BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 028465
         (208 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3A0F|A Chain A, The Crystal Structure Of Geotrichum Sp. M128 Xyloglucanase
          Length = 763

 Score = 28.5 bits (62), Expect = 2.5,   Method: Composition-based stats.
 Identities = 12/33 (36%), Positives = 19/33 (57%)

Query: 107 GKDDVINAGVAGCCTGIALSFPGEPSALLTSCI 139
           G++D  +AGVAGC  G   +  G+   L  +C+
Sbjct: 506 GRNDHPDAGVAGCTQGAYTTNSGDSWTLFQTCV 538


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.138    0.421 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,891,281
Number of Sequences: 62578
Number of extensions: 191342
Number of successful extensions: 354
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 353
Number of HSP's gapped (non-prelim): 1
length of query: 208
length of database: 14,973,337
effective HSP length: 94
effective length of query: 114
effective length of database: 9,091,005
effective search space: 1036374570
effective search space used: 1036374570
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 49 (23.5 bits)