Citrus Sinensis ID: 028424

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MVSGDIYEHAVLLSVKVEDQDAFERDFFQLKPYYTDAGKRLPPSPNEYMILGLNLLRLLVQNRIAEFHTELELLSSTALENPCIKHAVELEQSFMEGAYNRVLSAKQNVPNETYGYFMDLLAKTVRDEIAGCSEKAYDYLSIKDAGQMLLFTSDQELLEYVKEEHPEWEMKDGFVFFQKAKDSAPCKEIPSLQLINQTLSYARELERIV
cHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHccHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHccccccccccEEEEcccccccccccccHHHHHHHHHHHHHHHcccc
MVSGDIYEHAVLLSVKVEDQDAFERDFFQLKPYYTDAGKRLPPSPNEYMILGLNLLRLLVQNRIAEFHTELELLSSTALENPCIKHAVELEQSFMEGAYNRVLSAKQNVPNETYGYFMDLLAKTVRDEIAGCSEKAYDYLSIKDAGQMLLFTSDQELLEYVKEEHPEWEMKDGFVFFQKAKDSAPCKEIPSLQLINQTLSYARELERIV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSGDIYEHAVLLSVKVEDQDAFERDFFQLKPYYTDAGKRLPPSPNEYMILGLNLLRLLVQNRIAEFHTELELLSSTALENPCIKHAVELEQSFMEGAYNRVLSAKQNVPNETYGYFMDLLAKTVRDEIAGCSEKAYDYLSIKDAGQMLLFTSDQELLEYVKEEHPEWEMKDGFVFFQKAKDSAPCKEIPSLQLINQTLSYARELERIV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
26S proteasome non-ATPase regulatory subunit RPN12A Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins. May help to control the degradation of one or more factors that repress cytokinin signaling.probableQ9SGW3
26S proteasome non-ATPase regulatory subunit 8 Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.probableQ23449

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4B4T, chain T
Confidence level:very confident
Coverage over the Query: 6-177
View the alignment between query and template
View the model in PyMOL