BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 028426
         (209 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1VQZ|A Chain A, Crystal Structure Of A Putative Lipoate-Protein Ligase A
           (Sp_1160) From Streptococcus Pneumoniae Tigr4 At 1.99 A
           Resolution
          Length = 341

 Score = 30.4 bits (67), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 75  ADFQLRENDYVFGNRKFGGNAQSITKNRWIHHTSFLWD 112
           A+F  R ND     +KF GNAQ+    R  HH   L+D
Sbjct: 128 AEFTGR-NDLEIDGKKFCGNAQAYINGRIXHHGCLLFD 164


>pdb|3IOH|A Chain A, Crystal Structure Of The Fucosylgalactoside Alpha N-
           Acetylgalactosaminyltransferase (Gta, Cisab Mutant
           L266g, G
 pdb|3IOI|A Chain A, Crystal Structure Of The Fucosylgalactoside Alpha N-
           Acetylgalactosaminyltransferase (Gta, Cisab Mutant
           L266g, G Complex With A Novel Udp-Gal Derived Inhibitor
           (1gw)
 pdb|3IOJ|A Chain A, Crystal Structure Of The Fucosylgalactoside Alpha N-
           Acetylgalactosaminyltransferase (Gta, Cisab Mutant
           L266g, G Complex With Udp
 pdb|3IOJ|B Chain B, Crystal Structure Of The Fucosylgalactoside Alpha N-
           Acetylgalactosaminyltransferase (Gta, Cisab Mutant
           L266g, G Complex With Udp
 pdb|3U0Y|A Chain A, Crystal Structure Of The Fucosylgalactoside Alpha N-
           Acetylgalactosaminyltransferase (Gta, Cisab Mutant
           L266g, G268a) In Complex With Compound 382 And Udp
 pdb|3U0Y|B Chain B, Crystal Structure Of The Fucosylgalactoside Alpha N-
           Acetylgalactosaminyltransferase (Gta, Cisab Mutant
           L266g, G268a) In Complex With Compound 382 And Udp
 pdb|3V0L|A Chain A, Crystal Structure Of The Fucosylgalactoside Alpha N-
           Acetylgalactosaminyltransferase (gta, Cisab Mutant
           L266g, G268a) In Complex With A Novel Udp-gal Derived
           Inhibitor (2gw)
 pdb|3V0M|A Chain A, Crystal Structure Of The Fucosylgalactoside Alpha N-
           Acetylgalactosaminyltransferase (gta, Cisab Mutant
           L266g, G268a) In Complex With A Novel Udp-gal Derived
           Inhibitor (5gw) And H-antigen Acceptor
 pdb|3V0M|B Chain B, Crystal Structure Of The Fucosylgalactoside Alpha N-
           Acetylgalactosaminyltransferase (gta, Cisab Mutant
           L266g, G268a) In Complex With A Novel Udp-gal Derived
           Inhibitor (5gw) And H-antigen Acceptor
 pdb|3V0N|A Chain A, Crystal Structure Of The Fucosylgalactoside Alpha N-
           Acetylgalactosaminyltransferase (gta, Cisab Mutant
           L266g, G268a) In Complex With A Novel Udp-galnac Derived
           Inhibitor (3gw And 4gw)
 pdb|3V0N|B Chain B, Crystal Structure Of The Fucosylgalactoside Alpha N-
           Acetylgalactosaminyltransferase (gta, Cisab Mutant
           L266g, G268a) In Complex With A Novel Udp-galnac Derived
           Inhibitor (3gw And 4gw)
 pdb|3V0O|A Chain A, Crystal Structure Of The Fucosylgalactoside Alpha N-
           Acetylgalactosaminyltransferase (gta, Cisab Mutant
           L266g, G268a) In Complex With A Novel Udp-galnac Derived
           Inhibitor (4gw) And H-antigen Acceptor
 pdb|3V0O|B Chain B, Crystal Structure Of The Fucosylgalactoside Alpha N-
           Acetylgalactosaminyltransferase (gta, Cisab Mutant
           L266g, G268a) In Complex With A Novel Udp-galnac Derived
           Inhibitor (4gw) And H-antigen Acceptor
 pdb|3V0P|A Chain A, Crystal Structure Of The Fucosylgalactoside Alpha N-
           Acetylgalactosaminyltransferase (gta, Cisab Mutant
           L266g, G268a) In Complex With A Novel Udp-gal Derived
           Inhibitor (4gw) And H-antigen Acceptor
 pdb|3V0P|B Chain B, Crystal Structure Of The Fucosylgalactoside Alpha N-
           Acetylgalactosaminyltransferase (gta, Cisab Mutant
           L266g, G268a) In Complex With A Novel Udp-gal Derived
           Inhibitor (4gw) And H-antigen Acceptor
 pdb|3V0Q|A Chain A, Crystal Structure Of The Fucosylgalactoside Alpha N-
           Acetylgalactosaminyltransferase (gta, Cisab Mutant
           L266g, G268a) In Complex With Udp And H-antigen Acceptor
 pdb|3V0Q|B Chain B, Crystal Structure Of The Fucosylgalactoside Alpha N-
           Acetylgalactosaminyltransferase (gta, Cisab Mutant
           L266g, G268a) In Complex With Udp And H-antigen Acceptor
 pdb|3ZGF|A Chain A, Crystal Structure Of The Fucosylgalactoside Alpha N-
           Acetylgalactosaminyltransferase (gta, Cisab Mutant
           L266g, G268a) In Complex With In Complex With Npe Caged
           Udp-gal ( P2(1)2(1)2(1) Space Group)
 pdb|3ZGF|B Chain B, Crystal Structure Of The Fucosylgalactoside Alpha N-
           Acetylgalactosaminyltransferase (gta, Cisab Mutant
           L266g, G268a) In Complex With In Complex With Npe Caged
           Udp-gal ( P2(1)2(1)2(1) Space Group)
          Length = 298

 Score = 26.9 bits (58), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 29/67 (43%), Gaps = 2/67 (2%)

Query: 81  ENDYVFGNRKFGGNAQSITKNRWIHHTSFLWDYAEGNMAFLKQPARAPEYRMERGHTEFI 140
           E D+ +G   FGG+ Q + +     H + + D A G  A     +   +Y +    T+ +
Sbjct: 204 EGDFYYGGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVL 263

Query: 141 CRMNEYL 147
               EYL
Sbjct: 264 S--PEYL 268


>pdb|4GKL|A Chain A, Crystal Structure Of A Noncanonic Maltogenic Alpha-amylase
           Amyb From Thermotoga Neapolitana
 pdb|4GKL|B Chain B, Crystal Structure Of A Noncanonic Maltogenic Alpha-amylase
           Amyb From Thermotoga Neapolitana
          Length = 422

 Score = 26.6 bits (57), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 49/117 (41%), Gaps = 16/117 (13%)

Query: 48  DVPGVQPF--PRSIMSWSGLLYNQVFKGI------ADFQLRENDYVFGNRKF---GGNAQ 96
           D P V  F    S+M W   L+    KG+       ++ L+E+  +F        G   +
Sbjct: 257 DQPRVAKFLSRESLMHWIAFLF--TVKGVPLVHNGQEYALKEDLDIFNEYTLPIPGEENE 314

Query: 97  SITKNRWIHHTSFLWD-YAEGNMAFLK--QPARAPEYRMERGHTEFICRMNEYLPRT 150
             + +R + H  +  + ++ G M F++  QP R   Y    G+   +C +N  L  T
Sbjct: 315 IFSLHRKLAHYRYKTNVFSNGEMIFIRNDQPERVISYLWRHGNRFILCVLNPLLENT 371


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.137    0.415 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,076,699
Number of Sequences: 62578
Number of extensions: 232028
Number of successful extensions: 383
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 381
Number of HSP's gapped (non-prelim): 3
length of query: 209
length of database: 14,973,337
effective HSP length: 94
effective length of query: 115
effective length of database: 9,091,005
effective search space: 1045465575
effective search space used: 1045465575
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)