BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 028426
(209 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1VQZ|A Chain A, Crystal Structure Of A Putative Lipoate-Protein Ligase A
(Sp_1160) From Streptococcus Pneumoniae Tigr4 At 1.99 A
Resolution
Length = 341
Score = 30.4 bits (67), Expect = 0.74, Method: Compositional matrix adjust.
Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 1/38 (2%)
Query: 75 ADFQLRENDYVFGNRKFGGNAQSITKNRWIHHTSFLWD 112
A+F R ND +KF GNAQ+ R HH L+D
Sbjct: 128 AEFTGR-NDLEIDGKKFCGNAQAYINGRIXHHGCLLFD 164
>pdb|3IOH|A Chain A, Crystal Structure Of The Fucosylgalactoside Alpha N-
Acetylgalactosaminyltransferase (Gta, Cisab Mutant
L266g, G
pdb|3IOI|A Chain A, Crystal Structure Of The Fucosylgalactoside Alpha N-
Acetylgalactosaminyltransferase (Gta, Cisab Mutant
L266g, G Complex With A Novel Udp-Gal Derived Inhibitor
(1gw)
pdb|3IOJ|A Chain A, Crystal Structure Of The Fucosylgalactoside Alpha N-
Acetylgalactosaminyltransferase (Gta, Cisab Mutant
L266g, G Complex With Udp
pdb|3IOJ|B Chain B, Crystal Structure Of The Fucosylgalactoside Alpha N-
Acetylgalactosaminyltransferase (Gta, Cisab Mutant
L266g, G Complex With Udp
pdb|3U0Y|A Chain A, Crystal Structure Of The Fucosylgalactoside Alpha N-
Acetylgalactosaminyltransferase (Gta, Cisab Mutant
L266g, G268a) In Complex With Compound 382 And Udp
pdb|3U0Y|B Chain B, Crystal Structure Of The Fucosylgalactoside Alpha N-
Acetylgalactosaminyltransferase (Gta, Cisab Mutant
L266g, G268a) In Complex With Compound 382 And Udp
pdb|3V0L|A Chain A, Crystal Structure Of The Fucosylgalactoside Alpha N-
Acetylgalactosaminyltransferase (gta, Cisab Mutant
L266g, G268a) In Complex With A Novel Udp-gal Derived
Inhibitor (2gw)
pdb|3V0M|A Chain A, Crystal Structure Of The Fucosylgalactoside Alpha N-
Acetylgalactosaminyltransferase (gta, Cisab Mutant
L266g, G268a) In Complex With A Novel Udp-gal Derived
Inhibitor (5gw) And H-antigen Acceptor
pdb|3V0M|B Chain B, Crystal Structure Of The Fucosylgalactoside Alpha N-
Acetylgalactosaminyltransferase (gta, Cisab Mutant
L266g, G268a) In Complex With A Novel Udp-gal Derived
Inhibitor (5gw) And H-antigen Acceptor
pdb|3V0N|A Chain A, Crystal Structure Of The Fucosylgalactoside Alpha N-
Acetylgalactosaminyltransferase (gta, Cisab Mutant
L266g, G268a) In Complex With A Novel Udp-galnac Derived
Inhibitor (3gw And 4gw)
pdb|3V0N|B Chain B, Crystal Structure Of The Fucosylgalactoside Alpha N-
Acetylgalactosaminyltransferase (gta, Cisab Mutant
L266g, G268a) In Complex With A Novel Udp-galnac Derived
Inhibitor (3gw And 4gw)
pdb|3V0O|A Chain A, Crystal Structure Of The Fucosylgalactoside Alpha N-
Acetylgalactosaminyltransferase (gta, Cisab Mutant
L266g, G268a) In Complex With A Novel Udp-galnac Derived
Inhibitor (4gw) And H-antigen Acceptor
pdb|3V0O|B Chain B, Crystal Structure Of The Fucosylgalactoside Alpha N-
Acetylgalactosaminyltransferase (gta, Cisab Mutant
L266g, G268a) In Complex With A Novel Udp-galnac Derived
Inhibitor (4gw) And H-antigen Acceptor
pdb|3V0P|A Chain A, Crystal Structure Of The Fucosylgalactoside Alpha N-
Acetylgalactosaminyltransferase (gta, Cisab Mutant
L266g, G268a) In Complex With A Novel Udp-gal Derived
Inhibitor (4gw) And H-antigen Acceptor
pdb|3V0P|B Chain B, Crystal Structure Of The Fucosylgalactoside Alpha N-
Acetylgalactosaminyltransferase (gta, Cisab Mutant
L266g, G268a) In Complex With A Novel Udp-gal Derived
Inhibitor (4gw) And H-antigen Acceptor
pdb|3V0Q|A Chain A, Crystal Structure Of The Fucosylgalactoside Alpha N-
Acetylgalactosaminyltransferase (gta, Cisab Mutant
L266g, G268a) In Complex With Udp And H-antigen Acceptor
pdb|3V0Q|B Chain B, Crystal Structure Of The Fucosylgalactoside Alpha N-
Acetylgalactosaminyltransferase (gta, Cisab Mutant
L266g, G268a) In Complex With Udp And H-antigen Acceptor
pdb|3ZGF|A Chain A, Crystal Structure Of The Fucosylgalactoside Alpha N-
Acetylgalactosaminyltransferase (gta, Cisab Mutant
L266g, G268a) In Complex With In Complex With Npe Caged
Udp-gal ( P2(1)2(1)2(1) Space Group)
pdb|3ZGF|B Chain B, Crystal Structure Of The Fucosylgalactoside Alpha N-
Acetylgalactosaminyltransferase (gta, Cisab Mutant
L266g, G268a) In Complex With In Complex With Npe Caged
Udp-gal ( P2(1)2(1)2(1) Space Group)
Length = 298
Score = 26.9 bits (58), Expect = 8.4, Method: Compositional matrix adjust.
Identities = 17/67 (25%), Positives = 29/67 (43%), Gaps = 2/67 (2%)
Query: 81 ENDYVFGNRKFGGNAQSITKNRWIHHTSFLWDYAEGNMAFLKQPARAPEYRMERGHTEFI 140
E D+ +G FGG+ Q + + H + + D A G A + +Y + T+ +
Sbjct: 204 EGDFYYGGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVL 263
Query: 141 CRMNEYL 147
EYL
Sbjct: 264 S--PEYL 268
>pdb|4GKL|A Chain A, Crystal Structure Of A Noncanonic Maltogenic Alpha-amylase
Amyb From Thermotoga Neapolitana
pdb|4GKL|B Chain B, Crystal Structure Of A Noncanonic Maltogenic Alpha-amylase
Amyb From Thermotoga Neapolitana
Length = 422
Score = 26.6 bits (57), Expect = 9.7, Method: Compositional matrix adjust.
Identities = 28/117 (23%), Positives = 49/117 (41%), Gaps = 16/117 (13%)
Query: 48 DVPGVQPF--PRSIMSWSGLLYNQVFKGI------ADFQLRENDYVFGNRKF---GGNAQ 96
D P V F S+M W L+ KG+ ++ L+E+ +F G +
Sbjct: 257 DQPRVAKFLSRESLMHWIAFLF--TVKGVPLVHNGQEYALKEDLDIFNEYTLPIPGEENE 314
Query: 97 SITKNRWIHHTSFLWD-YAEGNMAFLK--QPARAPEYRMERGHTEFICRMNEYLPRT 150
+ +R + H + + ++ G M F++ QP R Y G+ +C +N L T
Sbjct: 315 IFSLHRKLAHYRYKTNVFSNGEMIFIRNDQPERVISYLWRHGNRFILCVLNPLLENT 371
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.320 0.137 0.415
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,076,699
Number of Sequences: 62578
Number of extensions: 232028
Number of successful extensions: 383
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 381
Number of HSP's gapped (non-prelim): 3
length of query: 209
length of database: 14,973,337
effective HSP length: 94
effective length of query: 115
effective length of database: 9,091,005
effective search space: 1045465575
effective search space used: 1045465575
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)