Citrus Sinensis ID: 028416

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MASVVYENLPPVLDSKSEQPPPPLFDGTTRLYMAYTCPFAQRVWITRNYKGLQDEIKLVAFDLQDKPAWYKEKVYPSNKVPSLEHNGKIIGESLDLINYVDSNFEGPSLLPDDPEKRKFAEELFSYSDTFIKDVSTSFKGDTAKEAGPAFDFLEKALDKFDDGPFFLGQFSLVDIAYIPFVDGYQMILSEGFKYDATIGRPKLAAWIEQ
ccccccccccccccccccccccccccccEEEEcccccHHHHHHHHHHHHccccccccEEccccccccHHHHHcccccccccEEEEccCEEEHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHcc
************************FDGTTRLYMAYTCPFAQRVWITRNYKGLQDEIKLVAFDLQDKPAWYKEKVYPSNKVPSLEHNGKIIGESLDLINYVDSNFEGPSLLPDDPEKRKFAEELFSYSDTFIKDVSTSFKGDTAKEAGPAFDFLEKALDKFDDGPFFLGQFSLVDIAYIPFVDGYQMILSEGFKYDATIGRPKLAAWIEQ
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASVVYENLPPVLDSKSEQPPPPLFDGTTRLYMAYTCPFAQRVWITRNYKGLQDEIKLVAFDLQDKPAWYKEKVYPSNKVPSLEHNGKIIGESLDLINYVDSNFEGPSLLPDDPEKRKFAEELFSYSDTFIKDVSTSFKGDTAKEAGPAFDFLEKALDKFDDGPFFLGQFSLVDIAYIPFVDGYQMILSEGFKYDATIGRPKLAAWIEQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein IN2-1 homolog B probableQ8H8U5
Glutathione S-transferase L3 Catalyzes the glutathione-dependent reduction of S-glutathionylquercetin to quercetin.probableQ9LZ06
Glutathione S-transferase L1 Catalyzes the glutathione-dependent reduction of S-glutathionylquercetin to quercetin. In vitro, possesses glutathione-dependent thiol transferase activity toward 2-hydroxyethyl disulfide (HED).probableQ6NLB0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3VLN, chain A
Confidence level:very confident
Coverage over the Query: 9-209
View the alignment between query and template
View the model in PyMOL