BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 028405
         (209 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase
           (P450c21)
 pdb|3QZ1|B Chain B, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase
           (P450c21)
 pdb|3QZ1|C Chain C, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase
           (P450c21)
 pdb|3QZ1|D Chain D, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase
           (P450c21)
          Length = 496

 Score = 28.1 bits (61), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 24/46 (52%)

Query: 90  PTLPQPTTNLVQSVGPLFFAALRERPSGSLNTPLTVVAAGLAKWLD 135
           P LP    +L Q +GP++   L  +    LN+  T+  A + KW+D
Sbjct: 43  PNLPIHLLSLTQKLGPVYRLRLGLQEVVVLNSKRTIEEAMIRKWVD 88


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.140    0.432 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,730,273
Number of Sequences: 62578
Number of extensions: 157542
Number of successful extensions: 301
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 297
Number of HSP's gapped (non-prelim): 4
length of query: 209
length of database: 14,973,337
effective HSP length: 94
effective length of query: 115
effective length of database: 9,091,005
effective search space: 1045465575
effective search space used: 1045465575
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 49 (23.5 bits)