BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 028502
         (208 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2C2F|A Chain A, Dps From Deinococcus Radiodurans
 pdb|2C2U|A Chain A, Dps From Deinococcus Radiodurans
 pdb|2F7N|A Chain A, Structure Of D. Radiodurans Dps-1
          Length = 207

 Score = 30.0 bits (66), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 20/34 (58%)

Query: 171 LSLFLTLNAVMWFFYGLFLKDVYVAVSSFLAQIY 204
           +SL+L      W   G F +D+++A   F+A+I+
Sbjct: 73  ISLYLKFKKYHWDIRGRFFRDLHLAYDEFIAEIF 106


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.335    0.143    0.451 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,279,308
Number of Sequences: 62578
Number of extensions: 124629
Number of successful extensions: 232
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 231
Number of HSP's gapped (non-prelim): 1
length of query: 208
length of database: 14,973,337
effective HSP length: 94
effective length of query: 114
effective length of database: 9,091,005
effective search space: 1036374570
effective search space used: 1036374570
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.6 bits)
S2: 49 (23.5 bits)