Query         028556
Match_columns 207
No_of_seqs    143 out of 1386
Neff          7.9 
Searched_HMMs 46136
Date          Fri Mar 29 13:22:00 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/028556.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/028556hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01657 Stress-antifung:  Salt  99.9 6.8E-23 1.5E-27  150.1   8.2   82   84-165    15-106 (106)
  2 PF01657 Stress-antifung:  Salt  99.7 1.1E-18 2.4E-23  127.7   3.8   62    4-65     45-106 (106)
  3 PF01102 Glycophorin_A:  Glycop  96.0  0.0021 4.5E-08   48.1   0.2   32  176-207    62-94  (122)
  4 PF08693 SKG6:  Transmembrane a  94.7   0.029 6.3E-07   33.5   2.3   25  182-207    16-40  (40)
  5 PTZ00382 Variant-specific surf  93.9   0.042 9.2E-07   39.3   2.2   25  176-200    64-88  (96)
  6 PF14610 DUF4448:  Protein of u  91.4    0.14 3.1E-06   40.9   2.3   28  180-207   159-186 (189)
  7 PF01034 Syndecan:  Syndecan do  90.8   0.073 1.6E-06   35.0   0.1   29  179-207    10-39  (64)
  8 PF02439 Adeno_E3_CR2:  Adenovi  90.1    0.25 5.4E-06   29.0   1.9   21  179-199     4-24  (38)
  9 PF15102 TMEM154:  TMEM154 prot  89.2    0.24 5.2E-06   38.0   1.8   10  180-189    58-67  (146)
 10 PHA03265 envelope glycoprotein  85.4     1.1 2.4E-05   39.2   3.9   28  179-206   348-376 (402)
 11 PF15012 DUF4519:  Domain of un  83.5     0.4 8.7E-06   30.7   0.3   27  178-204    28-54  (56)
 12 PF12669 P12:  Virus attachment  83.0     1.9   4E-05   27.9   3.3    7  183-189     2-8   (58)
 13 PF04478 Mid2:  Mid2 like cell   82.5    0.69 1.5E-05   35.8   1.3   20  180-199    51-70  (154)
 14 PF01299 Lamp:  Lysosome-associ  77.9     1.1 2.4E-05   38.6   1.2   24  178-201   270-293 (306)
 15 PF02009 Rifin_STEVOR:  Rifin/s  77.0    0.78 1.7E-05   39.5   0.0    8  199-206   277-284 (299)
 16 PF05454 DAG1:  Dystroglycan (D  75.5     0.9   2E-05   39.0   0.0   10  112-121   101-110 (290)
 17 PF08693 SKG6:  Transmembrane a  74.5     2.4 5.2E-05   25.3   1.6   27  176-202     6-32  (40)
 18 PF11857 DUF3377:  Domain of un  73.9     4.5 9.8E-05   27.4   3.1   23  177-199    28-50  (74)
 19 TIGR01478 STEVOR variant surfa  69.8     1.9   4E-05   36.8   0.6   15  155-169   213-227 (295)
 20 PF08374 Protocadherin:  Protoc  68.6     7.9 0.00017   31.7   3.9   13  179-191    39-51  (221)
 21 PF05808 Podoplanin:  Podoplani  68.5     1.6 3.5E-05   34.0   0.0   28  177-204   128-156 (162)
 22 PTZ00370 STEVOR; Provisional    68.4     2.1 4.4E-05   36.6   0.6   10  198-207   275-284 (296)
 23 PF03302 VSP:  Giardia variant-  67.1     5.4 0.00012   35.8   3.0   25  176-200   365-389 (397)
 24 PF13908 Shisa:  Wnt and FGF in  66.8     5.3 0.00011   31.5   2.6    7  154-160    31-37  (179)
 25 PF01034 Syndecan:  Syndecan do  64.6     1.9   4E-05   28.4  -0.3   29  177-205    12-40  (64)
 26 TIGR01167 LPXTG_anchor LPXTG-m  64.4     7.1 0.00015   21.7   2.2   14  193-206    20-33  (34)
 27 PF12768 Rax2:  Cortical protei  63.8      19 0.00041   30.8   5.6   17  178-194   227-243 (281)
 28 PLN03150 hypothetical protein;  60.4     8.7 0.00019   36.4   3.2   28  179-206   545-572 (623)
 29 PF12301 CD99L2:  CD99 antigen   60.3     8.8 0.00019   30.3   2.7   25  183-207   116-142 (169)
 30 PF08114 PMP1_2:  ATPase proteo  56.2      19 0.00042   21.5   3.0    6  178-183     9-14  (43)
 31 KOG1226 Integrin beta subunit   56.1      14  0.0003   35.7   3.7   28  177-204   710-737 (783)
 32 PTZ00046 rifin; Provisional     55.8     9.8 0.00021   33.6   2.5   10  198-207   335-344 (358)
 33 TIGR01477 RIFIN variant surfac  55.5      10 0.00022   33.5   2.5   10  198-207   330-339 (353)
 34 PF15176 LRR19-TM:  Leucine-ric  54.1      15 0.00033   26.4   2.8   21  175-195    11-31  (102)
 35 PF12877 DUF3827:  Domain of un  52.8      30 0.00065   33.0   5.3   22  113-134   211-232 (684)
 36 KOG3637 Vitronectin receptor,   52.4      14  0.0003   37.4   3.2   24  180-203   978-1001(1030)
 37 PF12768 Rax2:  Cortical protei  52.0     8.7 0.00019   32.8   1.6   29  178-206   231-259 (281)
 38 PF11884 DUF3404:  Domain of un  50.5     5.9 0.00013   33.5   0.3   13  153-165   210-222 (262)
 39 PF13908 Shisa:  Wnt and FGF in  48.9     8.5 0.00018   30.3   1.0   10  180-189    77-86  (179)
 40 PF05624 LSR:  Lipolysis stimul  48.3      41 0.00088   20.7   3.6   19  184-202     5-23  (49)
 41 PF15345 TMEM51:  Transmembrane  47.9      22 0.00048   29.4   3.3   23  180-203    59-81  (233)
 42 PF13940 Ldr_toxin:  Toxin Ldr,  46.5      21 0.00045   20.4   2.0   20  185-205    16-35  (35)
 43 PF04478 Mid2:  Mid2 like cell   45.5       4 8.8E-05   31.6  -1.3   28  178-206    53-80  (154)
 44 PF10873 DUF2668:  Protein of u  43.6      39 0.00084   26.0   3.7   13  179-191    62-74  (155)
 45 COG3763 Uncharacterized protei  41.8     9.2  0.0002   25.6   0.2    7  200-206    24-30  (71)
 46 PRK00523 hypothetical protein;  41.7     9.3  0.0002   25.8   0.2    7  200-206    25-31  (72)
 47 PF12877 DUF3827:  Domain of un  41.5      22 0.00048   33.8   2.6   17   12-28     79-95  (684)
 48 PRK01844 hypothetical protein;  41.2      17 0.00038   24.5   1.4   24  183-206     7-30  (72)
 49 PF04689 S1FA:  DNA binding pro  40.6      59  0.0013   21.4   3.7   19  176-194    11-29  (69)
 50 KOG3653 Transforming growth fa  38.2      54  0.0012   30.3   4.4   13  154-166   123-135 (534)
 51 PF02480 Herpes_gE:  Alphaherpe  38.2      11 0.00023   34.4   0.0   12  117-128   239-250 (439)
 52 PF05083 LST1:  LST-1 protein;   36.9      43 0.00094   22.4   2.7   18  189-206     7-24  (74)
 53 PF13955 Fst_toxin:  Toxin Fst,  36.7      17 0.00037   18.5   0.6   12  183-194     4-15  (21)
 54 TIGR02976 phageshock_pspB phag  35.6      29 0.00063   23.6   1.8   21  184-204     7-27  (75)
 55 COG3765 WzzB Chain length dete  35.5      19 0.00042   31.6   1.2   34  158-191   294-328 (347)
 56 PRK11638 lipopolysaccharide bi  34.0     8.2 0.00018   33.9  -1.4   46  159-205   295-341 (342)
 57 PF14991 MLANA:  Protein melan-  33.1     8.2 0.00018   28.4  -1.2   10  195-204    41-50  (118)
 58 KOG3488 Dolichol phosphate-man  32.3      35 0.00076   22.9   1.7   15  180-194    47-61  (81)
 59 PF03229 Alpha_GJ:  Alphavirus   32.3      59  0.0013   24.1   3.1   30  176-205    81-111 (126)
 60 PF14986 DUF4514:  Domain of un  30.9      50  0.0011   21.0   2.2   22  183-204    27-48  (61)
 61 COG3197 FixS Uncharacterized p  30.3      81  0.0018   20.3   3.1   24  180-204     3-26  (58)
 62 PF05393 Hum_adeno_E3A:  Human   28.8      57  0.0012   22.9   2.4   11  181-191    33-43  (94)
 63 PF08374 Protocadherin:  Protoc  28.8      29 0.00063   28.5   1.1   22  178-199    34-55  (221)
 64 PF07297 DPM2:  Dolichol phosph  27.1      32 0.00069   23.6   0.9   13  180-192    45-57  (78)
 65 PF15431 TMEM190:  Transmembran  27.1      70  0.0015   23.5   2.7   18  189-206    69-86  (134)
 66 PF06365 CD34_antigen:  CD34/Po  26.7   1E+02  0.0022   25.1   3.9    6  180-185   102-107 (202)
 67 PF07204 Orthoreo_P10:  Orthore  26.0      46 0.00099   23.7   1.5   11  181-191    45-55  (98)
 68 PF06697 DUF1191:  Protein of u  25.7      62  0.0013   27.7   2.6    7  180-186   212-218 (278)
 69 PF07010 Endomucin:  Endomucin;  25.5      46   0.001   27.6   1.7   10  197-206   207-216 (259)
 70 PTZ00045 apical membrane antig  25.1      67  0.0014   30.3   2.8   17  178-194   513-529 (595)
 71 PF05454 DAG1:  Dystroglycan (D  24.4      25 0.00054   30.2   0.0   25  182-206   152-176 (290)
 72 PF07438 DUF1514:  Protein of u  24.1      73  0.0016   21.0   2.1   14  183-196     3-16  (66)
 73 PRK15471 chain length determin  23.4      53  0.0011   28.7   1.8   33  175-207   290-325 (325)
 74 PF01102 Glycophorin_A:  Glycop  23.3      68  0.0015   23.9   2.1   27  178-204    68-94  (122)
 75 PRK10381 LPS O-antigen length   23.3      43 0.00093   29.8   1.3   35  158-192   316-351 (377)
 76 PF10577 UPF0560:  Uncharacteri  23.1      66  0.0014   31.5   2.5   19  143-161   214-232 (807)
 77 PF00944 Peptidase_S3:  Alphavi  22.1      60  0.0013   24.9   1.6   30  157-186    88-125 (158)
 78 PF06682 DUF1183:  Protein of u  21.9 1.5E+02  0.0032   25.9   4.2   16  148-163   108-123 (318)
 79 PF02480 Herpes_gE:  Alphaherpe  21.7      31 0.00066   31.5   0.0    9  181-189   355-363 (439)
 80 PF05084 GRA6:  Granule antigen  21.6      80  0.0017   24.9   2.3   20  187-206   157-176 (215)
 81 COG4736 CcoQ Cbb3-type cytochr  21.4   1E+02  0.0022   20.0   2.4   11  193-203    21-31  (60)

No 1  
>PF01657 Stress-antifung:  Salt stress response/antifungal;  InterPro: IPR002902 This domain is found in plants and has no known function. The structure of this domain is known and it is thought to be involved in antifungal responses in plants []. Two copies of this domain are also found together in cysteine-rich protein kinases and cysteine-rich repeat secretory proteins. The domain contains four conserved cysteines.; PDB: 3A2E_D.
Probab=99.88  E-value=6.8e-23  Score=150.13  Aligned_cols=82  Identities=30%  Similarity=0.677  Sum_probs=65.4

Q ss_pred             CcHHHHHHHHHHHHHHHHhh------ccccc----CCcceEEEEeccCCCChhhHHHHHHHHHHHHHhhcCCCcccEEEc
Q 028556           84 NDVEFFKRRDDVLADLQTAV------SFKVS----SSGFVEGFAQCLGDLTPADCTTCLAEAIAKLKNLCGSAPAADVFL  153 (207)
Q Consensus        84 ~~~~~~~~~~~ll~~l~~~a------~f~~~----~~~~vYgLaQC~~DLs~~~C~~CL~~a~~~~~~~c~~~~gg~i~~  153 (207)
                      .+..|..++..+|..|...+      +|+++    +..+||||+||++||++.+|..||+.++.+++++|+.++||+|++
T Consensus        15 ~~~~f~~~l~~ll~~l~~~a~~~~~~~f~~~~~~~~~~~vYgl~qC~~Dls~~dC~~Cl~~a~~~~~~~C~~~~g~~v~~   94 (106)
T PF01657_consen   15 DNSTFEQNLNSLLSSLVSNAASSSSKGFATGSAGSGPDTVYGLAQCRGDLSPSDCRACLADAVANISSCCPGSRGGRVWY   94 (106)
T ss_dssp             TT-THHHHHHHHHHHHHHHGGGTT-TEEEEEE--ST---EEEEEEE-TTS-HHHHHHHHHHHHCCHHHHTTSBSSEEEEE
T ss_pred             CCchHHHHHHHHHHHHHHHHhhccccCcEEeecCCCCCeEEEEEEcCCCCChhhhHHHHHHHHHHHHHhCCCCceEEEEC
Confidence            34556677899998886543      46554    356999999999999999999999999999999999999999999


Q ss_pred             CceeEEEeccCC
Q 028556          154 AQCYARYWASGY  165 (207)
Q Consensus       154 ~~C~lRYe~~~F  165 (207)
                      ++|+||||+|+|
T Consensus        95 ~~C~lRY~~~~F  106 (106)
T PF01657_consen   95 DSCFLRYENYPF  106 (106)
T ss_dssp             SSEEEEEESS--
T ss_pred             CCEEEEEECCCC
Confidence            999999999998


No 2  
>PF01657 Stress-antifung:  Salt stress response/antifungal;  InterPro: IPR002902 This domain is found in plants and has no known function. The structure of this domain is known and it is thought to be involved in antifungal responses in plants []. Two copies of this domain are also found together in cysteine-rich protein kinases and cysteine-rich repeat secretory proteins. The domain contains four conserved cysteines.; PDB: 3A2E_D.
Probab=99.74  E-value=1.1e-18  Score=127.71  Aligned_cols=62  Identities=44%  Similarity=0.912  Sum_probs=51.0

Q ss_pred             CCCCCCCCcEEEEEeccCCCChhchHHHHHHHHHHHhhhCCCCcceEEEcceeEEEEEeeee
Q 028556            4 GTSTPPEATVYGLYQCRGDLKTTDCSRCIESAVNQISLVCPYTYGASLQLEGCYVRYEHIDF   65 (207)
Q Consensus         4 ~~~~~~~~~vygl~qCr~D~~~~~C~~Cl~~a~~~~~~~C~~~~~a~i~~~~C~lrys~~~f   65 (207)
                      |+.|.+.+++|||+||++|+++++|..||+.|..++++.|+..++++||++.|+|||++++|
T Consensus        45 ~~~~~~~~~vYgl~qC~~Dls~~dC~~Cl~~a~~~~~~~C~~~~g~~v~~~~C~lRY~~~~F  106 (106)
T PF01657_consen   45 GSAGSGPDTVYGLAQCRGDLSPSDCRACLADAVANISSCCPGSRGGRVWYDSCFLRYENYPF  106 (106)
T ss_dssp             EE--ST---EEEEEEE-TTS-HHHHHHHHHHHHCCHHHHTTSBSSEEEEESSEEEEEESS--
T ss_pred             eecCCCCCeEEEEEEcCCCCChhhhHHHHHHHHHHHHHhCCCCceEEEECCCEEEEEECCCC
Confidence            44567788999999999999999999999999999999999999999999999999999987


No 3  
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=95.96  E-value=0.0021  Score=48.06  Aligned_cols=32  Identities=31%  Similarity=0.508  Sum_probs=21.6

Q ss_pred             CCCcEEEEeeHHHHHHHHHHHHHHH-HHHhhcC
Q 028556          176 QVGKTVAIIVGVVAGLAILIVFLSI-CRRAMER  207 (207)
Q Consensus       176 ~~~~~~~iv~~~v~~~~~~~~~~~~-~~~~~~~  207 (207)
                      ..+.++.|++|++++++++++++.| +||++||
T Consensus        62 s~~~i~~Ii~gv~aGvIg~Illi~y~irR~~Kk   94 (122)
T PF01102_consen   62 SEPAIIGIIFGVMAGVIGIILLISYCIRRLRKK   94 (122)
T ss_dssp             S-TCHHHHHHHHHHHHHHHHHHHHHHHHHHS--
T ss_pred             cccceeehhHHHHHHHHHHHHHHHHHHHHHhcc
Confidence            3456778999999998777766655 5666665


No 4  
>PF08693 SKG6:  Transmembrane alpha-helix domain;  InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ]. This entry represents the highly conserved transmembrane alpha-helical domain found in these proteins [, ]. The full-length AXL2 protein has a negative regulatory function in cytokinesis [].
Probab=94.72  E-value=0.029  Score=33.47  Aligned_cols=25  Identities=12%  Similarity=0.113  Sum_probs=11.4

Q ss_pred             EEeeHHHHHHHHHHHHHHHHHHhhcC
Q 028556          182 AIIVGVVAGLAILIVFLSICRRAMER  207 (207)
Q Consensus       182 ~iv~~~v~~~~~~~~~~~~~~~~~~~  207 (207)
                      ++++|+++-+ ++++++.|+|||++|
T Consensus        16 ~VvVPV~vI~-~vl~~~l~~~~rR~k   40 (40)
T PF08693_consen   16 GVVVPVGVII-IVLGAFLFFWYRRKK   40 (40)
T ss_pred             EEEechHHHH-HHHHHHhheEEeccC
Confidence            4455544422 333334444565554


No 5  
>PTZ00382 Variant-specific surface protein (VSP); Provisional
Probab=93.90  E-value=0.042  Score=39.33  Aligned_cols=25  Identities=36%  Similarity=0.392  Sum_probs=15.9

Q ss_pred             CCCcEEEEeeHHHHHHHHHHHHHHH
Q 028556          176 QVGKTVAIIVGVVAGLAILIVFLSI  200 (207)
Q Consensus       176 ~~~~~~~iv~~~v~~~~~~~~~~~~  200 (207)
                      +++.|..|++++++.+..++.+++|
T Consensus        64 s~gaiagi~vg~~~~v~~lv~~l~w   88 (96)
T PTZ00382         64 STGAIAGISVAVVAVVGGLVGFLCW   88 (96)
T ss_pred             ccccEEEEEeehhhHHHHHHHHHhh
Confidence            4567888999877665444444443


No 6  
>PF14610 DUF4448:  Protein of unknown function (DUF4448)
Probab=91.41  E-value=0.14  Score=40.95  Aligned_cols=28  Identities=25%  Similarity=0.262  Sum_probs=20.5

Q ss_pred             EEEEeeHHHHHHHHHHHHHHHHHHhhcC
Q 028556          180 TVAIIVGVVAGLAILIVFLSICRRAMER  207 (207)
Q Consensus       180 ~~~iv~~~v~~~~~~~~~~~~~~~~~~~  207 (207)
                      .++|++|+++++++++++..++|+|++|
T Consensus       159 ~laI~lPvvv~~~~~~~~~~~~~~R~~R  186 (189)
T PF14610_consen  159 ALAIALPVVVVVLALIMYGFFFWNRKKR  186 (189)
T ss_pred             eEEEEccHHHHHHHHHHHhhheeeccce
Confidence            7899999998776666666666666553


No 7  
>PF01034 Syndecan:  Syndecan domain;  InterPro: IPR001050 The syndecans are transmembrane proteoglycans which are involved in the organisation of cytoskeleton and/or actin microfilaments, and have important roles as cell surface receptors during cell-cell and/or cell-matrix interactions [, ]. Structurally, these proteins consist of four separate domains:   A signal sequence; An extracellular domain (ectodomain) of variable length whose sequence is not evolutionary conserved in the various forms of syndecans. The ectodomain contains the sites of attachment of the heparan sulphate glycosaminoglycan side chains;  A transmembrane region;  A highly conserved cytoplasmic domain of about 30 to 35 residues, which could interact with cytoskeletal proteins.    The proteins known to belong to this family are:    Syndecan 1.  Syndecan 2 or fibroglycan.  Syndecan 3 or neuroglycan or N-syndecan.  Syndecan 4 or amphiglycan or ryudocan.  Drosophila syndecan.   Caenorhabditis elegans probable syndecan (F57C7.3).    Syndecan-4, a transmembrane heparan sulphate proteoglycan, is a coreceptor with integrins in cell adhesion. It has been suggested to form a ternary signalling complex with protein kinase Calpha and phosphatidylinositol 4,5-bisphosphate (PIP2). Structural studies have demonstrated that the cytoplasmic domain undergoes a conformational transition and forms a symmetric dimer in the presence of phospholipid activator PIP2, and whose overall structure in solution exhibits a twisted clamp shape having a cavity in the centre of dimeric interface. In addition, it has been observed that the syndecan-4 variable domain interacts, strongly, not only with fatty acyl groups but also the anionic head group of PIP2. These findings indicate that PIP2 promotes oligomerisation of the syndecan-4 cytoplasmic domain for transmembrane signalling and cell-matrix adhesion [, ].; GO: 0008092 cytoskeletal protein binding, 0016020 membrane; PDB: 1EJQ_B 1EJP_B 1YBO_C 1OBY_Q.
Probab=90.76  E-value=0.073  Score=35.01  Aligned_cols=29  Identities=28%  Similarity=0.409  Sum_probs=0.4

Q ss_pred             cEEEEeeHHHHHHHHHHHHHHH-HHHhhcC
Q 028556          179 KTVAIIVGVVAGLAILIVFLSI-CRRAMER  207 (207)
Q Consensus       179 ~~~~iv~~~v~~~~~~~~~~~~-~~~~~~~  207 (207)
                      ...++|+|+|++++++++++.| +.|.+||
T Consensus        10 vlaavIaG~Vvgll~ailLIlf~iyR~rkk   39 (64)
T PF01034_consen   10 VLAAVIAGGVVGLLFAILLILFLIYRMRKK   39 (64)
T ss_dssp             ---------------------------S--
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            3456666666665544443433 3444443


No 8  
>PF02439 Adeno_E3_CR2:  Adenovirus E3 region protein CR2;  InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host []. This region called CR1 (conserved region 1) [] is found three times in Human adenovirus 19 (a subgroup D adenovirus) 49 kDa protein in the E3 region. CR1 is also found in the 20.1 Kd protein of subgroup B adenoviruses. The function of this 80 amino acid region is unknown. This region is probably a divergent immunoglobulin domain.
Probab=90.08  E-value=0.25  Score=29.03  Aligned_cols=21  Identities=52%  Similarity=0.822  Sum_probs=14.5

Q ss_pred             cEEEEeeHHHHHHHHHHHHHH
Q 028556          179 KTVAIIVGVVAGLAILIVFLS  199 (207)
Q Consensus       179 ~~~~iv~~~v~~~~~~~~~~~  199 (207)
                      .+++|+++++++++++++...
T Consensus         4 s~IaIIv~V~vg~~iiii~~~   24 (38)
T PF02439_consen    4 STIAIIVAVVVGMAIIIICMF   24 (38)
T ss_pred             chhhHHHHHHHHHHHHHHHHH
Confidence            467888888887766655443


No 9  
>PF15102 TMEM154:  TMEM154 protein family
Probab=89.22  E-value=0.24  Score=38.04  Aligned_cols=10  Identities=20%  Similarity=0.428  Sum_probs=6.7

Q ss_pred             EEEEeeHHHH
Q 028556          180 TVAIIVGVVA  189 (207)
Q Consensus       180 ~~~iv~~~v~  189 (207)
                      ++.|++|.|+
T Consensus        58 iLmIlIP~VL   67 (146)
T PF15102_consen   58 ILMILIPLVL   67 (146)
T ss_pred             EEEEeHHHHH
Confidence            6777888443


No 10 
>PHA03265 envelope glycoprotein D; Provisional
Probab=85.40  E-value=1.1  Score=39.18  Aligned_cols=28  Identities=39%  Similarity=0.593  Sum_probs=19.3

Q ss_pred             cEEEEeeH-HHHHHHHHHHHHHHHHHhhc
Q 028556          179 KTVAIIVG-VVAGLAILIVFLSICRRAME  206 (207)
Q Consensus       179 ~~~~iv~~-~v~~~~~~~~~~~~~~~~~~  206 (207)
                      ..+.|++| .|++++++-+++.++|||+|
T Consensus       348 ~~~g~~ig~~i~glv~vg~il~~~~rr~k  376 (402)
T PHA03265        348 TFVGISVGLGIAGLVLVGVILYVCLRRKK  376 (402)
T ss_pred             cccceEEccchhhhhhhhHHHHHHhhhhh
Confidence            34555544 56677777777888888876


No 11 
>PF15012 DUF4519:  Domain of unknown function (DUF4519)
Probab=83.49  E-value=0.4  Score=30.65  Aligned_cols=27  Identities=15%  Similarity=0.328  Sum_probs=20.0

Q ss_pred             CcEEEEeeHHHHHHHHHHHHHHHHHHh
Q 028556          178 GKTVAIIVGVVAGLAILIVFLSICRRA  204 (207)
Q Consensus       178 ~~~~~iv~~~v~~~~~~~~~~~~~~~~  204 (207)
                      .++.-||+|++++++++++++.|+..|
T Consensus        28 ~kv~tVVlP~l~~~~~~Ivv~vy~kTR   54 (56)
T PF15012_consen   28 QKVFTVVLPTLAAVFLFIVVFVYLKTR   54 (56)
T ss_pred             HhheeEehhHHHHHHHHHhheeEEecc
Confidence            346788999999887777777666554


No 12 
>PF12669 P12:  Virus attachment protein p12 family
Probab=83.05  E-value=1.9  Score=27.89  Aligned_cols=7  Identities=43%  Similarity=1.099  Sum_probs=2.9

Q ss_pred             EeeHHHH
Q 028556          183 IIVGVVA  189 (207)
Q Consensus       183 iv~~~v~  189 (207)
                      |++++++
T Consensus         2 iII~~Ii    8 (58)
T PF12669_consen    2 IIIGIII    8 (58)
T ss_pred             eeHHHHH
Confidence            3444433


No 13 
>PF04478 Mid2:  Mid2 like cell wall stress sensor;  InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region. The remainder of the protein sequence is serine-rich and of low complexity, and is therefore impossible to align accurately. Mid2 is thought to act as a mechanosensor of cell wall stress. The C-terminal cytoplasmic region of Mid2 is known to interact with Rom2, a guanine nucleotide exchange factor (GEF) for Rho1, which is part of the cell wall integrity signalling pathway [].
Probab=82.47  E-value=0.69  Score=35.82  Aligned_cols=20  Identities=25%  Similarity=0.423  Sum_probs=11.3

Q ss_pred             EEEEeeHHHHHHHHHHHHHH
Q 028556          180 TVAIIVGVVAGLAILIVFLS  199 (207)
Q Consensus       180 ~~~iv~~~v~~~~~~~~~~~  199 (207)
                      +|.+||||-++++++++++.
T Consensus        51 VIGvVVGVGg~ill~il~lv   70 (154)
T PF04478_consen   51 VIGVVVGVGGPILLGILALV   70 (154)
T ss_pred             EEEEEecccHHHHHHHHHhh
Confidence            56778886555544444343


No 14 
>PF01299 Lamp:  Lysosome-associated membrane glycoprotein (Lamp);  InterPro: IPR002000 Lysosome-associated membrane glycoproteins (lamp) [] are integral membrane proteins, specific to lysosomes, and whose exact biological function is not yet clear. Structurally, the lamp proteins consist of two internally homologous lysosome-luminal domains separated by a proline-rich hinge region; at the C-terminal extremity there is a transmembrane region (TM) followed by a very short cytoplasmic tail (C). In each of the duplicated domains, there are two conserved disulphide bonds. This structure is schematically represented in the figure below.   +-----+ +-----+ +-----+ +-----+ | | | | | | | | xCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxxxCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxx +--------------------------++Hinge++--------------------------++TM++C+  In mammals, there are two closely related types of lamp: lamp-1 and lamp-2, which form major components of the lysosome membrane. In chicken lamp-1 is known as LEP100.  Also included in this entry is the macrophage protein CD68 (or macrosialin) [] is a heavily glycosylated integral membrane protein whose structure consists of a mucin-like domain followed by a proline-rich hinge; a single lamp-like domain; a transmembrane region and a short cytoplasmic tail.   Similar to CD68, mammalian lamp-3, which is expressed in lymphoid organs, dendritic cells and in lung, contains all the C-terminal regions but lacks the N-terminal lamp-like region []. In a lamp-family protein from nematodes [] only the part C-terminal to the hinge is conserved. ; GO: 0016020 membrane
Probab=77.91  E-value=1.1  Score=38.57  Aligned_cols=24  Identities=29%  Similarity=0.398  Sum_probs=14.8

Q ss_pred             CcEEEEeeHHHHHHHHHHHHHHHH
Q 028556          178 GKTVAIIVGVVAGLAILIVFLSIC  201 (207)
Q Consensus       178 ~~~~~iv~~~v~~~~~~~~~~~~~  201 (207)
                      ..++.|+||++++++++++++.|+
T Consensus       270 ~~~vPIaVG~~La~lvlivLiaYl  293 (306)
T PF01299_consen  270 SDLVPIAVGAALAGLVLIVLIAYL  293 (306)
T ss_pred             cchHHHHHHHHHHHHHHHHHHhhe
Confidence            567778888766554555555544


No 15 
>PF02009 Rifin_STEVOR:  Rifin/stevor family;  InterPro: IPR002858 Malaria is still a major cause of mortality in many areas of the world. Plasmodium falciparum causes the most severe human form of the disease and is responsible for most fatalities. Severe cases of malaria can occur when the parasite invades and then proliferates within red blood cell erythrocytes. The parasite produces many variant antigenic proteins, encoded by multigene families, which are present on the surface of the infected erythrocyte and play important roles in virulence. A crucial survival mechanism for the malaria parasite is its ability to evade the immune response by switching these variant surface antigens. The high virulence of P. falciparum relative to other malarial parasites is in large part due to the fact that in this organism many of these surface antigens mediate the binding of infected erythrocytes to the vascular endothelium (cytoadherence) and non-infected erythrocytes (rosetting). This can lead to the accumulation of infected cells in the vasculature of a variety of organs, blocking the blood flow and reducing the oxygen supply. Clinical symptoms of severe infection can include fever, progressive anaemia, multi-organ dysfunction and coma. For more information see []. Several multicopy gene families have been described in Plasmodium falciparum, including the stevor family of subtelomeric open reading frames and the rif interspersed repetitive elements. Both families contain three predicted transmembrane segments. It has been proposed that stevor and rif are members of a larger superfamily that code for variant surface antigens [].
Probab=76.95  E-value=0.78  Score=39.53  Aligned_cols=8  Identities=25%  Similarity=0.094  Sum_probs=3.5

Q ss_pred             HHHHHhhc
Q 028556          199 SICRRAME  206 (207)
Q Consensus       199 ~~~~~~~~  206 (207)
                      ..+|.|+|
T Consensus       277 LILRYRRK  284 (299)
T PF02009_consen  277 LILRYRRK  284 (299)
T ss_pred             HHHHHHHH
Confidence            33444443


No 16 
>PF05454 DAG1:  Dystroglycan (Dystrophin-associated glycoprotein 1);  InterPro: IPR008465 Dystroglycan is one of the dystrophin-associated glycoproteins, which is encoded by a 5.5 kb transcript in Homo sapiens. The protein product is cleaved into two non-covalently associated subunits, [alpha] (N-terminal) and [beta] (C-terminal). In skeletal muscle the dystroglycan complex works as a transmembrane linkage between the extracellular matrix and the cytoskeleton [alpha]-dystroglycan is extracellular and binds to merosin ([alpha]-2 laminin) in the basement membrane, while [beta]-dystroglycan is a transmembrane protein and binds to dystrophin, which is a large rod-like cytoskeletal protein, absent in Duchenne muscular dystrophy patients. Dystrophin binds to intracellular actin cables. In this way, the dystroglycan complex, which links the extracellular matrix to the intracellular actin cables, is thought to provide structural integrity in muscle tissues. The dystroglycan complex is also known to serve as an agrin receptor in muscle, where it may regulate agrin-induced acetylcholine receptor clustering at the neuromuscular junction. There is also evidence which suggests the function of dystroglycan as a part of the signal transduction pathway because it is shown that Grb2, a mediator of the Ras-related signal pathway, can interact with the cytoplasmic domain of dystroglycan. In general, aberrant expression of dystrophin-associated protein complex underlies the pathogenesis of Duchenne muscular dystrophy, Becker muscular dystrophy and severe childhood autosomal recessive muscular dystrophy. Interestingly, no genetic disease has been described for either [alpha]- or [beta]-dystroglycan. Dystroglycan is widely distributed in non-muscle tissues as well as in muscle tissues. During epithelial morphogenesis of kidney, the dystroglycan complex is shown to act as a receptor for the basement membrane. Dystroglycan expression in Mus musculus brain and neural retina has also been reported. However, the physiological role of dystroglycan in non-muscle tissues has remained unclear [].; PDB: 1EG4_P.
Probab=75.46  E-value=0.9  Score=38.97  Aligned_cols=10  Identities=20%  Similarity=0.268  Sum_probs=0.0

Q ss_pred             ceEEEEeccC
Q 028556          112 FVEGFAQCLG  121 (207)
Q Consensus       112 ~vYgLaQC~~  121 (207)
                      ++.++.+|..
T Consensus       101 sv~~~G~C~~  110 (290)
T PF05454_consen  101 SVIPIGSCQD  110 (290)
T ss_dssp             ----------
T ss_pred             EEEEeeccCC
Confidence            6778877764


No 17 
>PF08693 SKG6:  Transmembrane alpha-helix domain;  InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ]. This entry represents the highly conserved transmembrane alpha-helical domain found in these proteins [, ]. The full-length AXL2 protein has a negative regulatory function in cytokinesis [].
Probab=74.53  E-value=2.4  Score=25.29  Aligned_cols=27  Identities=37%  Similarity=0.519  Sum_probs=21.6

Q ss_pred             CCCcEEEEeeHHHHHHHHHHHHHHHHH
Q 028556          176 QVGKTVAIIVGVVAGLAILIVFLSICR  202 (207)
Q Consensus       176 ~~~~~~~iv~~~v~~~~~~~~~~~~~~  202 (207)
                      +..+..+|.+++++.++++++++.++-
T Consensus         6 ~~~~~vaIa~~VvVPV~vI~~vl~~~l   32 (40)
T PF08693_consen    6 SNSNTVAIAVGVVVPVGVIIIVLGAFL   32 (40)
T ss_pred             CCCceEEEEEEEEechHHHHHHHHHHh
Confidence            345688999999999988888887764


No 18 
>PF11857 DUF3377:  Domain of unknown function (DUF3377);  InterPro: IPR021805  This domain is functionally uncharacterised and found at the C terminus of peptidases belonging to MEROPS peptidase family M10A, membrane-type matrix metallopeptidases (clan MA). ; GO: 0004222 metalloendopeptidase activity
Probab=73.89  E-value=4.5  Score=27.40  Aligned_cols=23  Identities=26%  Similarity=0.446  Sum_probs=15.7

Q ss_pred             CCcEEEEeeHHHHHHHHHHHHHH
Q 028556          177 VGKTVAIIVGVVAGLAILIVFLS  199 (207)
Q Consensus       177 ~~~~~~iv~~~v~~~~~~~~~~~  199 (207)
                      +-++++|++|.++.+.++.+++.
T Consensus        28 ~~~avaVviPl~L~LCiLvl~ya   50 (74)
T PF11857_consen   28 TVNAVAVVIPLVLLLCILVLIYA   50 (74)
T ss_pred             ceeEEEEeHHHHHHHHHHHHHHH
Confidence            34578899998877666655444


No 19 
>TIGR01478 STEVOR variant surface antigen, stevor family. This model represents the stevor branch of the rifin/stevor family (pfam02009) of predicted variant surface antigens as found in Plasmodium falciparum. This model is based on a set of stevor sequences kindly provided by Matt Berriman from the Sanger Center. This is a global model and assesses a penalty for incomplete sequence. Additional fragmentary sequences may be found with the fragment model and a cutoff of 8 bits.
Probab=69.79  E-value=1.9  Score=36.80  Aligned_cols=15  Identities=7%  Similarity=0.239  Sum_probs=7.6

Q ss_pred             ceeEEEeccCCCCCC
Q 028556          155 QCYARYWASGYYDLT  169 (207)
Q Consensus       155 ~C~lRYe~~~F~~~~  169 (207)
                      .|.--.....+|+.+
T Consensus       213 ~C~SSIsIfNMF~~s  227 (295)
T TIGR01478       213 KCTKALAGINFFFSS  227 (295)
T ss_pred             hhhhhhhhhcccChH
Confidence            455444555555433


No 20 
>PF08374 Protocadherin:  Protocadherin;  InterPro: IPR013585 The structure of protocadherins is similar to that of classic cadherins (IPR002126 from INTERPRO), but they also have some unique features associated with the cytoplasmic domains. They are expressed in a variety of organisms and are found in high concentrations in the brain where they seem to be localised mainly at cell-cell contact sites. Their expression seems to be developmentally regulated []. 
Probab=68.58  E-value=7.9  Score=31.71  Aligned_cols=13  Identities=23%  Similarity=0.549  Sum_probs=7.7

Q ss_pred             cEEEEeeHHHHHH
Q 028556          179 KTVAIIVGVVAGL  191 (207)
Q Consensus       179 ~~~~iv~~~v~~~  191 (207)
                      .+++||.|++.++
T Consensus        39 I~iaiVAG~~tVI   51 (221)
T PF08374_consen   39 IMIAIVAGIMTVI   51 (221)
T ss_pred             eeeeeecchhhhH
Confidence            3456777766544


No 21 
>PF05808 Podoplanin:  Podoplanin;  InterPro: IPR008783 This family consists of several mammalian podoplanin-like proteins which are thought to control specifically the unique shape of podocytes [].; GO: 0016021 integral to membrane; PDB: 3IET_X.
Probab=68.45  E-value=1.6  Score=34.04  Aligned_cols=28  Identities=25%  Similarity=0.404  Sum_probs=0.0

Q ss_pred             CCcEEEEeeHHHHHHHHHHHHH-HHHHHh
Q 028556          177 VGKTVAIIVGVVAGLAILIVFL-SICRRA  204 (207)
Q Consensus       177 ~~~~~~iv~~~v~~~~~~~~~~-~~~~~~  204 (207)
                      ++.++.||+|+++++.++.-++ .+.||.
T Consensus       128 T~tLVGIIVGVLlaIG~igGIIivvvRKm  156 (162)
T PF05808_consen  128 TVTLVGIIVGVLLAIGFIGGIIIVVVRKM  156 (162)
T ss_dssp             -----------------------------
T ss_pred             eeeeeeehhhHHHHHHHHhheeeEEeehh
Confidence            3456789999998877665444 445654


No 22 
>PTZ00370 STEVOR; Provisional
Probab=68.43  E-value=2.1  Score=36.60  Aligned_cols=10  Identities=10%  Similarity=-0.097  Sum_probs=5.0

Q ss_pred             HHHHHHhhcC
Q 028556          198 LSICRRAMER  207 (207)
Q Consensus       198 ~~~~~~~~~~  207 (207)
                      +.|+.||+|+
T Consensus       275 YiwlyrrRK~  284 (296)
T PTZ00370        275 YIWLYRRRKN  284 (296)
T ss_pred             HHHHHHhhcc
Confidence            3455555553


No 23 
>PF03302 VSP:  Giardia variant-specific surface protein;  InterPro: IPR005127 During infection, the intestinal protozoan parasite Giardia lamblia virus undergoes continuous antigenic variation which is determined by diversification of the parasite's major surface antigen, named VSP (variant surface protein).
Probab=67.13  E-value=5.4  Score=35.77  Aligned_cols=25  Identities=32%  Similarity=0.361  Sum_probs=14.4

Q ss_pred             CCCcEEEEeeHHHHHHHHHHHHHHH
Q 028556          176 QVGKTVAIIVGVVAGLAILIVFLSI  200 (207)
Q Consensus       176 ~~~~~~~iv~~~v~~~~~~~~~~~~  200 (207)
                      ++|-|..|.|++|++|.-|+-||+|
T Consensus       365 stgaIaGIsvavvvvVgglvGfLcW  389 (397)
T PF03302_consen  365 STGAIAGISVAVVVVVGGLVGFLCW  389 (397)
T ss_pred             cccceeeeeehhHHHHHHHHHHHhh
Confidence            3455777888876655444434443


No 24 
>PF13908 Shisa:  Wnt and FGF inhibitory regulator
Probab=66.76  E-value=5.3  Score=31.51  Aligned_cols=7  Identities=43%  Similarity=1.018  Sum_probs=3.8

Q ss_pred             CceeEEE
Q 028556          154 AQCYARY  160 (207)
Q Consensus       154 ~~C~lRY  160 (207)
                      .+|.+||
T Consensus        31 G~C~~ry   37 (179)
T PF13908_consen   31 GTCSLRY   37 (179)
T ss_pred             CCccCcc
Confidence            3555555


No 25 
>PF01034 Syndecan:  Syndecan domain;  InterPro: IPR001050 The syndecans are transmembrane proteoglycans which are involved in the organisation of cytoskeleton and/or actin microfilaments, and have important roles as cell surface receptors during cell-cell and/or cell-matrix interactions [, ]. Structurally, these proteins consist of four separate domains:   A signal sequence; An extracellular domain (ectodomain) of variable length whose sequence is not evolutionary conserved in the various forms of syndecans. The ectodomain contains the sites of attachment of the heparan sulphate glycosaminoglycan side chains;  A transmembrane region;  A highly conserved cytoplasmic domain of about 30 to 35 residues, which could interact with cytoskeletal proteins.    The proteins known to belong to this family are:    Syndecan 1.  Syndecan 2 or fibroglycan.  Syndecan 3 or neuroglycan or N-syndecan.  Syndecan 4 or amphiglycan or ryudocan.  Drosophila syndecan.   Caenorhabditis elegans probable syndecan (F57C7.3).    Syndecan-4, a transmembrane heparan sulphate proteoglycan, is a coreceptor with integrins in cell adhesion. It has been suggested to form a ternary signalling complex with protein kinase Calpha and phosphatidylinositol 4,5-bisphosphate (PIP2). Structural studies have demonstrated that the cytoplasmic domain undergoes a conformational transition and forms a symmetric dimer in the presence of phospholipid activator PIP2, and whose overall structure in solution exhibits a twisted clamp shape having a cavity in the centre of dimeric interface. In addition, it has been observed that the syndecan-4 variable domain interacts, strongly, not only with fatty acyl groups but also the anionic head group of PIP2. These findings indicate that PIP2 promotes oligomerisation of the syndecan-4 cytoplasmic domain for transmembrane signalling and cell-matrix adhesion [, ].; GO: 0008092 cytoskeletal protein binding, 0016020 membrane; PDB: 1EJQ_B 1EJP_B 1YBO_C 1OBY_Q.
Probab=64.64  E-value=1.9  Score=28.45  Aligned_cols=29  Identities=10%  Similarity=0.266  Sum_probs=0.7

Q ss_pred             CCcEEEEeeHHHHHHHHHHHHHHHHHHhh
Q 028556          177 VGKTVAIIVGVVAGLAILIVFLSICRRAM  205 (207)
Q Consensus       177 ~~~~~~iv~~~v~~~~~~~~~~~~~~~~~  205 (207)
                      .+.+..+|++++.+++++++++..+|++-
T Consensus        12 aavIaG~Vvgll~ailLIlf~iyR~rkkd   40 (64)
T PF01034_consen   12 AAVIAGGVVGLLFAILLILFLIYRMRKKD   40 (64)
T ss_dssp             -------------------------S---
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhcC
Confidence            45566788888888878777787777653


No 26 
>TIGR01167 LPXTG_anchor LPXTG-motif cell wall anchor domain. A common feature of this proteins containing this domain appears to be a high proportion of charged and zwitterionic residues immediatedly upstream of the LPXTG motif. This model differs from other descriptions of the LPXTG region by including a portion of that upstream charged region.
Probab=64.38  E-value=7.1  Score=21.70  Aligned_cols=14  Identities=14%  Similarity=0.009  Sum_probs=6.0

Q ss_pred             HHHHHHHHHHHhhc
Q 028556          193 ILIVFLSICRRAME  206 (207)
Q Consensus       193 ~~~~~~~~~~~~~~  206 (207)
                      ++++...+++|++|
T Consensus        20 l~~~~~~~~~~rk~   33 (34)
T TIGR01167        20 LLGLGGLLLRKRKK   33 (34)
T ss_pred             HHHHHHHHheeccc
Confidence            33333344455544


No 27 
>PF12768 Rax2:  Cortical protein marker for cell polarity
Probab=63.78  E-value=19  Score=30.80  Aligned_cols=17  Identities=29%  Similarity=0.440  Sum_probs=9.0

Q ss_pred             CcEEEEeeHHHHHHHHH
Q 028556          178 GKTVAIIVGVVAGLAIL  194 (207)
Q Consensus       178 ~~~~~iv~~~v~~~~~~  194 (207)
                      |.++.|.+++.++++++
T Consensus       227 G~VVlIslAiALG~v~l  243 (281)
T PF12768_consen  227 GFVVLISLAIALGTVFL  243 (281)
T ss_pred             eEEEEEehHHHHHHHHH
Confidence            44566666655554333


No 28 
>PLN03150 hypothetical protein; Provisional
Probab=60.42  E-value=8.7  Score=36.44  Aligned_cols=28  Identities=14%  Similarity=0.278  Sum_probs=15.8

Q ss_pred             cEEEEeeHHHHHHHHHHHHHHHHHHhhc
Q 028556          179 KTVAIIVGVVAGLAILIVFLSICRRAME  206 (207)
Q Consensus       179 ~~~~iv~~~v~~~~~~~~~~~~~~~~~~  206 (207)
                      .++.|+++++++++++++.+.++|++++
T Consensus       545 ~~i~~~~~~~~~~l~~~~~~~~~~~~r~  572 (623)
T PLN03150        545 AKIGIAFGVSVAFLFLVICAMCWWKRRQ  572 (623)
T ss_pred             eEEEEEhHHHHHHHHHHHHHhhheeehh
Confidence            3566677766655455544555555544


No 29 
>PF12301 CD99L2:  CD99 antigen like protein 2;  InterPro: IPR022078  This family of proteins is found in eukaryotes. Proteins in this family are typically between 165 and 237 amino acids in length. CD99L2 and CD99 are involved in trans-endothelial migration of neutrophils in vitro and in the recruitment of neutrophils into inflamed peritoneum. 
Probab=60.25  E-value=8.8  Score=30.32  Aligned_cols=25  Identities=20%  Similarity=0.280  Sum_probs=13.3

Q ss_pred             EeeHHHHHH--HHHHHHHHHHHHhhcC
Q 028556          183 IIVGVVAGL--AILIVFLSICRRAMER  207 (207)
Q Consensus       183 iv~~~v~~~--~~~~~~~~~~~~~~~~  207 (207)
                      +|.|||.+|  +++-++..|+-.++||
T Consensus       116 ~IaGIvsav~valvGAvsSyiaYqkKK  142 (169)
T PF12301_consen  116 TIAGIVSAVVVALVGAVSSYIAYQKKK  142 (169)
T ss_pred             hhhhHHHHHHHHHHHHHHHHHHHHhhc
Confidence            444444333  2344456677777776


No 30 
>PF08114 PMP1_2:  ATPase proteolipid family;  InterPro: IPR012589 This family consists of small proteolipids associated with the plasma membrane H+ ATPase. Two proteolipids (PMP1 and PMP2) are associated with the ATPase and both genes are similarly expressed in the wild-type strain of yeast. No modification of the level of transcription of one PMP gene is detected in a strain deleted of the other. Though both proteolipids show similarity with other small proteolipids associated with other cation -transporting ATPases, their functions remain unclear [].
Probab=56.20  E-value=19  Score=21.50  Aligned_cols=6  Identities=17%  Similarity=0.401  Sum_probs=2.4

Q ss_pred             CcEEEE
Q 028556          178 GKTVAI  183 (207)
Q Consensus       178 ~~~~~i  183 (207)
                      |.++.+
T Consensus         9 GVIlVF   14 (43)
T PF08114_consen    9 GVILVF   14 (43)
T ss_pred             Ceeeeh
Confidence            334443


No 31 
>KOG1226 consensus Integrin beta subunit (N-terminal portion of extracellular region) [Signal transduction mechanisms; Extracellular structures]
Probab=56.12  E-value=14  Score=35.72  Aligned_cols=28  Identities=29%  Similarity=0.451  Sum_probs=22.1

Q ss_pred             CCcEEEEeeHHHHHHHHHHHHHHHHHHh
Q 028556          177 VGKTVAIIVGVVAGLAILIVFLSICRRA  204 (207)
Q Consensus       177 ~~~~~~iv~~~v~~~~~~~~~~~~~~~~  204 (207)
                      .-.+++|++++|++++++.+++..+|+.
T Consensus       710 ~~~~~~i~lgvv~~ivligl~llliwkl  737 (783)
T KOG1226|consen  710 GPNILAIVLGVVAGIVLIGLALLLIWKL  737 (783)
T ss_pred             CCcEeeehHHHHHHHHHHHHHHHHHHHH
Confidence            3468899999999888887777777764


No 32 
>PTZ00046 rifin; Provisional
Probab=55.80  E-value=9.8  Score=33.63  Aligned_cols=10  Identities=20%  Similarity=0.165  Sum_probs=5.8

Q ss_pred             HHHHHHhhcC
Q 028556          198 LSICRRAMER  207 (207)
Q Consensus       198 ~~~~~~~~~~  207 (207)
                      +..+|.|+||
T Consensus       335 YLILRYRRKK  344 (358)
T PTZ00046        335 YLILRYRRKK  344 (358)
T ss_pred             HHHHHhhhcc
Confidence            3456766665


No 33 
>TIGR01477 RIFIN variant surface antigen, rifin family. This model represents the rifin branch of the rifin/stevor family (pfam02009) of predicted variant surface antigens as found in Plasmodium falciparum. This model is based on a set of rifin sequences kindly provided by Matt Berriman from the Sanger Center. This is a global model and assesses a penalty for incomplete sequence. Additional fragmentary sequences may be found with the fragment model and a cutoff of 20 bits.
Probab=55.48  E-value=10  Score=33.49  Aligned_cols=10  Identities=20%  Similarity=0.165  Sum_probs=5.8

Q ss_pred             HHHHHHhhcC
Q 028556          198 LSICRRAMER  207 (207)
Q Consensus       198 ~~~~~~~~~~  207 (207)
                      +..+|.|+||
T Consensus       330 YLILRYRRKK  339 (353)
T TIGR01477       330 YLILRYRRKK  339 (353)
T ss_pred             HHHHHhhhcc
Confidence            3456666665


No 34 
>PF15176 LRR19-TM:  Leucine-rich repeat family 19 TM domain
Probab=54.07  E-value=15  Score=26.40  Aligned_cols=21  Identities=24%  Similarity=0.385  Sum_probs=13.6

Q ss_pred             CCCCcEEEEeeHHHHHHHHHH
Q 028556          175 DQVGKTVAIIVGVVAGLAILI  195 (207)
Q Consensus       175 ~~~~~~~~iv~~~v~~~~~~~  195 (207)
                      ...++.++..+|+|++++++-
T Consensus        11 ~~~g~sW~~LVGVv~~al~~S   31 (102)
T PF15176_consen   11 GEGGRSWPFLVGVVVTALVTS   31 (102)
T ss_pred             CCCCcccHhHHHHHHHHHHHH
Confidence            345788888888776554443


No 35 
>PF12877 DUF3827:  Domain of unknown function (DUF3827);  InterPro: IPR024606 The function of the proteins in this entry is not currently known, but one of the human proteins (Q9HCM3 from SWISSPROT) has been implicated in pilocytic astrocytomas [, , ]. In the majority of cases of pilocytic astrocytomas a tandem duplication produces an in-frame fusion of the gene encoding this protein and the BRAF oncogene. The resulting fusion protein has constitutive BRAF kinase activity and is capable of transforming cells. 
Probab=52.83  E-value=30  Score=32.96  Aligned_cols=22  Identities=14%  Similarity=-0.185  Sum_probs=11.3

Q ss_pred             eEEEEeccCCCChhhHHHHHHH
Q 028556          113 VEGFAQCLGDLTPADCTTCLAE  134 (207)
Q Consensus       113 vYgLaQC~~DLs~~~C~~CL~~  134 (207)
                      -|...+=-.-|...+...=|..
T Consensus       211 YyV~~~~G~pl~a~~AA~~Ln~  232 (684)
T PF12877_consen  211 YYVEGQNGKPLPAVTAAKDLNL  232 (684)
T ss_pred             EEEEcCCCcCCcHHHHHHHHhc
Confidence            4444355555666665544433


No 36 
>KOG3637 consensus Vitronectin receptor, alpha subunit [Extracellular structures]
Probab=52.44  E-value=14  Score=37.37  Aligned_cols=24  Identities=25%  Similarity=0.452  Sum_probs=16.4

Q ss_pred             EEEEeeHHHHHHHHHHHHHHHHHH
Q 028556          180 TVAIIVGVVAGLAILIVFLSICRR  203 (207)
Q Consensus       180 ~~~iv~~~v~~~~~~~~~~~~~~~  203 (207)
                      ++.||++++++++++++++..+||
T Consensus       978 ~wiIi~svl~GLLlL~llv~~LwK 1001 (1030)
T KOG3637|consen  978 LWIIILSVLGGLLLLALLVLLLWK 1001 (1030)
T ss_pred             eeeehHHHHHHHHHHHHHHHHHHh
Confidence            567888888887766665554444


No 37 
>PF12768 Rax2:  Cortical protein marker for cell polarity
Probab=51.95  E-value=8.7  Score=32.82  Aligned_cols=29  Identities=28%  Similarity=0.334  Sum_probs=17.4

Q ss_pred             CcEEEEeeHHHHHHHHHHHHHHHHHHhhc
Q 028556          178 GKTVAIIVGVVAGLAILIVFLSICRRAME  206 (207)
Q Consensus       178 ~~~~~iv~~~v~~~~~~~~~~~~~~~~~~  206 (207)
                      .--++|.+|+++.++++-+++.+++|+++
T Consensus       231 lIslAiALG~v~ll~l~Gii~~~~~r~~~  259 (281)
T PF12768_consen  231 LISLAIALGTVFLLVLIGIILAYIRRRRQ  259 (281)
T ss_pred             EEehHHHHHHHHHHHHHHHHHHHHHhhhc
Confidence            34466777766666566555556666643


No 38 
>PF11884 DUF3404:  Domain of unknown function (DUF3404);  InterPro: IPR021821  This domain is functionally uncharacterised. This domain is found in bacteria. This presumed domain is about 260 amino acids in length. This domain is found associated with PF02518 from PFAM, PF00512 from PFAM. 
Probab=50.49  E-value=5.9  Score=33.48  Aligned_cols=13  Identities=23%  Similarity=0.524  Sum_probs=9.9

Q ss_pred             cCceeEEEeccCC
Q 028556          153 LAQCYARYWASGY  165 (207)
Q Consensus       153 ~~~C~lRYe~~~F  165 (207)
                      +.+|++||.+--+
T Consensus       210 ~~sC~~r~gNlCw  222 (262)
T PF11884_consen  210 GNSCFVRYGNLCW  222 (262)
T ss_pred             CCcccceecceee
Confidence            4689999987654


No 39 
>PF13908 Shisa:  Wnt and FGF inhibitory regulator
Probab=48.93  E-value=8.5  Score=30.32  Aligned_cols=10  Identities=50%  Similarity=0.830  Sum_probs=4.3

Q ss_pred             EEEEeeHHHH
Q 028556          180 TVAIIVGVVA  189 (207)
Q Consensus       180 ~~~iv~~~v~  189 (207)
                      ++.|+++|++
T Consensus        77 ~~~iivgvi~   86 (179)
T PF13908_consen   77 ITGIIVGVIC   86 (179)
T ss_pred             eeeeeeehhh
Confidence            3344444433


No 40 
>PF05624 LSR:  Lipolysis stimulated receptor (LSR);  InterPro: IPR008664 This domain consists of mammalian LISCH7 protein homologues. LISCH7 is a liver-specific BHLH-ZIP transcription factor.
Probab=48.31  E-value=41  Score=20.65  Aligned_cols=19  Identities=26%  Similarity=0.733  Sum_probs=8.6

Q ss_pred             eeHHHHHHHHHHHHHHHHH
Q 028556          184 IVGVVAGLAILIVFLSICR  202 (207)
Q Consensus       184 v~~~v~~~~~~~~~~~~~~  202 (207)
                      |+-|+++.+++++.+...|
T Consensus         5 V~~iilg~~ll~~LigiCw   23 (49)
T PF05624_consen    5 VVLIILGALLLLLLIGICW   23 (49)
T ss_pred             EeHHHHHHHHHHHHHHHHH
Confidence            4445554444444444444


No 41 
>PF15345 TMEM51:  Transmembrane protein 51
Probab=47.93  E-value=22  Score=29.44  Aligned_cols=23  Identities=26%  Similarity=0.456  Sum_probs=10.9

Q ss_pred             EEEEeeHHHHHHHHHHHHHHHHHH
Q 028556          180 TVAIIVGVVAGLAILIVFLSICRR  203 (207)
Q Consensus       180 ~~~iv~~~v~~~~~~~~~~~~~~~  203 (207)
                      .+|+|+..+ +++++++-+|..-|
T Consensus        59 SVAyVLVG~-Gv~LLLLSICL~IR   81 (233)
T PF15345_consen   59 SVAYVLVGS-GVALLLLSICLSIR   81 (233)
T ss_pred             EEEEehhhH-HHHHHHHHHHHHHH
Confidence            355554433 44455555554433


No 42 
>PF13940 Ldr_toxin:  Toxin Ldr, type I toxin-antitoxin system
Probab=46.45  E-value=21  Score=20.35  Aligned_cols=20  Identities=20%  Similarity=0.371  Sum_probs=10.5

Q ss_pred             eHHHHHHHHHHHHHHHHHHhh
Q 028556          185 VGVVAGLAILIVFLSICRRAM  205 (207)
Q Consensus       185 ~~~v~~~~~~~~~~~~~~~~~  205 (207)
                      .|+++++ +..++..|.++|+
T Consensus        16 AP~iagI-i~s~iv~w~~~RK   35 (35)
T PF13940_consen   16 APIIAGI-IASLIVGWLRNRK   35 (35)
T ss_pred             hHHHHHH-HHHHHHHHHHhcC
Confidence            4555555 3333456666553


No 43 
>PF04478 Mid2:  Mid2 like cell wall stress sensor;  InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region. The remainder of the protein sequence is serine-rich and of low complexity, and is therefore impossible to align accurately. Mid2 is thought to act as a mechanosensor of cell wall stress. The C-terminal cytoplasmic region of Mid2 is known to interact with Rom2, a guanine nucleotide exchange factor (GEF) for Rho1, which is part of the cell wall integrity signalling pathway [].
Probab=45.53  E-value=4  Score=31.62  Aligned_cols=28  Identities=25%  Similarity=0.426  Sum_probs=16.9

Q ss_pred             CcEEEEeeHHHHHHHHHHHHHHHHHHhhc
Q 028556          178 GKTVAIIVGVVAGLAILIVFLSICRRAME  206 (207)
Q Consensus       178 ~~~~~iv~~~v~~~~~~~~~~~~~~~~~~  206 (207)
                      |-++.|-+++++++ +++++++++|+++|
T Consensus        53 GvVVGVGg~ill~i-l~lvf~~c~r~kkt   80 (154)
T PF04478_consen   53 GVVVGVGGPILLGI-LALVFIFCIRRKKT   80 (154)
T ss_pred             EEEecccHHHHHHH-HHhheeEEEecccC
Confidence            77777777776654 44445555555544


No 44 
>PF10873 DUF2668:  Protein of unknown function (DUF2668);  InterPro: IPR022640  Members in this family of proteins are annotated as cysteine and tyrosine-rich protein 1, however currently no function is known []. 
Probab=43.56  E-value=39  Score=26.04  Aligned_cols=13  Identities=23%  Similarity=0.409  Sum_probs=8.1

Q ss_pred             cEEEEeeHHHHHH
Q 028556          179 KTVAIIVGVVAGL  191 (207)
Q Consensus       179 ~~~~iv~~~v~~~  191 (207)
                      -|..||+|+|..+
T Consensus        62 AIaGIVfgiVfim   74 (155)
T PF10873_consen   62 AIAGIVFGIVFIM   74 (155)
T ss_pred             eeeeeehhhHHHH
Confidence            3556888876543


No 45 
>COG3763 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=41.83  E-value=9.2  Score=25.63  Aligned_cols=7  Identities=43%  Similarity=0.819  Sum_probs=3.3

Q ss_pred             HHHHhhc
Q 028556          200 ICRRAME  206 (207)
Q Consensus       200 ~~~~~~~  206 (207)
                      +.||..|
T Consensus        24 iark~~~   30 (71)
T COG3763          24 IARKQMK   30 (71)
T ss_pred             HHHHHHH
Confidence            3455544


No 46 
>PRK00523 hypothetical protein; Provisional
Probab=41.66  E-value=9.3  Score=25.77  Aligned_cols=7  Identities=0%  Similarity=0.510  Sum_probs=3.0

Q ss_pred             HHHHhhc
Q 028556          200 ICRRAME  206 (207)
Q Consensus       200 ~~~~~~~  206 (207)
                      +.|+..|
T Consensus        25 iark~~~   31 (72)
T PRK00523         25 VSKKMFK   31 (72)
T ss_pred             HHHHHHH
Confidence            3354443


No 47 
>PF12877 DUF3827:  Domain of unknown function (DUF3827);  InterPro: IPR024606 The function of the proteins in this entry is not currently known, but one of the human proteins (Q9HCM3 from SWISSPROT) has been implicated in pilocytic astrocytomas [, , ]. In the majority of cases of pilocytic astrocytomas a tandem duplication produces an in-frame fusion of the gene encoding this protein and the BRAF oncogene. The resulting fusion protein has constitutive BRAF kinase activity and is capable of transforming cells. 
Probab=41.52  E-value=22  Score=33.83  Aligned_cols=17  Identities=24%  Similarity=0.339  Sum_probs=7.9

Q ss_pred             cEEEEEeccCCCChhch
Q 028556           12 TVYGLYQCRGDLKTTDC   28 (207)
Q Consensus        12 ~vygl~qCr~D~~~~~C   28 (207)
                      -+|+..-=++-++.++=
T Consensus        79 i~~aVr~~~~~LnGt~~   95 (684)
T PF12877_consen   79 ITYAVRNGSGFLNGTEV   95 (684)
T ss_pred             EEEEEecCceeeccHHH
Confidence            34444444444444443


No 48 
>PRK01844 hypothetical protein; Provisional
Probab=41.23  E-value=17  Score=24.47  Aligned_cols=24  Identities=42%  Similarity=0.419  Sum_probs=9.4

Q ss_pred             EeeHHHHHHHHHHHHHHHHHHhhc
Q 028556          183 IIVGVVAGLAILIVFLSICRRAME  206 (207)
Q Consensus       183 iv~~~v~~~~~~~~~~~~~~~~~~  206 (207)
                      |++++++.++-++++.++.|+..|
T Consensus         7 I~l~I~~li~G~~~Gff~ark~~~   30 (72)
T PRK01844          7 ILVGVVALVAGVALGFFIARKYMM   30 (72)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            344444333333333333454443


No 49 
>PF04689 S1FA:  DNA binding protein S1FA;  InterPro: IPR006779  S1FA is an unusual small plant peptide of only 70 amino acids with a basic domain which contains a nuclear localization signal and a putative DNA binding helix. S1FA is highly conserved between dicotyledonous and monocotyledonous plants and may be a DNA-binding protein that specifically recognises the negative promoter element S1F [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=40.61  E-value=59  Score=21.41  Aligned_cols=19  Identities=16%  Similarity=0.209  Sum_probs=11.2

Q ss_pred             CCCcEEEEeeHHHHHHHHH
Q 028556          176 QVGKTVAIIVGVVAGLAIL  194 (207)
Q Consensus       176 ~~~~~~~iv~~~v~~~~~~  194 (207)
                      +-|.|+.|+++-++.++++
T Consensus        11 nPGlIVLlvV~g~ll~flv   29 (69)
T PF04689_consen   11 NPGLIVLLVVAGLLLVFLV   29 (69)
T ss_pred             CCCeEEeehHHHHHHHHHH
Confidence            4466777777655544444


No 50 
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms]
Probab=38.20  E-value=54  Score=30.34  Aligned_cols=13  Identities=15%  Similarity=0.028  Sum_probs=8.6

Q ss_pred             CceeEEEeccCCC
Q 028556          154 AQCYARYWASGYY  166 (207)
Q Consensus       154 ~~C~lRYe~~~F~  166 (207)
                      +.|+.+|+..+=.
T Consensus       123 ~~CN~n~s~~~~~  135 (534)
T KOG3653|consen  123 DFCNANFSHLPPP  135 (534)
T ss_pred             CcccCCccccCCC
Confidence            6888877754433


No 51 
>PF02480 Herpes_gE:  Alphaherpesvirus glycoprotein E;  InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein. gE is involved in virus spread but is not essential for propagation [].; GO: 0016020 membrane; PDB: 2GJ7_F 2GIY_B.
Probab=38.18  E-value=11  Score=34.43  Aligned_cols=12  Identities=33%  Similarity=0.603  Sum_probs=5.4

Q ss_pred             EeccCCCChhhH
Q 028556          117 AQCLGDLTPADC  128 (207)
Q Consensus       117 aQC~~DLs~~~C  128 (207)
                      ..|.++-.+.+|
T Consensus       239 ~~C~~~~~~~~C  250 (439)
T PF02480_consen  239 ANCSPSGWPRRC  250 (439)
T ss_dssp             EEEBTTC-TTTT
T ss_pred             cCCCCCCCcCCC
Confidence            446555444444


No 52 
>PF05083 LST1:  LST-1 protein;  InterPro: IPR007775 B144/LST1 is a gene encoded in the human major histocompatibility complex that produces multiple forms of alternatively spliced mRNA and encodes peptides fewer than 100 amino acids in length. B144/LST1 is strongly expressed in dendritic cells. Transfection of B144/LST1 into a variety of cells induces morphologic changes including the production of long, thin filopodia []. A possible role in modulating immune responses. Induces morphological changes including production of filopodia and microspikes when overexpressed in a variety of cell types and may be involved in dendritic cell maturation. Isoform 1 and isoform 2 have an inhibitory effect on lymphocyte proliferation [, ]. ; GO: 0000902 cell morphogenesis, 0006955 immune response, 0016020 membrane
Probab=36.85  E-value=43  Score=22.44  Aligned_cols=18  Identities=17%  Similarity=0.231  Sum_probs=12.0

Q ss_pred             HHHHHHHHHHHHHHHhhc
Q 028556          189 AGLAILIVFLSICRRAME  206 (207)
Q Consensus       189 ~~~~~~~~~~~~~~~~~~  206 (207)
                      ++|+++.++++++-||+|
T Consensus         7 l~vvll~~clC~lsrRvk   24 (74)
T PF05083_consen    7 LAVVLLSACLCRLSRRVK   24 (74)
T ss_pred             HHHHHHHHHHHHHHhhhh
Confidence            445566667787777766


No 53 
>PF13955 Fst_toxin:  Toxin Fst, type I toxin-antitoxin system; PDB: 2KV5_A.
Probab=36.66  E-value=17  Score=18.48  Aligned_cols=12  Identities=33%  Similarity=0.642  Sum_probs=6.4

Q ss_pred             EeeHHHHHHHHH
Q 028556          183 IIVGVVAGLAIL  194 (207)
Q Consensus       183 iv~~~v~~~~~~  194 (207)
                      |+.|+++++++.
T Consensus         4 iIaPi~VGvvl~   15 (21)
T PF13955_consen    4 IIAPIVVGVVLT   15 (21)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             ehhhHHHHHHHH
Confidence            355666665433


No 54 
>TIGR02976 phageshock_pspB phage shock protein B. This model describes the PspB protein of the psp (phage shock protein) operon, as found in Escherichia coli and many related species. Expression of a phage protein called secretin protein IV, and a number of other stresses including ethanol, heat shock, and defects in protein secretion trigger sigma-54-dependent expression of the phage shock regulon. PspB is both a regulator and an effector protein of the phage shock response.
Probab=35.62  E-value=29  Score=23.58  Aligned_cols=21  Identities=5%  Similarity=0.013  Sum_probs=9.5

Q ss_pred             eeHHHHHHHHHHHHHHHHHHh
Q 028556          184 IVGVVAGLAILIVFLSICRRA  204 (207)
Q Consensus       184 v~~~v~~~~~~~~~~~~~~~~  204 (207)
                      ++|+++.+++++....++..+
T Consensus         7 ~~Pliif~ifVap~wl~lHY~   27 (75)
T TIGR02976         7 AIPLIIFVIFVAPLWLILHYR   27 (75)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            455555444444433444333


No 55 
>COG3765 WzzB Chain length determinant protein [Cell envelope biogenesis, outer membrane]
Probab=35.46  E-value=19  Score=31.62  Aligned_cols=34  Identities=18%  Similarity=0.334  Sum_probs=16.9

Q ss_pred             EEEeccCCCCCCCCCCC-CCCCcEEEEeeHHHHHH
Q 028556          158 ARYWASGYYDLTDSSHD-DQVGKTVAIIVGVVAGL  191 (207)
Q Consensus       158 lRYe~~~F~~~~~~~~~-~~~~~~~~iv~~~v~~~  191 (207)
                      .+++.|.+-..+..|.+ ++-+|.+.++++++++.
T Consensus       294 ~~~~~yRYl~~P~~Pvkrd~PrrA~ilil~~LiGg  328 (347)
T COG3765         294 ERFSTYRYLQKPTLPVKRDSPRRAIILILGALIGG  328 (347)
T ss_pred             cceeEEEecCCCCCCCcCCCcchHHHHHHHHHHHH
Confidence            44555544444443433 55566655555555543


No 56 
>PRK11638 lipopolysaccharide biosynthesis protein WzzE; Provisional
Probab=33.96  E-value=8.2  Score=33.94  Aligned_cols=46  Identities=15%  Similarity=0.220  Sum_probs=25.8

Q ss_pred             EEeccCCCCCCCCCC-CCCCCcEEEEeeHHHHHHHHHHHHHHHHHHhh
Q 028556          159 RYWASGYYDLTDSSH-DDQVGKTVAIIVGVVAGLAILIVFLSICRRAM  205 (207)
Q Consensus       159 RYe~~~F~~~~~~~~-~~~~~~~~~iv~~~v~~~~~~~~~~~~~~~~~  205 (207)
                      .|..|.+-..++.|. +++-++.+.+|+++++|+ ++.+++.++||++
T Consensus       295 ~f~~~~yl~~P~~Pv~rD~Pkr~lIlil~~llG~-~lg~~~vL~r~~~  341 (342)
T PRK11638        295 RFQTYRYLRTPEEPVKRDSPRRAFLMIMWGAVGA-LVGAGVALTRRRR  341 (342)
T ss_pred             eeeeeeeecCCCcCcccCCCchhHHHHHHHHHHH-HHHheeeEeecCC
Confidence            444544544444443 356677777788877776 3333344456554


No 57 
>PF14991 MLANA:  Protein melan-A; PDB: 2GTZ_F 2GT9_F 3MRO_P 2GUO_C 3MRQ_P 2GTW_C 3L6F_C 3MRP_P.
Probab=33.08  E-value=8.2  Score=28.39  Aligned_cols=10  Identities=20%  Similarity=0.451  Sum_probs=0.0

Q ss_pred             HHHHHHHHHh
Q 028556          195 IVFLSICRRA  204 (207)
Q Consensus       195 ~~~~~~~~~~  204 (207)
                      ++...|+|||
T Consensus        41 liGCWYckRR   50 (118)
T PF14991_consen   41 LIGCWYCKRR   50 (118)
T ss_dssp             ----------
T ss_pred             HHhheeeeec
Confidence            3333445555


No 58 
>KOG3488 consensus Dolichol phosphate-mannose regulatory protein (DPM2) [Posttranslational modification, protein turnover, chaperones]
Probab=32.34  E-value=35  Score=22.93  Aligned_cols=15  Identities=47%  Similarity=0.603  Sum_probs=9.7

Q ss_pred             EEEEeeHHHHHHHHH
Q 028556          180 TVAIIVGVVAGLAIL  194 (207)
Q Consensus       180 ~~~iv~~~v~~~~~~  194 (207)
                      -.+|.+|+.++++++
T Consensus        47 ~yAi~iPvaagl~ll   61 (81)
T KOG3488|consen   47 EYAITIPVAAGLFLL   61 (81)
T ss_pred             hHHhhhHHHHHHHHH
Confidence            357778877765444


No 59 
>PF03229 Alpha_GJ:  Alphavirus glycoprotein J;  InterPro: IPR004913 The exact function of the herpesvirus glycoprotein J is unknown, but it appears to play a role in the inhibition of apotosis of the host cell [].; GO: 0019050 suppression by virus of host apoptosis
Probab=32.28  E-value=59  Score=24.06  Aligned_cols=30  Identities=17%  Similarity=0.325  Sum_probs=17.6

Q ss_pred             CCCcEEEEeeHHHHHHHHHHHHHH-HHHHhh
Q 028556          176 QVGKTVAIIVGVVAGLAILIVFLS-ICRRAM  205 (207)
Q Consensus       176 ~~~~~~~iv~~~v~~~~~~~~~~~-~~~~~~  205 (207)
                      ..+.++-.|+|.+.+|++.+++.. +++|++
T Consensus        81 p~d~aLp~VIGGLcaL~LaamGA~~LLrR~c  111 (126)
T PF03229_consen   81 PVDFALPLVIGGLCALTLAAMGAGALLRRCC  111 (126)
T ss_pred             CcccchhhhhhHHHHHHHHHHHHHHHHHHHH
Confidence            345566777777766666655444 345544


No 60 
>PF14986 DUF4514:  Domain of unknown function (DUF4514)
Probab=30.94  E-value=50  Score=20.95  Aligned_cols=22  Identities=18%  Similarity=0.350  Sum_probs=13.0

Q ss_pred             EeeHHHHHHHHHHHHHHHHHHh
Q 028556          183 IIVGVVAGLAILIVFLSICRRA  204 (207)
Q Consensus       183 iv~~~v~~~~~~~~~~~~~~~~  204 (207)
                      ..+|+++...++++-++.+|+-
T Consensus        27 talGvaisAgFLaLKicmIrkh   48 (61)
T PF14986_consen   27 TALGVAISAGFLALKICMIRKH   48 (61)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHh
Confidence            3455555555666667777753


No 61 
>COG3197 FixS Uncharacterized protein, possibly involved in nitrogen fixation [Inorganic ion transport and metabolism]
Probab=30.31  E-value=81  Score=20.32  Aligned_cols=24  Identities=13%  Similarity=0.059  Sum_probs=10.6

Q ss_pred             EEEEeeHHHHHHHHHHHHHHHHHHh
Q 028556          180 TVAIIVGVVAGLAILIVFLSICRRA  204 (207)
Q Consensus       180 ~~~iv~~~v~~~~~~~~~~~~~~~~  204 (207)
                      ++.|.+|+.+.+++ +.+..|+|-.
T Consensus         3 ~l~~Lipvsi~l~~-v~l~~flWav   26 (58)
T COG3197           3 ILYILIPVSILLGA-VGLGAFLWAV   26 (58)
T ss_pred             eeeeHHHHHHHHHH-HHHHHHHHhc
Confidence            45556665443322 2233445543


No 62 
>PF05393 Hum_adeno_E3A:  Human adenovirus early E3A glycoprotein;  InterPro: IPR008652 This family consists of several early glycoproteins (E3A), from human adenovirus type 2.; GO: 0016021 integral to membrane
Probab=28.85  E-value=57  Score=22.91  Aligned_cols=11  Identities=18%  Similarity=0.459  Sum_probs=5.3

Q ss_pred             EEEeeHHHHHH
Q 028556          181 VAIIVGVVAGL  191 (207)
Q Consensus       181 ~~iv~~~v~~~  191 (207)
                      +.|-..+|.++
T Consensus        33 Lgm~~lvI~~i   43 (94)
T PF05393_consen   33 LGMWFLVICGI   43 (94)
T ss_pred             cchhHHHHHHH
Confidence            34444555544


No 63 
>PF08374 Protocadherin:  Protocadherin;  InterPro: IPR013585 The structure of protocadherins is similar to that of classic cadherins (IPR002126 from INTERPRO), but they also have some unique features associated with the cytoplasmic domains. They are expressed in a variety of organisms and are found in high concentrations in the brain where they seem to be localised mainly at cell-cell contact sites. Their expression seems to be developmentally regulated []. 
Probab=28.81  E-value=29  Score=28.49  Aligned_cols=22  Identities=27%  Similarity=0.536  Sum_probs=15.9

Q ss_pred             CcEEEEeeHHHHHHHHHHHHHH
Q 028556          178 GKTVAIIVGVVAGLAILIVFLS  199 (207)
Q Consensus       178 ~~~~~iv~~~v~~~~~~~~~~~  199 (207)
                      .-.+.|++++|++++.++++|+
T Consensus        34 ~d~~~I~iaiVAG~~tVILVI~   55 (221)
T PF08374_consen   34 KDYVKIMIAIVAGIMTVILVIF   55 (221)
T ss_pred             ccceeeeeeeecchhhhHHHHH
Confidence            4478899999988766655443


No 64 
>PF07297 DPM2:  Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2);  InterPro: IPR009914 This family consists of several eukaryotic dolichol phosphate-mannose biosynthesis regulatory (DPM2) proteins. Biosynthesis of glycosylphosphatidylinositol and N-glycan precursor is dependent upon a mannosyl donor, dolichol phosphate-mannose (DPM). DPM2, an 84 amino acid membrane protein expressed in the endoplasmic reticulum (ER), makes a complex with DPM1 that is essential for the ER localisation and stable expression of DPM1. Moreover, DPM2 enhances binding of dolichol phosphate, a substrate of DPM synthase. Biosynthesis of DPM in mammalian cells is regulated by DPM2 [].; GO: 0009059 macromolecule biosynthetic process, 0030176 integral to endoplasmic reticulum membrane
Probab=27.11  E-value=32  Score=23.61  Aligned_cols=13  Identities=31%  Similarity=0.253  Sum_probs=7.5

Q ss_pred             EEEEeeHHHHHHH
Q 028556          180 TVAIIVGVVAGLA  192 (207)
Q Consensus       180 ~~~iv~~~v~~~~  192 (207)
                      ..||.+|+++.++
T Consensus        45 ~yAi~lP~~lll~   57 (78)
T PF07297_consen   45 EYAIILPIFLLLL   57 (78)
T ss_pred             HHHHHHHHHHHHH
Confidence            4566777665443


No 65 
>PF15431 TMEM190:  Transmembrane protein 190
Probab=27.10  E-value=70  Score=23.49  Aligned_cols=18  Identities=28%  Similarity=0.390  Sum_probs=10.4

Q ss_pred             HHHHHHHHHHHHHHHhhc
Q 028556          189 AGLAILIVFLSICRRAME  206 (207)
Q Consensus       189 ~~~~~~~~~~~~~~~~~~  206 (207)
                      .++++++..++++|+.+.
T Consensus        69 ~gll~Li~~iclFWWAkR   86 (134)
T PF15431_consen   69 GGLLLLICSICLFWWAKR   86 (134)
T ss_pred             HhHHHHHHHHHHHHHHHH
Confidence            345555666666666553


No 66 
>PF06365 CD34_antigen:  CD34/Podocalyxin family;  InterPro: IPR013836 This family consists of several mammalian CD34 antigen proteins. The CD34 antigen is a human leukocyte membrane protein expressed specifically by lymphohematopoietic progenitor cells. CD34 is a phosphoprotein. Activation of protein kinase C (PKC) has been found to enhance CD34 phosphorylation [, ]. This family contains several eukaryotic podocalyxin proteins. Podocalyxin is a major membrane protein of the glomerular epithelium and is thought to be involved in maintenance of the architecture of the foot processes and filtration slits characteristic of this unique epithelium by virtue of its high negative charge. Podocalyxin functions as an anti-adhesin that maintains an open filtration pathway between neighbouring foot processes in the glomerular epithelium by charge repulsion [].
Probab=26.75  E-value=1e+02  Score=25.14  Aligned_cols=6  Identities=17%  Similarity=0.562  Sum_probs=2.6

Q ss_pred             EEEEee
Q 028556          180 TVAIIV  185 (207)
Q Consensus       180 ~~~iv~  185 (207)
                      +|+||+
T Consensus       102 lI~lv~  107 (202)
T PF06365_consen  102 LIALVT  107 (202)
T ss_pred             EEehHH
Confidence            444443


No 67 
>PF07204 Orthoreo_P10:  Orthoreovirus membrane fusion protein p10;  InterPro: IPR009854 This family consists of several Orthoreovirus membrane fusion protein p10 sequences. p10 is thought to be a multifunctional protein that plays a key role in virus-host interaction [].
Probab=26.03  E-value=46  Score=23.69  Aligned_cols=11  Identities=27%  Similarity=0.166  Sum_probs=4.7

Q ss_pred             EEEeeHHHHHH
Q 028556          181 VAIIVGVVAGL  191 (207)
Q Consensus       181 ~~iv~~~v~~~  191 (207)
                      ++...++++.+
T Consensus        45 LA~GGG~iLil   55 (98)
T PF07204_consen   45 LAAGGGLILIL   55 (98)
T ss_pred             hhccchhhhHH
Confidence            34444444433


No 68 
>PF06697 DUF1191:  Protein of unknown function (DUF1191);  InterPro: IPR010605 This family contains hypothetical plant proteins of unknown function.
Probab=25.71  E-value=62  Score=27.69  Aligned_cols=7  Identities=43%  Similarity=0.506  Sum_probs=2.9

Q ss_pred             EEEEeeH
Q 028556          180 TVAIIVG  186 (207)
Q Consensus       180 ~~~iv~~  186 (207)
                      .+.|+++
T Consensus       212 ~W~iv~g  218 (278)
T PF06697_consen  212 WWKIVVG  218 (278)
T ss_pred             eEEEEEE
Confidence            3344444


No 69 
>PF07010 Endomucin:  Endomucin;  InterPro: IPR010740 This family consists of several mammalian endomucin proteins. Endomucin is an early endothelial-specific antigen that is also expressed on putative hematopoietic progenitor cells.
Probab=25.52  E-value=46  Score=27.61  Aligned_cols=10  Identities=10%  Similarity=0.341  Sum_probs=4.1

Q ss_pred             HHHHHHHhhc
Q 028556          197 FLSICRRAME  206 (207)
Q Consensus       197 ~~~~~~~~~~  206 (207)
                      ++.++|-+.|
T Consensus       207 LvgLyr~C~k  216 (259)
T PF07010_consen  207 LVGLYRMCWK  216 (259)
T ss_pred             HHHHHHHhhc
Confidence            3344444333


No 70 
>PTZ00045 apical membrane antigen 1; Provisional
Probab=25.12  E-value=67  Score=30.31  Aligned_cols=17  Identities=12%  Similarity=0.417  Sum_probs=7.6

Q ss_pred             CcEEEEeeHHHHHHHHH
Q 028556          178 GKTVAIIVGVVAGLAIL  194 (207)
Q Consensus       178 ~~~~~iv~~~v~~~~~~  194 (207)
                      .+++.|++++..+++++
T Consensus       513 ~~~~i~iia~~~~~~~v  529 (595)
T PTZ00045        513 KRILIIIIAATGAVVLV  529 (595)
T ss_pred             cceehhHHHHHHHHHHH
Confidence            34555555444433333


No 71 
>PF05454 DAG1:  Dystroglycan (Dystrophin-associated glycoprotein 1);  InterPro: IPR008465 Dystroglycan is one of the dystrophin-associated glycoproteins, which is encoded by a 5.5 kb transcript in Homo sapiens. The protein product is cleaved into two non-covalently associated subunits, [alpha] (N-terminal) and [beta] (C-terminal). In skeletal muscle the dystroglycan complex works as a transmembrane linkage between the extracellular matrix and the cytoskeleton [alpha]-dystroglycan is extracellular and binds to merosin ([alpha]-2 laminin) in the basement membrane, while [beta]-dystroglycan is a transmembrane protein and binds to dystrophin, which is a large rod-like cytoskeletal protein, absent in Duchenne muscular dystrophy patients. Dystrophin binds to intracellular actin cables. In this way, the dystroglycan complex, which links the extracellular matrix to the intracellular actin cables, is thought to provide structural integrity in muscle tissues. The dystroglycan complex is also known to serve as an agrin receptor in muscle, where it may regulate agrin-induced acetylcholine receptor clustering at the neuromuscular junction. There is also evidence which suggests the function of dystroglycan as a part of the signal transduction pathway because it is shown that Grb2, a mediator of the Ras-related signal pathway, can interact with the cytoplasmic domain of dystroglycan. In general, aberrant expression of dystrophin-associated protein complex underlies the pathogenesis of Duchenne muscular dystrophy, Becker muscular dystrophy and severe childhood autosomal recessive muscular dystrophy. Interestingly, no genetic disease has been described for either [alpha]- or [beta]-dystroglycan. Dystroglycan is widely distributed in non-muscle tissues as well as in muscle tissues. During epithelial morphogenesis of kidney, the dystroglycan complex is shown to act as a receptor for the basement membrane. Dystroglycan expression in Mus musculus brain and neural retina has also been reported. However, the physiological role of dystroglycan in non-muscle tissues has remained unclear [].; PDB: 1EG4_P.
Probab=24.43  E-value=25  Score=30.24  Aligned_cols=25  Identities=16%  Similarity=0.284  Sum_probs=0.0

Q ss_pred             EEeeHHHHHHHHHHHHHHHHHHhhc
Q 028556          182 AIIVGVVAGLAILIVFLSICRRAME  206 (207)
Q Consensus       182 ~iv~~~v~~~~~~~~~~~~~~~~~~  206 (207)
                      ++|+.+++.++.++++++|.|||+.
T Consensus       152 aVVI~~iLLIA~iIa~icyrrkR~G  176 (290)
T PF05454_consen  152 AVVIAAILLIAGIIACICYRRKRKG  176 (290)
T ss_dssp             -------------------------
T ss_pred             HHHHHHHHHHHHHHHHHhhhhhhcc
Confidence            3444433334344444445455443


No 72 
>PF07438 DUF1514:  Protein of unknown function (DUF1514);  InterPro: IPR009999 This entry is represented by Bacteriophage phi PVL, Orf60. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family consists of several Staphylococcus aureus and related bacteriophage proteins of around 65 residues in length. The function of this family is unknown.
Probab=24.09  E-value=73  Score=20.99  Aligned_cols=14  Identities=43%  Similarity=0.769  Sum_probs=8.3

Q ss_pred             EeeHHHHHHHHHHH
Q 028556          183 IIVGVVAGLAILIV  196 (207)
Q Consensus       183 iv~~~v~~~~~~~~  196 (207)
                      |+++++++++++++
T Consensus         3 IiiSIvLai~lLI~   16 (66)
T PF07438_consen    3 IIISIVLAIALLIS   16 (66)
T ss_pred             hhHHHHHHHHHHHH
Confidence            56677776655444


No 73 
>PRK15471 chain length determinant protein WzzB; Provisional
Probab=23.37  E-value=53  Score=28.69  Aligned_cols=33  Identities=18%  Similarity=0.226  Sum_probs=17.5

Q ss_pred             CCCCcEEEEeeHHHHHHHHH---HHHHHHHHHhhcC
Q 028556          175 DQVGKTVAIIVGVVAGLAIL---IVFLSICRRAMER  207 (207)
Q Consensus       175 ~~~~~~~~iv~~~v~~~~~~---~~~~~~~~~~~~~  207 (207)
                      ++.+|.+.+++++++++++.   +++..++|++++|
T Consensus       290 d~Pkr~lIlil~~~lG~~lg~~~vL~r~~~r~~~~~  325 (325)
T PRK15471        290 DSPKKAITLVLAVLLGGMIGAGIVLGRNALRNYNAK  325 (325)
T ss_pred             CCCcchhHHHHHHHHHHHHHHHHHHHHHHHHhhhcC
Confidence            45566666666666554332   2223356666655


No 74 
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=23.27  E-value=68  Score=23.93  Aligned_cols=27  Identities=15%  Similarity=0.353  Sum_probs=14.5

Q ss_pred             CcEEEEeeHHHHHHHHHHHHHHHHHHh
Q 028556          178 GKTVAIIVGVVAGLAILIVFLSICRRA  204 (207)
Q Consensus       178 ~~~~~iv~~~v~~~~~~~~~~~~~~~~  204 (207)
                      +-++++++|+++.+++++.++...||+
T Consensus        68 ~Ii~gv~aGvIg~Illi~y~irR~~Kk   94 (122)
T PF01102_consen   68 GIIFGVMAGVIGIILLISYCIRRLRKK   94 (122)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHS--
T ss_pred             ehhHHHHHHHHHHHHHHHHHHHHHhcc
Confidence            344555666665555556666666554


No 75 
>PRK10381 LPS O-antigen length regulator; Provisional
Probab=23.27  E-value=43  Score=29.82  Aligned_cols=35  Identities=17%  Similarity=0.203  Sum_probs=19.3

Q ss_pred             EEEeccCCCCCCCCCC-CCCCCcEEEEeeHHHHHHH
Q 028556          158 ARYWASGYYDLTDSSH-DDQVGKTVAIIVGVVAGLA  192 (207)
Q Consensus       158 lRYe~~~F~~~~~~~~-~~~~~~~~~iv~~~v~~~~  192 (207)
                      .++..|.+-..++.|. +++.+|.+.+|+++++|++
T Consensus       316 ~~~~~fryl~~p~~P~~rd~Pkr~lIlvl~~llG~~  351 (377)
T PRK10381        316 VNFTPFKYQLSPSLPVKKDGPGKALIVILAALIGGM  351 (377)
T ss_pred             cccceEEecCCCcCCCCCCCcchhHHHHHHHHHHHH
Confidence            3444444444444333 3666777777777776653


No 76 
>PF10577 UPF0560:  Uncharacterised protein family UPF0560;  InterPro: IPR018890  This family of proteins has no known function. 
Probab=23.05  E-value=66  Score=31.54  Aligned_cols=19  Identities=11%  Similarity=-0.202  Sum_probs=10.0

Q ss_pred             cCCCcccEEEcCceeEEEe
Q 028556          143 CGSAPAADVFLAQCYARYW  161 (207)
Q Consensus       143 c~~~~gg~i~~~~C~lRYe  161 (207)
                      +..+.|..+-...-.+|=+
T Consensus       214 FD~ktG~Wv~~G~G~Vk~~  232 (807)
T PF10577_consen  214 FDEKTGAWVKSGLGMVKRE  232 (807)
T ss_pred             ecCCcceeEecceEEEEee
Confidence            3445565555555555544


No 77 
>PF00944 Peptidase_S3:  Alphavirus core protein ;  InterPro: IPR000930 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. Togavirin, also known as Sindbis virus core endopeptidase, is a serine protease resident at the N terminus of the p130 polyprotein of togaviruses []. The endopeptidase signature identifies the peptidase as belonging to the MEROPS peptidase family S3 (togavirin family, clan PA(S)). The polyprotein also includes structural proteins for the nucleocapsid core and for the glycoprotein spikes []. Togavirin is only active while part of the polyprotein, cleavage at a Trp-Ser bond resulting in total lack of activity []. Mutagenesis studies have identified the location of the His-Asp-Ser catalytic triad, and X-ray studies have revealed the protein fold to be similar to that of chymotrypsin [, ].; GO: 0004252 serine-type endopeptidase activity, 0006508 proteolysis, 0016020 membrane; PDB: 2YEW_D 1EP5_A 3J0C_F 1EP6_C 1WYK_D 1DYL_A 1VCQ_B 1VCP_B 1LD4_D 1KXA_A ....
Probab=22.13  E-value=60  Score=24.86  Aligned_cols=30  Identities=30%  Similarity=0.462  Sum_probs=19.3

Q ss_pred             eEEEeccCCCCCCC--CCCC------CCCCcEEEEeeH
Q 028556          157 YARYWASGYYDLTD--SSHD------DQVGKTVAIIVG  186 (207)
Q Consensus       157 ~lRYe~~~F~~~~~--~~~~------~~~~~~~~iv~~  186 (207)
                      .++|+...|--.+.  .++.      +++|++++||+|
T Consensus        88 aVqy~~grftip~g~g~~GDSGRpi~DNsGrVVaIVLG  125 (158)
T PF00944_consen   88 AVQYSNGRFTIPTGVGKPGDSGRPIFDNSGRVVAIVLG  125 (158)
T ss_dssp             EEEEETTEEEEETTS-STTSTTEEEESTTSBEEEEEEE
T ss_pred             eEEEeCCeEEeccCCCCCCCCCCccCcCCCCEEEEEec
Confidence            47788777653221  1211      688999999986


No 78 
>PF06682 DUF1183:  Protein of unknown function (DUF1183);  InterPro: IPR009567 This family consists of several eukaryotic proteins of around 360 residues in length. The function of this family is unknown.
Probab=21.93  E-value=1.5e+02  Score=25.92  Aligned_cols=16  Identities=19%  Similarity=0.275  Sum_probs=12.8

Q ss_pred             ccEEEcCceeEEEecc
Q 028556          148 AADVFLAQCYARYWAS  163 (207)
Q Consensus       148 gg~i~~~~C~lRYe~~  163 (207)
                      .--|+-.+|-|.|++.
T Consensus       108 DpyvLkGSCgleY~L~  123 (318)
T PF06682_consen  108 DPYVLKGSCGLEYRLE  123 (318)
T ss_pred             CceecCCccceEEEEE
Confidence            3468889999999854


No 79 
>PF02480 Herpes_gE:  Alphaherpesvirus glycoprotein E;  InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein. gE is involved in virus spread but is not essential for propagation [].; GO: 0016020 membrane; PDB: 2GJ7_F 2GIY_B.
Probab=21.66  E-value=31  Score=31.47  Aligned_cols=9  Identities=22%  Similarity=0.759  Sum_probs=0.0

Q ss_pred             EEEeeHHHH
Q 028556          181 VAIIVGVVA  189 (207)
Q Consensus       181 ~~iv~~~v~  189 (207)
                      +++++++++
T Consensus       355 l~vVlgvav  363 (439)
T PF02480_consen  355 LGVVLGVAV  363 (439)
T ss_dssp             ---------
T ss_pred             HHHHHHHHH
Confidence            334444433


No 80 
>PF05084 GRA6:  Granule antigen protein (GRA6);  InterPro: IPR008119  Toxoplasma gondii is an obligate intracellular apicomplexan protozoan parasite, with a complex lifestyle involving varied hosts []. It has two phases of growth: an intestinal phase in feline hosts, and an extra-intestinal phase in other mammals. Oocysts from infected cats develop into tachyzoites, and eventually, bradyzoites and zoitocysts in the extraintestinal host []. Transmission of the parasite occurs through contact with infected cats or raw/undercooked meat; in immunocompromised individuals, it can cause severe and often lethal toxoplasmosis. Acute infection in healthy humans can sometimes also cause tissue damage [].  The protozoan utilises a variety of secretory and antigenic proteins to invade a host and gain access to the intracellular environment []. These originate from distinct organelles in the T. gondii cell termed micronemes, rhoptries, and dense granules. They are released at specific times during invasion to ensure the proteins are allocated to their correct target destinations []. Dense granule antigens (GRAs) are released from the T. gondii tachyzoite while still encapsulated in a host vacuole. Gra6, one of these moieties, is associated with the parasitophorous vacuole []. It possesses a hydrophobic central region flanked by two hydrophilic domains, and is present as a single copy gene in the Toxoplasma gondii genome []. Gra6 shares a similar function with Gra2, in that it is rapidly targeted to a network of membranous tubules that connect with the vacuolar membrane []. Indeed, these two proteins, together with Gra4, form a multimeric complex that stabilises the parasite within the vacuole.
Probab=21.61  E-value=80  Score=24.88  Aligned_cols=20  Identities=20%  Similarity=0.267  Sum_probs=10.9

Q ss_pred             HHHHHHHHHHHHHHHHHhhc
Q 028556          187 VVAGLAILIVFLSICRRAME  206 (207)
Q Consensus       187 ~v~~~~~~~~~~~~~~~~~~  206 (207)
                      +|+++.+.++...|+||+..
T Consensus       157 ~VlA~~VA~L~~~F~RR~~r  176 (215)
T PF05084_consen  157 VVLAVSVAMLTWFFLRRTGR  176 (215)
T ss_pred             HHHHHHHHHHHHHHHHhhcc
Confidence            34444455555566777653


No 81 
>COG4736 CcoQ Cbb3-type cytochrome oxidase, subunit 3 [Posttranslational modification, protein turnover, chaperones]
Probab=21.41  E-value=1e+02  Score=20.01  Aligned_cols=11  Identities=18%  Similarity=0.380  Sum_probs=4.4

Q ss_pred             HHHHHHHHHHH
Q 028556          193 ILIVFLSICRR  203 (207)
Q Consensus       193 ~~~~~~~~~~~  203 (207)
                      +++.++.|.-|
T Consensus        21 ~fiavi~~ayr   31 (60)
T COG4736          21 FFIAVIYFAYR   31 (60)
T ss_pred             HHHHHHHHHhc
Confidence            33334444433


Done!