Citrus Sinensis ID: 028452

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21

MVHADGSVIKSWDYLRQNGLQGFIDIWPIPTAVAWKLIACFGAFEAALQLLLPGKRVEGPISPTGHRPVYKANGVASYAVTLITYLSLWWFGIFNPTIVYDHLGEIYSALIFGSFIFCIFLYIKGHLAPSSTDSGSCGNIIIDFYWGMELYPRIGKNFDIKVFTNCRFGMMSWAVLAVTYCIKQFCSHCFLTCELKAWCVQVGMLIGP

cccccccHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHcccCEECcccccccccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHECcccccccccccccHHHHccccCCcccccccCEEcHHHccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccc

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
7-dehydrocholesterol reductase	Production of cholesterol by reduction of C7-C8 double bond of 7-dehydrocholesterol (7-DHC). Lesions in the gene coding for the enzyme cause dwarfism.	probable	Q9LDU6

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted