Citrus Sinensis ID: 028463


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MASSLALKRLVSFNLIPRALRCTVAPSATSASRFFNTNAVRQYDDGGDDRDLDIDRRSARSFPRRRDDFFSGNVFDPFSPTRSLSQVLNFMDQMTESPFFSGTRGGLRRGWDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVIRGEGGKEGEGEESVRRYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVPKVKEEERADVFQVKVD
cccHHHHHHHccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccCEEECcccEEEEEEEccccccccEEEEEEccEEEEEEECccCEEECccCEEEEEEEEccccccccccEEEEEcccEEEEEcccccccccccEEEEEcc
***S**********************************AV*******************************GNVFDPFSPTRSLSQVLNFMDQMTESPFFSGTRGGLRRGWDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVI***************RYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVPK*********FQVKVD
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASSLALKRLVSFNLIPRALRCTVAPSATSASRFFNTNAVRQYDDGGDDRDLDIDRRSARSFPRRRDDFFSGNVFDPFSPTRSLSQVLNFMDQMTESPFFSGTRGGLRRGWDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVIRGEGGKEGEGEESVRRYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVPKVKEEERADVFQVKVD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
23.6 kDa heat shock protein, mitochondrial probableQ96331
Heat shock 22 kDa protein, mitochondrial probableQ39818
Small heat shock protein, chloroplastic probableP11890

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BOL, chain A
Confidence level:very confident
Coverage over the Query: 85-205
View the alignment between query and template
View the model in PyMOL