028382           35 ECNMYCLDCND---QAFCFYC-RSSKHKDHQVIQIRRS   68 (210)
Q Consensus        35 E~N~FCldC~~---~~~C~~C-~~~~H~~HrvlQIRRs   68 (210)
                      +--..|++|..   .++|..| ....|.+|+++.++-.
T Consensus        11 q~~y~C~tC~~~~~~~iC~~CF~~~~H~gH~~~~~~~~   48 (71)
T PF02207_consen   11 QIFYRCLTCSLDESSGICEECFANSCHEGHRVVYYRSS   48 (71)
T ss_dssp             -EEEEETTTBSSTT-BBEHHHHCTSGGGGSSEEEEE--
T ss_pred             CEEEECccCCCCCCEEEchhhCCCCCcCCCcEEEEEeC
Confidence            55578999976   3799999 8889999998887654


No 12 
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=70.19  E-value=1.2  Score=32.08  Aligned_cols=25  Identities=28%  Similarity=0.755  Sum_probs=21.9

Q ss_pred             cccccccccccCCCCeeeeecceeC
Q 028382          114 AHICEICGRSLLDPFRFCSLGCKLA  138 (210)
Q Consensus       114 ~~~C~~C~R~L~d~~~FCSl~CKv~  138 (210)
                      ..+|..||..+..+-.|||-.|+=.
T Consensus         3 HkHC~~CG~~Ip~~~~fCS~~C~~~   27 (59)
T PF09889_consen    3 HKHCPVCGKPIPPDESFCSPKCREE   27 (59)
T ss_pred             CCcCCcCCCcCCcchhhhCHHHHHH
Confidence            4689999999998889999999943


No 13 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=65.40  E-value=2.7  Score=24.61  Aligned_cols=16  Identities=38%  Similarity=1.024  Sum_probs=14.2

Q ss_pred             ccccccccCCCCeeee
Q 028382          117 CEICGRSLLDPFRFCS  132 (210)
Q Consensus       117 C~~C~R~L~d~~~FCS  132 (210)
                      |..||..+.+...||+
T Consensus         2 Cp~CG~~~~~~~~fC~   17 (23)
T PF13240_consen    2 CPNCGAEIEDDAKFCP   17 (23)
T ss_pred             CcccCCCCCCcCcchh
Confidence            7889999999889986


No 14 
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=60.31  E-value=0.73  Score=32.49  Aligned_cols=24  Identities=33%  Similarity=0.948  Sum_probs=20.8

Q ss_pred             CcccccccccccC---------CCCeeeeecce
Q 028382          113 VAHICEICGRSLL---------DPFRFCSLGCK  136 (210)
Q Consensus       113 ~~~~C~~C~R~L~---------d~~~FCSl~CK  136 (210)
                      ...+|++|+|.+.         |...|||-.|+
T Consensus        11 p~KICpvCqRPFsWRkKW~~cWDeVKyCSeRCr   43 (54)
T COG4338          11 PDKICPVCQRPFSWRKKWARCWDEVKYCSERCR   43 (54)
T ss_pred             chhhhhhhcCchHHHHHHHHHHHHHHHHHHHHH
Confidence            4689999999984         56899999999


No 15 
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=56.91  E-value=6.4  Score=31.95  Aligned_cols=39  Identities=28%  Similarity=0.876  Sum_probs=30.8

Q ss_pred             hccccCCCCCCCCceecccCCCccCcCccc-CCCCCCCceEEEEe
Q 028382           24 VCRTHGDAARSECNMYCLDCNDQAFCFYCR-SSKHKDHQVIQIRR   67 (210)
Q Consensus        24 ~C~~H~~~~knE~N~FCldC~~~~~C~~C~-~~~H~~HrvlQIRR   67 (210)
                      .|..|...    ..+||..|.. .+|..|. ...|.+|.++.+..
T Consensus        88 ~c~~~~~~----~~~~c~~~~~-~~c~~c~~~~~h~~h~~~~~~~  127 (386)
T KOG2177|consen   88 LCEKHGEE----LKLFCEEDEK-LLCVLCRESGEHRGHPVLPLEE  127 (386)
T ss_pred             hhhhcCCc----ceEEeccccc-ccCCCCCCcccccCCccccHHH
Confidence            57777542    6799999985 8999996 67899998887643


No 16 
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger present in Drosophila ref(2)P, NBR1, Human sequestosome 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Drosophila ref(2)P appears to control the multiplication of sigma rhabdovirus. NBR1 (Next to BRCA1 gene 1 protein) interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB), and may function in cell signalling pathways. Sequestosome 1 is a phosphotyrosine independent ligand for the Lck SH2 domain and binds noncovalently to ubiquitin via its UBA domain.
Probab=55.86  E-value=7.4  Score=25.82  Aligned_cols=28  Identities=32%  Similarity=0.783  Sum_probs=20.1

Q ss_pred             eecccCCCccCcCccc-CCCCCCCceEEE
Q 028382           38 MYCLDCNDQAFCFYCR-SSKHKDHQVIQI   65 (210)
Q Consensus        38 ~FCldC~~~~~C~~C~-~~~H~~HrvlQI   65 (210)
                      .-|+.|..--||..|. ...|..|+.++|
T Consensus        15 y~C~~C~d~dLC~~C~~~~~H~~H~f~~~   43 (43)
T cd02340          15 YKCLVCPDYDLCESCEAKGVHPEHAMLKI   43 (43)
T ss_pred             EECCCCCCccchHHhhCcCCCCCCCEEeC
Confidence            5688887667999993 335777877754


No 17 
>smart00396 ZnF_UBR1 Putative zinc finger in N-recognin, a recognition component of the N-end rule pathway. Domain is involved in recognition of N-end rule substrates in yeast Ubr1p
Probab=55.10  E-value=13  Score=27.00  Aligned_cols=31  Identities=26%  Similarity=0.499  Sum_probs=23.7

Q ss_pred             CCCCCceecccCCCc---cCcCcccC-CCCCCCce
Q 028382           32 ARSECNMYCLDCNDQ---AFCFYCRS-SKHKDHQV   62 (210)
Q Consensus        32 ~knE~N~FCldC~~~---~~C~~C~~-~~H~~Hrv   62 (210)
                      .++|.-..|++|...   .+|..|.. ..|.+|++
T Consensus         8 ~~~~~~y~C~tC~~~~~~~iC~~Cf~~~~H~gH~~   42 (71)
T smart00396        8 TGGEVIYRCKTCGLDPTCVLCSDCFRSNCHKGHDY   42 (71)
T ss_pred             CCCCEEEECcCCCCCCCEeEChHHCCCCCCCCCCE
Confidence            345666889999754   68999966 78999974


No 18 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=54.13  E-value=6.5  Score=23.32  Aligned_cols=19  Identities=26%  Similarity=0.742  Sum_probs=15.6

Q ss_pred             cccccccccccCCCCeeee
Q 028382          114 AHICEICGRSLLDPFRFCS  132 (210)
Q Consensus       114 ~~~C~~C~R~L~d~~~FCS  132 (210)
                      ...|..|+..+.+..+||+
T Consensus         2 ~~~Cp~Cg~~~~~~~~fC~   20 (26)
T PF13248_consen    2 EMFCPNCGAEIDPDAKFCP   20 (26)
T ss_pred             cCCCcccCCcCCcccccCh
Confidence            3578899998888889986


No 19 
>PF06467 zf-FCS:  MYM-type Zinc finger with FCS sequence motif;  InterPro: IPR010507 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  MYM-type zinc fingers were identified in MYM family proteins []. Human protein Q14202 from SWISSPROT is involved in a chromosomal translocation and may be responsible for X-linked retardation in XQ13.1 []. Q9UBW7 from SWISSPROT is also involved in disease. In myeloproliferative disorders it is fused to FGF receptor 1 []; in atypical myeloproliferative disorders it is rearranged []. Members of the family generally are involved in development. This Zn-finger domain functions as a transcriptional trans-activator of late vaccinia viral genes, and orthologues are also found in all nucleocytoplasmic large DNA viruses, NCLDV. This domain is also found fused to the C termini of recombinases from certain prokaryotic transposons []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2L8E_A 2DAS_A.
Probab=48.66  E-value=4.6  Score=25.76  Aligned_cols=25  Identities=24%  Similarity=0.571  Sum_probs=15.0

Q ss_pred             CCcccccccccccCC------------CCeeeeecce
Q 028382          112 GVAHICEICGRSLLD------------PFRFCSLGCK  136 (210)
Q Consensus       112 g~~~~C~~C~R~L~d------------~~~FCSl~CK  136 (210)
                      .....|..|++.+..            ...|||..|.
T Consensus         4 ~~~~~C~~C~~~~~~~~~~~~~~~~g~~~~FCS~~C~   40 (43)
T PF06467_consen    4 LKMKTCSYCKKYIPNKPTMIEVQYDGKMKQFCSQSCL   40 (43)
T ss_dssp             -SCEE-TTT--EEECCC----EE-TTTTSCCSSHHHH
T ss_pred             CcCCcCcccCCcccCCCccccccccCcccChhCHHHH
Confidence            346789999887742            1379999885


No 20 
>COG4068 Uncharacterized protein containing a Zn-ribbon [Function unknown]
Probab=41.06  E-value=7.7  Score=28.37  Aligned_cols=23  Identities=26%  Similarity=0.717  Sum_probs=21.1

Q ss_pred             cccccccccccCCCCeeeeecce
Q 028382          114 AHICEICGRSLLDPFRFCSLGCK  136 (210)
Q Consensus       114 ~~~C~~C~R~L~d~~~FCSl~CK  136 (210)
                      ..+|.+|+..+...-+|||-.|.
T Consensus         8 H~HC~VCg~aIp~de~~CSe~C~   30 (64)
T COG4068           8 HRHCVVCGKAIPPDEQVCSEECG   30 (64)
T ss_pred             CccccccCCcCCCccchHHHHHH
Confidence            46899999999988899999997


No 21 
>PRK05707 DNA polymerase III subunit delta'; Validated
Probab=38.93  E-value=23  Score=32.57  Aligned_cols=93  Identities=11%  Similarity=0.270  Sum_probs=50.5

Q ss_pred             CCccHHHHhcchhhhhccccCC---CCCC----------CCceecccCCCc---cCcCcccCCCCCCCc-eEEEEecccc
Q 028382            9 VPPWLEPMLRTAFFTVCRTHGD---AARS----------ECNMYCLDCNDQ---AFCFYCRSSKHKDHQ-VIQIRRSSYH   71 (210)
Q Consensus         9 ~P~WL~~LL~~~FF~~C~~H~~---~~kn----------E~N~FCldC~~~---~~C~~C~~~~H~~Hr-vlQIRRssY~   71 (210)
                      .-|||...++.-+-..--.|.-   ...+          -+-++|.+=...   .-|+.|.+-....|+ +..|..-.=.
T Consensus         4 ~yPWl~~~~~~~~~~~r~~ha~Lf~G~~G~GK~~~A~~~A~~llC~~~~~~~~Cg~C~sC~~~~~g~HPD~~~i~~~~~~   83 (328)
T PRK05707          4 IYPWQQSLWQQLAGRGRHPHAYLLHGPAGIGKRALAERLAAALLCEAPQGGGACGSCKGCQLLRAGSHPDNFVLEPEEAD   83 (328)
T ss_pred             CCCCcHHHHHHHHHCCCcceeeeeECCCCCCHHHHHHHHHHHHcCCCCCCCCCCCCCHHHHHHhcCCCCCEEEEeccCCC
Confidence            4799999998766554445532   1111          113455431111   247777544444453 4444332113


Q ss_pred             ceeeechhhhhhcccceeEEEECCcEEEEee
Q 028382           72 DVVRVGEIQNIMDISGVQTYVINSARVVFLN  102 (210)
Q Consensus        72 dVVrv~dIqkl~D~S~IQtYvINsakVVfLn  102 (210)
                      ..|+|++|.++++--..=++ .++.|||.|.
T Consensus        84 ~~i~id~iR~l~~~~~~~~~-~~~~kv~iI~  113 (328)
T PRK05707         84 KTIKVDQVRELVSFVVQTAQ-LGGRKVVLIE  113 (328)
T ss_pred             CCCCHHHHHHHHHHHhhccc-cCCCeEEEEC
Confidence            56899999988654443232 3678888884


No 22 
>KOG4367 consensus Predicted Zn-finger protein [Function unknown]
Probab=36.47  E-value=9.6  Score=37.79  Aligned_cols=35  Identities=31%  Similarity=0.872  Sum_probs=25.7

Q ss_pred             hhccccCCCCCCCCceecccCCCccCcCcccC-CCCCCCc
Q 028382           23 TVCRTHGDAARSECNMYCLDCNDQAFCFYCRS-SKHKDHQ   61 (210)
Q Consensus        23 ~~C~~H~~~~knE~N~FCldC~~~~~C~~C~~-~~H~~Hr   61 (210)
                      ..|..|....   -.|||+.|.. ++|..|+. ..|..|.
T Consensus       224 ~~ct~h~~e~---~smyc~~ck~-pvc~~clee~khs~he  259 (699)
T KOG4367|consen  224 STCTDHELEN---HSMYCVQCKM-PVCYQCLEEGKHSSHE  259 (699)
T ss_pred             hhccCCCCCC---ceEEEEecCC-hHHHHHHHhhcccchh
Confidence            4688887633   6799999985 99999942 2466663


No 23 
>KOG4582 consensus Uncharacterized conserved protein, contains ZZ-type Zn-finger [General function prediction only]
Probab=35.78  E-value=24  Score=31.98  Aligned_cols=57  Identities=19%  Similarity=0.423  Sum_probs=35.7

Q ss_pred             CCCccHHHHhcc-hhh-----hhccc---cCCCCCCCCceecccCCCccCcCcccCC--CCCCCceEEEEe
Q 028382            8 LVPPWLEPMLRT-AFF-----TVCRT---HGDAARSECNMYCLDCNDQAFCFYCRSS--KHKDHQVIQIRR   67 (210)
Q Consensus         8 ~~P~WL~~LL~~-~FF-----~~C~~---H~~~~knE~N~FCldC~~~~~C~~C~~~--~H~~HrvlQIRR   67 (210)
                      ..+.||++-+.+ -++     ..|..   |.-..   --.-|..|...-||..|-..  +|..|..|||.+
T Consensus       132 ~~~~~~~~~~~~~H~~~~~~~v~CD~C~~~~IvG---~RyKC~~C~dYDLCe~Ce~~~~~h~~H~~lR~~t  199 (278)
T KOG4582|consen  132 SLVITLNPVVGEMHPNISKLSVPCDNCGKPGIVG---ARYKCTVCPDYDLCERCEAGNEHHAAHAMLRLHT  199 (278)
T ss_pred             hhhhhcCCCccccCCCcccccccCCCccCCcccc---ceeeecCCCccchhHHhhcCCCCCcccceeeccc
Confidence            346666665543 334     34443   33211   22579999877899999433  678899999766


No 24 
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=33.81  E-value=12  Score=23.26  Aligned_cols=22  Identities=36%  Similarity=0.969  Sum_probs=13.0

Q ss_pred             ccccccccccC-----CCCeeeeecce
Q 028382          115 HICEICGRSLL-----DPFRFCSLGCK  136 (210)
Q Consensus       115 ~~C~~C~R~L~-----d~~~FCSl~CK  136 (210)
                      ..|.+|+..-.     -..+||||.|.
T Consensus         3 ~~C~vC~~~~kY~Cp~C~~~~CSl~C~   29 (30)
T PF04438_consen    3 KLCSVCGNPAKYRCPRCGARYCSLACY   29 (30)
T ss_dssp             EEETSSSSEESEE-TTT--EESSHHHH
T ss_pred             CCCccCcCCCEEECCCcCCceeCcEeE
Confidence            35777776221     13579999984


No 25 
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2. This small protein is found in three archaeal species so far (Methanococcus jannaschii, Archeoglobus fulgidus, and Methanobacterium thermoautotrophicum) as well as in Anabaena PCC7120. It is homologous to thioredoxins, glutaredoxins, and protein disulfide isomerases, and shares with them a redox-active disulfide. The redox active disulfide region CXXC motif resembles neither thioredoxin nor glutaredoxin. A closely related protein found in the same three Archaea, described by redox_disulf_1, has a glutaredoxin-like CP[YH]C sequence; it has been characterized in functional assays as redox-active but unlikely to be a thioredoxin or glutaredoxin.
Probab=32.23  E-value=65  Score=22.81  Aligned_cols=32  Identities=13%  Similarity=0.352  Sum_probs=22.7

Q ss_pred             eeeechhhhh--hcccceeEEEECCcEEEEeecCC
Q 028382           73 VVRVGEIQNI--MDISGVQTYVINSARVVFLNERP  105 (210)
Q Consensus        73 VVrv~dIqkl--~D~S~IQtYvINsakVVfLn~RP  105 (210)
                      +++++|++..  +++.+|-|.++||..+ +....|
T Consensus        33 ~~~v~~~~~a~~~~v~~vPti~i~G~~~-~~G~~~   66 (76)
T TIGR00412        33 FEKVTDMNEILEAGVTATPGVAVDGELV-IMGKIP   66 (76)
T ss_pred             EEEeCCHHHHHHcCCCcCCEEEECCEEE-EEeccC
Confidence            5666665554  7999999999988666 554434


No 26 
>PF04570 DUF581:  Protein of unknown function (DUF581);  InterPro: IPR007650 This is a family of uncharacterised proteins.
Probab=28.71  E-value=17  Score=26.08  Aligned_cols=28  Identities=32%  Similarity=0.751  Sum_probs=21.1

Q ss_pred             CcccccccccccC---CC--C----eeeeecceeCee
Q 028382          113 VAHICEICGRSLL---DP--F----RFCSLGCKLAGI  140 (210)
Q Consensus       113 ~~~~C~~C~R~L~---d~--~----~FCSl~CKv~~~  140 (210)
                      .-..|-.|.|.|.   |-  |    -|||..|.-..|
T Consensus        15 FL~~C~~C~k~L~~~~DiymYrGd~aFCS~ECR~~qi   51 (58)
T PF04570_consen   15 FLSFCYLCKKKLDPGKDIYMYRGDKAFCSEECRSQQI   51 (58)
T ss_pred             HHHHHHccCCCCCCCCCeeeeccccccccHHHHHHHH
Confidence            3578999999998   32  3    399999985544


No 27 
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present in ZZZ3 (ZZ finger containing 3) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=26.23  E-value=35  Score=23.27  Aligned_cols=28  Identities=32%  Similarity=0.805  Sum_probs=18.9

Q ss_pred             eecccCC--CccCcCcccCC--CC-CCCceEEE
Q 028382           38 MYCLDCN--DQAFCFYCRSS--KH-KDHQVIQI   65 (210)
Q Consensus        38 ~FCldC~--~~~~C~~C~~~--~H-~~HrvlQI   65 (210)
                      .-|++|.  .--+|..|...  .| .+|+++.|
T Consensus        16 ~~C~~C~~~d~DlC~~C~~~~~~H~~~H~~~~i   48 (48)
T cd02341          16 YHCSECDDGDFDLCQDCVVKGESHQEDHWLVKI   48 (48)
T ss_pred             EECCCCCCCCCccCHHHHhCcCCCCCCCceeeC
Confidence            5688887  55799999432  35 56777654


No 28 
>PF12773 DZR:  Double zinc ribbon
Probab=21.16  E-value=40  Score=22.07  Aligned_cols=12  Identities=42%  Similarity=0.910  Sum_probs=6.1

Q ss_pred             cccccccccccC
Q 028382          114 AHICEICGRSLL  125 (210)
Q Consensus       114 ~~~C~~C~R~L~  125 (210)
                      ...|..||..|.
T Consensus        12 ~~fC~~CG~~l~   23 (50)
T PF12773_consen   12 AKFCPHCGTPLP   23 (50)
T ss_pred             ccCChhhcCChh
Confidence            344555555554


No 29 
>smart00746 TRASH metallochaperone-like domain.
Probab=21.08  E-value=49  Score=18.21  Aligned_cols=10  Identities=50%  Similarity=0.999  Sum_probs=7.5

Q ss_pred             Ceeeeeccee
Q 028382          128 FRFCSLGCKL  137 (210)
Q Consensus       128 ~~FCSl~CKv  137 (210)
                      +.|||..|..
T Consensus        24 ~~FCs~~c~~   33 (39)
T smart00746       24 FYFCSSKCLS   33 (39)
T ss_pred             EEEeCHHHHH
Confidence            5788888863


Done!