BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 028490
(208 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1XXS|A Chain A, Structural Insights For Fatty Acid Binding In A Lys49
Phospholipase A2: Crystal Structure Of Myotoxin Ii From
Bothrops Moojeni Complexed With Stearic Acid
pdb|1XXS|B Chain B, Structural Insights For Fatty Acid Binding In A Lys49
Phospholipase A2: Crystal Structure Of Myotoxin Ii From
Bothrops Moojeni Complexed With Stearic Acid
Length = 122
Score = 30.0 bits (66), Expect = 1.0, Method: Compositional matrix adjust.
Identities = 16/51 (31%), Positives = 22/51 (43%)
Query: 82 THMTGENRTILDGTLLLDPTNKISANYVLDSRNLKLRYSYVHRGMATFEPC 132
T + GEN + L D I LD+ N K RY+Y+ +PC
Sbjct: 72 TIVCGENNSCLKELCECDKAVAICLRENLDTYNKKYRYNYLKPACKKADPC 122
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.320 0.134 0.401
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,194,738
Number of Sequences: 62578
Number of extensions: 248621
Number of successful extensions: 440
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 438
Number of HSP's gapped (non-prelim): 2
length of query: 208
length of database: 14,973,337
effective HSP length: 94
effective length of query: 114
effective length of database: 9,091,005
effective search space: 1036374570
effective search space used: 1036374570
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)