BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 028518
         (208 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2BHG|A Chain A, 3c Protease From Type A10(61) Foot-And-Mouth Disease Virus
 pdb|2BHG|B Chain B, 3c Protease From Type A10(61) Foot-And-Mouth Disease Virus
          Length = 209

 Score = 28.5 bits (62), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 4/46 (8%)

Query: 111 LEELALQSLDQNKITRDQTQPFRITARENQQNHRGSPVPMLDGNAD 156
           L + AL  L +    RD T+ FR TAR      +G+PV  +  NAD
Sbjct: 83  LSDAALXVLHRGNKVRDITKHFRDTARXK----KGTPVVGVVNNAD 124


>pdb|2J92|A Chain A, 3c Protease From Type A10(61) Foot-And-Mouth Disease
           Virus- Crystal Packing Mutant (K51q)
 pdb|2J92|B Chain B, 3c Protease From Type A10(61) Foot-And-Mouth Disease
           Virus- Crystal Packing Mutant (K51q)
          Length = 209

 Score = 28.1 bits (61), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 4/46 (8%)

Query: 111 LEELALQSLDQNKITRDQTQPFRITARENQQNHRGSPVPMLDGNAD 156
           L + AL  L +    RD T+ FR TAR      +G+PV  +  NAD
Sbjct: 83  LSDAALMVLHRGNKVRDITKHFRDTARMK----KGTPVVGVVNNAD 124


>pdb|2WV4|A Chain A, Crystal Structure Of Foot-And-Mouth Disease Virus 3c
           Protease In Complex With A Decameric Peptide
           Corresponding To The Vp1-2a Cleavage Junction
 pdb|2WV4|B Chain B, Crystal Structure Of Foot-And-Mouth Disease Virus 3c
           Protease In Complex With A Decameric Peptide
           Corresponding To The Vp1-2a Cleavage Junction
 pdb|2WV5|A Chain A, Crystal Structure Of Foot-And-Mouth Disease Virus 3c
           Protease In Complex With A Decameric Peptide
           Corresponding To The Vp1-2a Cleavage Junction With A Gln
           To Glu Substitution At P1
 pdb|2WV5|B Chain B, Crystal Structure Of Foot-And-Mouth Disease Virus 3c
           Protease In Complex With A Decameric Peptide
           Corresponding To The Vp1-2a Cleavage Junction With A Gln
           To Glu Substitution At P1
 pdb|2WV5|C Chain C, Crystal Structure Of Foot-And-Mouth Disease Virus 3c
           Protease In Complex With A Decameric Peptide
           Corresponding To The Vp1-2a Cleavage Junction With A Gln
           To Glu Substitution At P1
 pdb|2WV5|D Chain D, Crystal Structure Of Foot-And-Mouth Disease Virus 3c
           Protease In Complex With A Decameric Peptide
           Corresponding To The Vp1-2a Cleavage Junction With A Gln
           To Glu Substitution At P1
          Length = 214

 Score = 28.1 bits (61), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 4/46 (8%)

Query: 111 LEELALQSLDQNKITRDQTQPFRITARENQQNHRGSPVPMLDGNAD 156
           L + AL  L +    RD T+ FR TAR      +G+PV  +  NAD
Sbjct: 83  LSDAALMVLHRGNKVRDITKHFRDTARMK----KGTPVVGVVNNAD 124


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.135    0.413 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,464,656
Number of Sequences: 62578
Number of extensions: 273278
Number of successful extensions: 588
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 588
Number of HSP's gapped (non-prelim): 3
length of query: 208
length of database: 14,973,337
effective HSP length: 94
effective length of query: 114
effective length of database: 9,091,005
effective search space: 1036374570
effective search space used: 1036374570
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)