Citrus Sinensis ID: 028576


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------
MRVAGAATLISIPLKPSKTKPTRIMALNSSNKNKNMNPPTVAMASLSGKENEKRKLPILLFDIMDTIVRDPFYHDVPAFFGMSMKELIECKHPNAWIEFEMGMISEMELARKFFTDGRPFDLEGLKICMKKGYAYLDGVEELLHELKQSNYEMHAFTNYPIWYEIIEDKLKISTYLSWTFCSCVIGMFSKQCLKERGNLILIFIRKS
cccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccEEEEEcccccccccccccHHHHHHHcHHHHHHHcccHHHHHHHcccccHHHHHHHHHcccccccHHHHHHHHHHcccccccHHHHHHHHHHcccEEEEEEcHHHHHHHHHHHHHHcccccEEEEEccccccccccccccccEEEEEEEcc
cEEEEEEEcccccccccccccccccccccccccccccccHHHHccccccccccccccEEEEEcHHHHccccHHHHHHHHHcccHHHHHHcccccHHHHHHcccccHHHHHHHHHcccccccHHHHHHHHHHHHHccccHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHcHHHHccEEEEEcHcccccHHHHcccccEEEEEEEcc
MRVAGAATLisiplkpsktkptriMALNssnknknmnpptVAMASlsgkenekrklpILLFDIMDtivrdpfyhdvpaffGMSMKELIECKHPNAWIEFEMGMISEMELARKFftdgrpfdleGLKICMKKGYAYLDGVEELLHELKQSnyemhaftnYPIWYEIIEDKLKISTYLSWTFCSCVIGMFSKQCLKERGNLILIFIRKS
mrvagaatlisiplkpsktkptRIMALnssnknknmnppTVAMASlsgkenekRKLPILLFDIMDTIVRDPFYHDVPAFFGMSMKELIECKHPNAWIEFEMGMISEMELARKFFTDGRPFDLEGLKICMKKGYAYLDGVEELLHELKQSNYEMHAFTNYPIWYEIIEDKLKISTYLSWTFCSCVIGMFSKQCLKERGNLilifirks
MRVAGAATLISIPLKPSKTKPTRIMALnssnknknmnppTVAMASLSGKENEKRKLPILLFDIMDTIVRDPFYHDVPAFFGMSMKELIECKHPNAWIEFEMGMISEMELARKFFTDGRPFDLEGLKICMKKGYAYLDGVEELLHELKQSNYEMHAFTNYPIWYEIIEDKLKISTYLSWTFCSCVIGMFSKQCLKERGNLILIFIRKS
*******************************************************LPILLFDIMDTIVRDPFYHDVPAFFGMSMKELIECKHPNAWIEFEMGMISEMELARKFFTDGRPFDLEGLKICMKKGYAYLDGVEELLHELKQSNYEMHAFTNYPIWYEIIEDKLKISTYLSWTFCSCVIGMFSKQCLKERGNLILIFI***
*********************************************************ILLFDIMDTIVRDPFYHDVPAFFGMSMKELIECKHPNAWIEFEMGMISEMELARKFFTDGRPFDLEGLKICMKKGYAYLDGVEELLHELKQSNYEMHAFTNYPIWYEIIEDKLKISTYLSWTFCSCVIGMFSKQCLKERGNLILIFIRKS
MRVAGAATLISIPLKPSKTKPTRIMALNSSNKNKNMNPPTVAMASLSGKENEKRKLPILLFDIMDTIVRDPFYHDVPAFFGMSMKELIECKHPNAWIEFEMGMISEMELARKFFTDGRPFDLEGLKICMKKGYAYLDGVEELLHELKQSNYEMHAFTNYPIWYEIIEDKLKISTYLSWTFCSCVIGMFSKQCLKERGNLILIFIRKS
MRVAGAATLISIPLKPSKTKPTRI*A*NS*****NM*PP****AS****ENEKRKLPILLFDIMDTIVRDPFYHDVPAFFGMSMKELIECKHPNAWIEFEMGMISEMELARKFFTDGRPFDLEGLKICMKKGYAYLDGVEELLHELKQSNYEMHAFTNYPIWYEIIEDKLKISTYLSWTFCSCVIGMFSKQCLKERGNLILIFIRKS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRVAGAATLISIPLKPSKTKPTRIMALNSSNKNKNMNPPTVAMASLSGKENEKRKLPILLFDIMDTIVRDPFYHDVPAFFGMSMKELIECKHPNAWIEFEMGMISEMELARKFFTDGRPFDLEGLKICMKKGYAYLDGVEELLHELKQSNYEMHAFTNYPIWYEIIEDKLKISTYLSWTFCSCVIGMFSKQCLKERGNLILIFIRKS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query207
359476630244 PREDICTED: uncharacterized protein LOC10 0.811 0.688 0.668 1e-63
224111942252 predicted protein [Populus trichocarpa] 0.888 0.730 0.639 2e-62
255632788214 unknown [Glycine max] 0.811 0.785 0.662 2e-62
351723195255 uncharacterized protein LOC100527586 [Gl 0.811 0.658 0.662 4e-62
297735303216 unnamed protein product [Vitis vinifera] 0.685 0.657 0.767 8e-62
297839955240 hypothetical protein ARALYDRAFT_477291 [ 0.777 0.670 0.674 1e-60
388506662256 unknown [Lotus japonicus] 0.710 0.574 0.707 1e-60
363807772257 uncharacterized protein LOC100790345 [Gl 0.816 0.657 0.652 2e-60
255558130224 catalytic, putative [Ricinus communis] g 0.840 0.776 0.607 4e-60
388492746257 unknown [Medicago truncatula] 0.792 0.638 0.635 5e-60
>gi|359476630|ref|XP_003631869.1| PREDICTED: uncharacterized protein LOC100261651 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 119/178 (66%), Positives = 138/178 (77%), Gaps = 10/178 (5%)

Query: 10  ISIPLK-PSKTKPTRIMALNSSNKNKNMNPPTVAMASLSGKENEKRKLPILLFDIMDTIV 68
           +S PLK    T  +R MA+   N + N         + S  +N  RKLPILLFDIMDTIV
Sbjct: 13  VSFPLKLKHPTSKSRKMAIKIINSSSN---------TTSTGDNGNRKLPILLFDIMDTIV 63

Query: 69  RDPFYHDVPAFFGMSMKELIECKHPNAWIEFEMGMISEMELARKFFTDGRPFDLEGLKIC 128
           RDPFYHDVP FF M M+EL+ECKHP AWIEFE G+I+E ELARKFF DGR FDLEGLK C
Sbjct: 64  RDPFYHDVPVFFRMPMEELLECKHPTAWIEFEKGLINETELARKFFKDGRDFDLEGLKNC 123

Query: 129 MKKGYAYLDGVEELLHELKQSNYEMHAFTNYPIWYEIIEDKLKISTYLSWTFCSCVIG 186
           M++GY+Y++GVE LL  LKQ+NYEMHAFTNYPIWYE+IEDKLK+ST+LSWTFCSC IG
Sbjct: 124 MRRGYSYIEGVEGLLRALKQNNYEMHAFTNYPIWYEMIEDKLKLSTFLSWTFCSCTIG 181




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224111942|ref|XP_002316029.1| predicted protein [Populus trichocarpa] gi|222865069|gb|EEF02200.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255632788|gb|ACU16747.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|351723195|ref|NP_001238294.1| uncharacterized protein LOC100527586 [Glycine max] gi|255632691|gb|ACU16697.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|297735303|emb|CBI17665.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297839955|ref|XP_002887859.1| hypothetical protein ARALYDRAFT_477291 [Arabidopsis lyrata subsp. lyrata] gi|297333700|gb|EFH64118.1| hypothetical protein ARALYDRAFT_477291 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|388506662|gb|AFK41397.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|363807772|ref|NP_001242176.1| uncharacterized protein LOC100790345 [Glycine max] gi|255641172|gb|ACU20863.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|255558130|ref|XP_002520093.1| catalytic, putative [Ricinus communis] gi|223540721|gb|EEF42282.1| catalytic, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|388492746|gb|AFK34439.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query207
TAIR|locus:2019873245 FHY1 "flavin mononucleotide hy 0.695 0.587 0.724 7.5e-57
TAIR|locus:2019873 FHY1 "flavin mononucleotide hydrolase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 585 (211.0 bits), Expect = 7.5e-57, P = 7.5e-57
 Identities = 105/145 (72%), Positives = 120/145 (82%)

Query:    43 MASLSGKE-NEKRKLPILLFDIMDTIVRDPFYHDVPAFFGMSMKELIECKHPNAWIEFEM 101
             + S SG E + KRKLPILLFD+MDTIVRDPFY DVPAFFGM MK+L+ECKHP  WIEFE 
Sbjct:    33 LGSSSGDEISRKRKLPILLFDVMDTIVRDPFYQDVPAFFGMPMKQLLECKHPMVWIEFEK 92

Query:   102 GMISEMELARKFFTDGRPFDLEGLKICMKKGYAYLDGVEELLHELKQSNYEMHAFTNYPI 161
             G+I E ELAR FF DGR FDLEGLK CM+ GY+YLDG++ELL  L   ++E+HAFTNYPI
Sbjct:    93 GLIDEEELARNFFIDGRDFDLEGLKECMRSGYSYLDGMQELLQTLAADDFEIHAFTNYPI 152

Query:   162 WYEIIEDKLKISTYLSWTFCSCVIG 186
             WY IIEDKLK+S YLSWTFCSC+ G
Sbjct:   153 WYNIIEDKLKLSAYLSWTFCSCIAG 177


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.325   0.139   0.426    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      207       195   0.00078  111 3  11 22  0.40    32
                                                     31  0.44    35


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  607 (65 KB)
  Total size of DFA:  180 KB (2104 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  16.59u 0.15s 16.74t   Elapsed:  00:00:01
  Total cpu time:  16.59u 0.15s 16.74t   Elapsed:  00:00:01
  Start:  Sat May 11 02:23:48 2013   End:  Sat May 11 02:23:49 2013


GO:0016787 "hydrolase activity" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=IDA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_fgenesh4_pg.C_LG_X1288
SubName- Full=Putative uncharacterized protein; (253 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query207
pfam13419176 pfam13419, HAD_2, Haloacid dehalogenase-like hydro 3e-04
>gnl|CDD|222115 pfam13419, HAD_2, Haloacid dehalogenase-like hydrolase Back     alignment and domain information
 Score = 39.6 bits (93), Expect = 3e-04
 Identities = 28/135 (20%), Positives = 50/135 (37%), Gaps = 10/135 (7%)

Query: 59  LLFDIMDTIV-RDPFYHDVPAFFGMSMKELIECKHPNAWIEFEMGMISEME----LARKF 113
           ++FD+  T++  DP   +  A   ++ + L      +A    E G +   E    L R+ 
Sbjct: 1   IIFDLDGTLIDFDPVIFE--ALRDLAAERL--GLDISAEELREAGGLPFDEALADLLREH 56

Query: 114 FTDGRPFDLEGLKICMKKGYAYLDGVEELLHELKQSNYEMHAFTNYPIWY-EIIEDKLKI 172
             D        L+  ++        V ELL  LK    ++   +N      E + +KL +
Sbjct: 57  PIDPDEILEALLEYNLESRLEPFPDVVELLRRLKAKGVKLVILSNGSREAVERLLEKLGL 116

Query: 173 STYLSWTFCSCVIGM 187
                  F S  +G 
Sbjct: 117 LDLFDAVFTSDDVGA 131


Length = 176

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 207
PRK09456199 ?-D-glucose-1-phosphatase; Provisional 99.88
PRK09449224 dUMP phosphatase; Provisional 99.87
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 99.83
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 99.83
TIGR01422253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 99.82
PRK14988224 GMP/IMP nucleotidase; Provisional 99.82
TIGR02247211 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li 99.82
PLN02770248 haloacid dehalogenase-like hydrolase family protei 99.82
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 99.81
COG0637221 Predicted phosphatase/phosphohexomutase [General f 99.8
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 99.8
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 99.79
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 99.79
PRK11587218 putative phosphatase; Provisional 99.79
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 99.79
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 99.79
TIGR01990185 bPGM beta-phosphoglucomutase. The enzyme from L. l 99.78
COG1011229 Predicted hydrolase (HAD superfamily) [General fun 99.77
PRK13288214 pyrophosphatase PpaX; Provisional 99.77
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 99.77
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 99.77
PRK10563221 6-phosphogluconate phosphatase; Provisional 99.77
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 99.77
PLN02575381 haloacid dehalogenase-like hydrolase 99.75
PLN02940 382 riboflavin kinase 99.75
PRK13226229 phosphoglycolate phosphatase; Provisional 99.75
KOG3085237 consensus Predicted hydrolase (HAD superfamily) [G 99.73
COG0546220 Gph Predicted phosphatases [General function predi 99.72
PRK13222226 phosphoglycolate phosphatase; Provisional 99.72
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 99.71
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 99.7
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 99.69
PRK10748238 flavin mononucleotide phosphatase; Provisional 99.69
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 99.69
TIGR01493175 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su 99.68
PRK13223272 phosphoglycolate phosphatase; Provisional 99.68
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 99.67
PRK06698459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 99.67
PLN02779286 haloacid dehalogenase-like hydrolase family protei 99.66
TIGR01549154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 99.63
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.62
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 99.59
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 99.56
PHA02597197 30.2 hypothetical protein; Provisional 99.54
PRK13225273 phosphoglycolate phosphatase; Provisional 99.53
KOG2914222 consensus Predicted haloacid-halidohydrolase and r 99.52
PLN02954224 phosphoserine phosphatase 99.51
PRK09552219 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp 99.46
PLN02811220 hydrolase 99.45
TIGR01489188 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent 99.42
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 99.35
TIGR03333214 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl 99.32
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 99.3
PRK11133322 serB phosphoserine phosphatase; Provisional 99.29
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 99.29
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 99.26
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 99.26
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 99.25
PRK13582205 thrH phosphoserine phosphatase; Provisional 99.24
TIGR01691220 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen 99.21
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 99.21
TIGR01488177 HAD-SF-IB Haloacid Dehalogenase superfamily, subfa 99.17
TIGR02137203 HSK-PSP phosphoserine phosphatase/homoserine phosp 99.08
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 99.07
PRK11590211 hypothetical protein; Provisional 99.05
PRK11009237 aphA acid phosphatase/phosphotransferase; Provisio 99.04
KOG3109244 consensus Haloacid dehalogenase-like hydrolase [Ge 98.99
COG0560212 SerB Phosphoserine phosphatase [Amino acid transpo 98.98
PRK06769173 hypothetical protein; Validated 98.93
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 98.92
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 98.92
TIGR01490202 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol 98.91
PRK08238 479 hypothetical protein; Validated 98.87
PF06888234 Put_Phosphatase: Putative Phosphatase; InterPro: I 98.86
TIGR01684301 viral_ppase viral phosphatase. These proteins also 98.68
TIGR01545210 YfhB_g-proteo haloacid dehalogenase superfamily, s 98.66
TIGR01686 320 FkbH FkbH-like domain. The C-terminal portion of t 98.62
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 98.52
PHA02530300 pseT polynucleotide kinase; Provisional 98.44
TIGR01533266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 98.41
PRK05446 354 imidazole glycerol-phosphate dehydratase/histidino 98.31
TIGR01458257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 98.29
KOG3120256 consensus Predicted haloacid dehalogenase-like hyd 98.29
TIGR01452279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 98.28
PF12689169 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 98.28
KOG1615227 consensus Phosphoserine phosphatase [Amino acid tr 98.21
COG4996164 Predicted phosphatase [General function prediction 98.19
TIGR01668170 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph 98.15
TIGR01663 526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 98.14
TIGR01544277 HAD-SF-IE haloacid dehalogenase superfamily, subfa 98.03
TIGR02244343 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd 97.99
PHA03398303 viral phosphatase superfamily protein; Provisional 97.94
PLN02645 311 phosphoglycolate phosphatase 97.92
TIGR01459 242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 97.86
TIGR01456 321 CECR5 HAD-superfamily class IIA hydrolase, TIGR014 97.83
PF12710192 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P 97.82
COG0647 269 NagD Predicted sugar phosphatases of the HAD super 97.8
TIGR01675229 plant-AP plant acid phosphatase. This model explic 97.73
PF06941191 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol 97.7
TIGR01457 249 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr 97.62
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 97.58
PF00702215 Hydrolase: haloacid dehalogenase-like hydrolase; I 97.53
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 97.45
PF03767229 Acid_phosphat_B: HAD superfamily, subfamily IIIB ( 97.38
PTZ00445219 p36-lilke protein; Provisional 97.38
TIGR01680275 Veg_Stor_Prot vegetative storage protein. The prot 97.38
PRK00192 273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 97.32
PRK10513 270 sugar phosphate phosphatase; Provisional 97.32
COG4359220 Uncharacterized conserved protein [Function unknow 97.31
PRK01158230 phosphoglycolate phosphatase; Provisional 97.23
PRK10444248 UMP phosphatase; Provisional 97.2
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 97.18
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 97.18
PRK10530 272 pyridoxal phosphate (PLP) phosphatase; Provisional 97.05
TIGR01487215 SPP-like sucrose-phosphate phosphatase-like hydrol 96.97
TIGR02251162 HIF-SF_euk Dullard-like phosphatase domain. This d 96.93
TIGR02250156 FCP1_euk FCP1-like phosphatase, phosphatase domain 96.88
PRK12702 302 mannosyl-3-phosphoglycerate phosphatase; Reviewed 96.72
COG0561 264 Cof Predicted hydrolases of the HAD superfamily [G 96.66
PRK10976 266 putative hydrolase; Provisional 96.66
PRK15126 272 thiamin pyrimidine pyrophosphate hydrolase; Provis 96.64
PRK03669 271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 96.58
PLN02887 580 hydrolase family protein 96.53
COG0241181 HisB Histidinol phosphatase and related phosphatas 96.43
smart00775157 LNS2 LNS2 domain. This domain is found in Saccharo 96.43
COG4229229 Predicted enolase-phosphatase [Energy production a 96.33
PF08645159 PNK3P: Polynucleotide kinase 3 phosphatase; InterP 96.32
COG2179175 Predicted hydrolase of the HAD superfamily [Genera 95.96
PRK14502 694 bifunctional mannosyl-3-phosphoglycerate synthase/ 95.64
TIGR01525556 ATPase-IB_hvy heavy metal translocating P-type ATP 95.53
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 95.18
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 95.17
TIGR01512536 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo 95.09
PF05761 448 5_nucleotid: 5' nucleotidase family; InterPro: IPR 94.86
TIGR01452 279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 94.78
PLN02499 498 glycerol-3-phosphate acyltransferase 94.78
PLN02177 497 glycerol-3-phosphate acyltransferase 94.69
TIGR01458 257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 94.37
PTZ00174247 phosphomannomutase; Provisional 94.03
COG2503274 Predicted secreted acid phosphatase [General funct 94.0
PF11019252 DUF2608: Protein of unknown function (DUF2608); In 93.71
TIGR01511562 ATPase-IB1_Cu copper-(or silver)-translocating P-t 93.53
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 93.46
PLN02423245 phosphomannomutase 92.99
PRK10444 248 UMP phosphatase; Provisional 92.98
TIGR01522 884 ATPase-IIA2_Ca golgi membrane calcium-translocatin 92.53
TIGR01689126 EcbF-BcbF capsule biosynthesis phosphatase. Due to 92.25
PF05152297 DUF705: Protein of unknown function (DUF705); Inte 92.07
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 91.18
TIGR01460 236 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class 91.17
TIGR01460236 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class 89.74
KOG4549144 consensus Magnesium-dependent phosphatase [General 89.24
PRK10671 834 copA copper exporting ATPase; Provisional 89.06
TIGR01684301 viral_ppase viral phosphatase. These proteins also 88.64
PF03031159 NIF: NLI interacting factor-like phosphatase; Inte 88.39
PF00702215 Hydrolase: haloacid dehalogenase-like hydrolase; I 88.04
KOG2470 510 consensus Similar to IMP-GMP specific 5'-nucleotid 87.98
TIGR01482225 SPP-subfamily Sucrose-phosphate phosphatase subfam 87.79
PF08282 254 Hydrolase_3: haloacid dehalogenase-like hydrolase; 87.61
TIGR02463 221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 87.1
COG5663194 Uncharacterized conserved protein [Function unknow 86.93
TIGR02461225 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat 86.04
PRK11033741 zntA zinc/cadmium/mercury/lead-transporting ATPase 85.17
PF03031159 NIF: NLI interacting factor-like phosphatase; Inte 85.11
PLN02645311 phosphoglycolate phosphatase 85.11
TIGR02461 225 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat 85.03
TIGR00099 256 Cof-subfamily Cof subfamily of IIB subfamily of ha 84.87
PRK06769173 hypothetical protein; Validated 84.73
PF08282 254 Hydrolase_3: haloacid dehalogenase-like hydrolase; 84.61
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 84.41
COG0731 296 Fe-S oxidoreductases [Energy production and conver 84.26
PF08645159 PNK3P: Polynucleotide kinase 3 phosphatase; InterP 84.24
TIGR01457249 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr 82.61
PHA03398303 viral phosphatase superfamily protein; Provisional 82.34
TIGR00099 256 Cof-subfamily Cof subfamily of IIB subfamily of ha 81.76
TIGR01484204 HAD-SF-IIB HAD-superfamily hydrolase, subfamily II 81.61
TIGR01486 256 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph 81.41
TIGR02463221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 81.36
KOG2882 306 consensus p-Nitrophenyl phosphatase [Inorganic ion 80.47
COG1778170 Low specificity phosphatase (HAD superfamily) [Gen 80.25
COG2179175 Predicted hydrolase of the HAD superfamily [Genera 80.02
>PRK09456 ?-D-glucose-1-phosphatase; Provisional Back     alignment and domain information
Probab=99.88  E-value=1.6e-21  Score=159.97  Aligned_cols=146  Identities=15%  Similarity=0.157  Sum_probs=111.5

Q ss_pred             CeEEEEcCCcccCCChhchH---HHHHcCCHHHHHHhhC-chHHHHHHhCCCCHHHHHHHHhhc-CCCCCHHHHHHHHHh
Q 028576           57 PILLFDIMDTIVRDPFYHDV---PAFFGMSMKELIECKH-PNAWIEFEMGMISEMELARKFFTD-GRPFDLEGLKICMKK  131 (207)
Q Consensus        57 ~~IlFDLDGTLvD~~~~~~l---~~~~g~~~~~~~~~~~-~~~w~~~e~G~Is~~e~~~~~~~~-g~~~~~~~l~~~~~~  131 (207)
                      .+||||+||||+|.+....+   ....+....++...+. ...|.+++.|.++..++++.+.+. +.+.+.+++...+..
T Consensus         1 ~~viFDldgvL~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (199)
T PRK09456          1 MLYIFDLGNVIVDIDFNRVLGVWSDLSRVPLATLKKRFTMGEAFHQHERGEISDEAFAEALCHEMALSLSYEQFAHGWQA   80 (199)
T ss_pred             CEEEEeCCCccccCcHHHHHHHHHHhcCCCHHHHHHHHhcCcHHHHHhcCCCCHHHHHHHHHHHhCCCCCHHHHHHHHHH
Confidence            37999999999996544433   3234556666655443 357999999999999998887765 555555666555543


Q ss_pred             c-CCcchhHHHHHHHHhHCCCeEEEEcCcHHHH-HHHHHh-CCcccccCeEEEccccCCCCCChHHHHHhhhhh
Q 028576          132 G-YAYLDGVEELLHELKQSNYEMHAFTNYPIWY-EIIEDK-LKISTYLSWTFCSCVIGMFSKQCLKERGNLILI  202 (207)
Q Consensus       132 ~-~~~~pgv~elL~~Lk~~G~kl~IlTN~~~~~-~~il~~-~~l~~yFD~v~~S~evg~~KPdPeiy~~~~~~~  202 (207)
                      . ..++||+.++|+.|+++|++++|+||++... +..+.. .++..+||.+++|++++..||+|++|+.++...
T Consensus        81 ~~~~~~~g~~e~L~~l~~~g~~~~i~Sn~~~~~~~~~~~~~~~l~~~fd~v~~s~~~~~~KP~p~~~~~~~~~~  154 (199)
T PRK09456         81 VFVALRPEVIAIMHKLREQGHRVVVLSNTNRLHTTFWPEEYPEVRAAADHIYLSQDLGMRKPEARIYQHVLQAE  154 (199)
T ss_pred             HHhccCHHHHHHHHHHHhCCCcEEEEcCCchhhHHHHHhhchhHHHhcCEEEEecccCCCCCCHHHHHHHHHHc
Confidence            2 3689999999999999999999999997543 333333 478899999999999999999999999998764



>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase Back     alignment and domain information
>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>PLN02940 riboflavin kinase Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only] Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed Back     alignment and domain information
>PLN02811 hydrolase Back     alignment and domain information
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>PRK11590 hypothetical protein; Provisional Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information
>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase Back     alignment and domain information
>TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>COG4996 Predicted phosphatase [General function prediction only] Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 Back     alignment and domain information
>TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase Back     alignment and domain information
>PHA03398 viral phosphatase superfamily protein; Provisional Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 Back     alignment and domain information
>PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B Back     alignment and domain information
>COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01675 plant-AP plant acid phosphatase Back     alignment and domain information
>PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins Back     alignment and domain information
>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) Back     alignment and domain information
>PTZ00445 p36-lilke protein; Provisional Back     alignment and domain information
>TIGR01680 Veg_Stor_Prot vegetative storage protein Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>COG4359 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain Back     alignment and domain information
>TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain Back     alignment and domain information
>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PLN02887 hydrolase family protein Back     alignment and domain information
>COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] Back     alignment and domain information
>smart00775 LNS2 LNS2 domain Back     alignment and domain information
>COG4229 Predicted enolase-phosphatase [Energy production and conversion] Back     alignment and domain information
>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional Back     alignment and domain information
>TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase Back     alignment and domain information
>PF05761 5_nucleotid: 5' nucleotidase family; InterPro: IPR008380 This family includes a 5'-nucleotidase, 3 Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>PLN02499 glycerol-3-phosphate acyltransferase Back     alignment and domain information
>PLN02177 glycerol-3-phosphate acyltransferase Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>COG2503 Predicted secreted acid phosphatase [General function prediction only] Back     alignment and domain information
>PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria Back     alignment and domain information
>TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>PLN02423 phosphomannomutase Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase Back     alignment and domain information
>TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase Back     alignment and domain information
>PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information
>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information
>KOG4549 consensus Magnesium-dependent phosphatase [General function prediction only] Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase Back     alignment and domain information
>PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear Back     alignment and domain information
>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) Back     alignment and domain information
>KOG2470 consensus Similar to IMP-GMP specific 5'-nucleotidase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>COG5663 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>COG0731 Fe-S oxidoreductases [Energy production and conversion] Back     alignment and domain information
>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] Back     alignment and domain information
>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>PHA03398 viral phosphatase superfamily protein; Provisional Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>KOG2882 consensus p-Nitrophenyl phosphatase [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query207
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 2e-20
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 6e-16
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 5e-13
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 2e-07
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 1e-05
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 5e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Length = 200 Back     alignment and structure
 Score = 83.6 bits (207), Expect = 2e-20
 Identities = 31/135 (22%), Positives = 52/135 (38%), Gaps = 8/135 (5%)

Query: 59  LLFDIMDTIVRDPF----YHDVPAFFGMSMKELIECKHPNAWIEFEMGMISEMELARKF- 113
           L +DI   ++ + +      DV   FG+   +  E  H  A  E E+G ++  E   +  
Sbjct: 7   LFWDIGGVLLTNGWDREQRADVAQRFGLDTDDFTER-HRLAAPELELGRMTLAEYLEQVV 65

Query: 114 FTDGRPFDLEGLKICMKKGYAYLDGVEELLHELKQSNYEMHAFTNYP-IWYEIIEDKLKI 172
           F   R F  E  +  M++       V  L  +L Q  Y M++  N      E       +
Sbjct: 66  FYQPRDFTPEDFRAVMEEQSQPRPEVLALARDLGQ-RYRMYSLNNEGRDLNEYRIRTFGL 124

Query: 173 STYLSWTFCSCVIGM 187
             +L   F S  +G+
Sbjct: 125 GEFLLAFFTSSALGV 139


>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Length = 206 Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Length = 211 Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Length = 229 Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Length = 137 Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Length = 235 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query207
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 99.85
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 99.83
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 99.83
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 99.82
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 99.81
2zg6_A220 Putative uncharacterized protein ST2620, probable 99.8
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 99.8
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 99.77
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 99.77
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 99.76
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 99.75
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 99.74
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 99.74
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 99.74
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 99.74
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 99.73
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 99.73
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 99.72
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 99.72
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 99.72
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 99.72
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 99.71
2hsz_A243 Novel predicted phosphatase; structural genomics, 99.71
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 99.71
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 99.71
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 99.71
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 99.71
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 99.7
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 99.7
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 99.7
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 99.69
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 99.69
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 99.69
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 99.69
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 99.69
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 99.68
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 99.67
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 99.67
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 99.66
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 99.66
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 99.65
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 99.64
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 99.64
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 99.64
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 99.63
3umc_A254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 99.63
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 99.62
3sd7_A240 Putative phosphatase; structural genomics, haloaci 99.61
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 99.6
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 99.59
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 99.59
3fvv_A232 Uncharacterized protein; unknown function, structu 99.59
3ib6_A189 Uncharacterized protein; structural genomics, unkn 99.59
3umg_A254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 99.59
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 99.58
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 99.58
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 99.57
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 99.57
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 99.57
1te2_A226 Putative phosphatase; structural genomics, phospha 99.56
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 99.56
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 99.56
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 99.54
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 99.53
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 99.52
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 99.51
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 99.51
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 99.47
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 99.47
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 99.46
2p11_A231 Hypothetical protein; putative haloacid dehalogena 99.42
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 99.42
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 99.38
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 99.34
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, s 99.33
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 99.33
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 99.3
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 99.3
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 99.2
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypotheti 99.12
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 99.08
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 99.08
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 99.08
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 99.06
2ho4_A259 Haloacid dehalogenase-like hydrolase domain contai 99.05
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 99.01
2i33_A258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 98.99
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 98.98
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 98.97
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 98.96
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 98.94
2hx1_A284 Predicted sugar phosphatases of the HAD superfamil 98.89
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 98.89
3mmz_A176 Putative HAD family hydrolase; structural genomics 98.88
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 98.87
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 98.86
3mn1_A189 Probable YRBI family phosphatase; structural genom 98.82
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 98.82
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 98.8
2oyc_A306 PLP phosphatase, pyridoxal phosphate phosphatase; 98.73
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 98.72
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 98.68
2o2x_A218 Hypothetical protein; structural genomics, joint c 98.68
3ocu_A262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 98.65
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genom 98.62
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 98.61
3pct_A260 Class C acid phosphatase; hydrolase, outer membran 98.61
3gyg_A289 NTD biosynthesis operon putative hydrolase NTDB; P 98.6
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 98.54
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 98.37
2yj3_A263 Copper-transporting ATPase; hydrolase, P-type ATPa 97.72
3qgm_A 268 P-nitrophenyl phosphatase (PHO2); structural genom 98.35
1y8a_A 332 Hypothetical protein AF1437; structural genomics, 98.14
3pdw_A 266 Uncharacterized hydrolase YUTF; structural genomic 98.09
3epr_A 264 Hydrolase, haloacid dehalogenase-like family; stru 98.04
4dw8_A 279 Haloacid dehalogenase-like hydrolase; HAD, putativ 97.99
4as2_A 327 Phosphorylcholine phosphatase; hydrolase, HAD supe 97.93
3mpo_A 279 Predicted hydrolase of the HAD superfamily; SGX, P 97.91
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 97.87
3kc2_A 352 Uncharacterized protein YKR070W; HAD-like, mitocho 97.75
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 97.7
2obb_A142 Hypothetical protein; structural genomics, PSI-2, 97.63
3dnp_A 290 Stress response protein YHAX; structural PSI-2, pr 97.59
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 97.51
1xpj_A126 Hypothetical protein; structural genomics, MCSG, p 97.46
3f9r_A 246 Phosphomannomutase; trypanosome glycobiology struc 97.45
3dao_A 283 Putative phosphatse; structural genomics, joint ce 97.29
3pgv_A 285 Haloacid dehalogenase-like hydrolase; structural g 97.29
1xvi_A 275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 97.23
1rkq_A 282 Hypothetical protein YIDA; two domain structure wi 97.16
3ef0_A 372 RNA polymerase II subunit A C-terminal domain phos 97.14
2b30_A 301 Pvivax hypothetical protein; SGPP, structural geno 97.1
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 97.04
3r4c_A 268 Hydrolase, haloacid dehalogenase-like hydrolase; h 97.02
1l6r_A 227 Hypothetical protein TA0175; structural genomics, 96.91
4fe3_A297 Cytosolic 5'-nucleotidase 3; substrate complex, HA 96.86
1nrw_A 288 Hypothetical protein, haloacid dehalogenase-like h 96.81
2jc9_A 555 Cytosolic purine 5'-nucleotidase; cytosolic 5-prim 96.01
3l7y_A 304 Putative uncharacterized protein SMU.1108C; hydrol 95.88
2pq0_A 258 Hypothetical conserved protein GK1056; hyopthetica 95.54
4gxt_A385 A conserved functionally unknown protein; structur 95.4
3fzq_A 274 Putative hydrolase; YP_001086940.1, putative haloa 95.02
1rlm_A271 Phosphatase; HAD family, rossman fold, hydrolase; 94.91
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 94.76
4g63_A 470 Cytosolic IMP-GMP specific 5'-nucleotidase; struct 94.52
2hx1_A 284 Predicted sugar phosphatases of the HAD superfamil 93.52
2rbk_A 261 Putative uncharacterized protein; HAD-like phospha 93.32
1nf2_A 268 Phosphatase; structural proteomics, HAD NEW fold, 93.0
3qle_A204 TIM50P; chaperone, mitochondrion, preprotein trans 92.72
3zx4_A 259 MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd 92.61
2fue_A262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 92.45
1s2o_A244 SPP, sucrose-phosphatase; phosphohydrolase, HAD su 90.92
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 90.87
2zos_A249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 89.42
1zjj_A 263 Hypothetical protein PH1952; alpha/beta hydrolase 88.9
2oyc_A 306 PLP phosphatase, pyridoxal phosphate phosphatase; 86.28
1qyi_A 384 ZR25, hypothetical protein; structural genomics, P 86.24
3j08_A 645 COPA, copper-exporting P-type ATPase A; copper tra 85.46
3epr_A264 Hydrolase, haloacid dehalogenase-like family; stru 84.12
1vjr_A 271 4-nitrophenylphosphatase; TM1742, structural genom 83.59
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 81.81
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
Probab=99.85  E-value=7.8e-21  Score=153.03  Aligned_cols=138  Identities=15%  Similarity=0.107  Sum_probs=93.7

Q ss_pred             CCeEEEEcCCcccCC-C-hhchHHHHH---cCCHHHHHHhhCchHHHHHHhCCCCHHHHHHHHhhc-CCCCCHHHHHH--
Q 028576           56 LPILLFDIMDTIVRD-P-FYHDVPAFF---GMSMKELIECKHPNAWIEFEMGMISEMELARKFFTD-GRPFDLEGLKI--  127 (207)
Q Consensus        56 ~~~IlFDLDGTLvD~-~-~~~~l~~~~---g~~~~~~~~~~~~~~w~~~e~G~Is~~e~~~~~~~~-g~~~~~~~l~~--  127 (207)
                      +|+||||+||||+|+ + +..++.+++   |.+.       ....+ ....| .+..+.++...+. ......+.+.+  
T Consensus         1 IkAViFD~DGTL~ds~~~~~~a~~~~~~~~g~~~-------~~~~~-~~~~g-~~~~~~~~~~~~~~~~~~~~~~~~~~~   71 (216)
T 3kbb_A            1 MEAVIFDMDGVLMDTEPLYFEAYRRVAESYGKPY-------TEDLH-RRIMG-VPEREGLPILMEALEIKDSLENFKKRV   71 (216)
T ss_dssp             CCEEEEESBTTTBCCGGGHHHHHHHHHHHTTCCC-------CHHHH-HHHTT-SCHHHHHHHHHHHTTCCSCHHHHHHHH
T ss_pred             CeEEEECCCCcccCCHHHHHHHHHHHHHHcCCCC-------CHHHH-HHHhc-cchhhhhhhhhhcccchhhHHHHHHHH
Confidence            579999999999994 2 223344443   3321       00111 11123 2333444433332 22233333322  


Q ss_pred             ------HHHhcCCcchhHHHHHHHHhHCCCeEEEEcCcHHH-HHHHHHhCCcccccCeEEEccccCCCCCChHHHHHhhh
Q 028576          128 ------CMKKGYAYLDGVEELLHELKQSNYEMHAFTNYPIW-YEIIEDKLKISTYLSWTFCSCVIGMFSKQCLKERGNLI  200 (207)
Q Consensus       128 ------~~~~~~~~~pgv~elL~~Lk~~G~kl~IlTN~~~~-~~~il~~~~l~~yFD~v~~S~evg~~KPdPeiy~~~~~  200 (207)
                            .+.....++||+.++|+.|+++|++++++||++.. ....++.+++.+|||.+++|++++..||+|++|+.|+.
T Consensus        72 ~~~~~~~~~~~~~~~pg~~~~l~~L~~~g~~~~i~tn~~~~~~~~~l~~~~l~~~fd~~~~~~~~~~~KP~p~~~~~a~~  151 (216)
T 3kbb_A           72 HEEKKRVFSELLKENPGVREALEFVKSKRIKLALATSTPQREALERLRRLDLEKYFDVMVFGDQVKNGKPDPEIYLLVLE  151 (216)
T ss_dssp             HHHHHHHHHHHCCBCTTHHHHHHHHHHTTCEEEEECSSCHHHHHHHHHHTTCGGGCSEEECGGGSSSCTTSTHHHHHHHH
T ss_pred             HHHHHHHHHHhcccCccHHHHHHHHHHcCCCcccccCCcHHHHHHHHHhcCCCccccccccccccCCCcccHHHHHHHHH
Confidence                  22344678999999999999999999999999754 55577999999999999999999999999999999987


Q ss_pred             hh
Q 028576          201 LI  202 (207)
Q Consensus       201 ~~  202 (207)
                      ..
T Consensus       152 ~l  153 (216)
T 3kbb_A          152 RL  153 (216)
T ss_dssp             HH
T ss_pred             hh
Confidence            64



>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Back     alignment and structure
>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Back     alignment and structure
>1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Back     alignment and structure
>4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>2jc9_A Cytosolic purine 5'-nucleotidase; cytosolic 5-prime nucleotidase II, GMP-IMP specific nucleotidase, CN-II, NT5C2, hydrolase, polymorphism; HET: ADN; 1.5A {Homo sapiens} PDB: 2j2c_A* 2xje_A* 2xjf_A* 2jcm_A* 2xcw_A* 2xcv_A* 2xcx_A 2xjb_A* 2xjc_A* 2xjd_A* Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>4g63_A Cytosolic IMP-GMP specific 5'-nucleotidase; structural genomics, PSI-biology, northeast structural genom consortium, NESG; 2.70A {Legionella pneumophila subsp} PDB: 2bde_A Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Back     alignment and structure
>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Back     alignment and structure
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Back     alignment and structure
>3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query207
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 99.84
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 99.82
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 99.82
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 99.8
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 99.79
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 99.78
d1swva_257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 99.78
d1o08a_221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 99.78
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 99.77
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 99.76
d1zd3a1225 Epoxide hydrolase, N-terminal domain {Human (Homo 99.75
d2b0ca1197 Putative phosphatase YihX {Escherichia coli [TaxId 99.73
d1qq5a_245 L-2-Haloacid dehalogenase, HAD {Xanthobacter autot 99.71
d1cr6a1222 Epoxide hydrolase, N-terminal domain {Mouse (Mus m 99.69
d2fdra1222 Hypothetical protein Atu0790 {Agrobacterium tumefa 99.63
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 99.59
d1zs9a1253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 99.59
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 99.59
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 99.34
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 99.33
d1nnla_217 Phosphoserine phosphatase {Human (Homo sapiens) [T 99.33
d2g80a1225 Protein UTR4 {Baker's yeast (Saccharomyces cerevis 99.26
d2fpwa1161 Histidine biosynthesis bifunctional protein HisB, 99.09
d2gmwa1182 D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc 98.89
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 98.79
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 98.77
d1qyia_380 Hypothetical protein MW1667 (SA1546) {Staphylococc 98.51
d2o2xa1209 Hypothetical protein Mll2559 {Mesorhizobium loti [ 98.29
d2c4na1 250 NagD {Escherichia coli [TaxId: 562]} 98.16
d1wvia_253 Putative phosphatase SMU.1415c {Streptococcus muta 98.03
d1rkua_206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 98.0
d1vjra_ 261 Hypothetical protein TM1742 {Thermotoga maritima [ 97.95
d1rkqa_ 271 Hypothetical protein YidA {Escherichia coli [TaxId 97.82
d1yv9a1 253 Putative hydrolase EF1188 {Enterococcus faecalis [ 97.69
d2bdua1291 Cytosolic 5'-nucleotidase III {Mouse (Mus musculus 97.51
d1xpja_124 Hypothetical protein VC0232 {Vibrio cholerae [TaxI 97.34
d1q92a_195 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo 97.31
d2b82a1209 Class B acid phosphatase, AphA {Escherichia coli [ 97.3
d1wr8a_230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 97.27
d1nrwa_ 285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 97.23
d1yj5a1195 5' polynucleotide kinase-3' phosphatase, middle do 96.78
d1xvia_ 232 Putative mannosyl-3-phosphoglycerate phosphatase M 96.63
d1l6ra_225 Phosphoglycolate phosphatase, PGPase {Archaeon The 96.48
d1rlma_ 269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 96.43
d2amya1243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 94.6
d2b30a1 283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 93.68
d2bdea1 458 Cytosolic IMP-GMP specific 5'-nucleotidase {Legion 93.58
d2fuea1244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 93.28
d1nf2a_ 267 Hypothetical protein TM0651 {Thermotoga maritima [ 93.04
d2rbka1 260 Sugar-phosphate phosphatase BT4131 {Bacteroides th 92.74
d1wzca1243 Putative mannosyl-3-phosphoglycerate phosphatase M 92.0
d2b8ea1135 Cation-transporting ATPase {Archaeon Archaeoglobus 91.84
d1u02a_229 Trehalose-6-phosphate phosphatase related protein 91.6
d1s2oa1244 Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 91.39
d2obba1122 Hypothetical protein BT0820 {Bacteroides thetaiota 90.97
d2o2xa1209 Hypothetical protein Mll2559 {Mesorhizobium loti [ 89.84
d1qyia_ 380 Hypothetical protein MW1667 (SA1546) {Staphylococc 88.75
d1k1ea_177 Probable phosphatase YrbI {Haemophilus influenzae, 87.08
d1wvia_ 253 Putative phosphatase SMU.1415c {Streptococcus muta 86.43
d1wpga2168 Calcium ATPase, catalytic domain P {Rabbit (Orycto 82.88
d2obba1122 Hypothetical protein BT0820 {Bacteroides thetaiota 82.6
d1ta0a_181 Carboxy-terminal domain RNA polymerase II polypept 80.62
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Phosphonoacetaldehyde hydrolase-like
domain: Putative hydrolase SP0805
species: Streptococcus pneumoniae [TaxId: 1313]
Probab=99.84  E-value=2.8e-21  Score=152.47  Aligned_cols=137  Identities=13%  Similarity=0.022  Sum_probs=92.2

Q ss_pred             CCCCeEEEEcCCcccCC--ChhchHHHHH---cCC--HHHHHHhhCchHHHHHHhCCCCHHHHHHHHhhcCCCCCHHHHH
Q 028576           54 RKLPILLFDIMDTIVRD--PFYHDVPAFF---GMS--MKELIECKHPNAWIEFEMGMISEMELARKFFTDGRPFDLEGLK  126 (207)
Q Consensus        54 ~~~~~IlFDLDGTLvD~--~~~~~l~~~~---g~~--~~~~~~~~~~~~w~~~e~G~Is~~e~~~~~~~~g~~~~~~~l~  126 (207)
                      |+|++||||+||||+|+  ....++.+.+   |.+  .++....        .  | .+....++.+... .+.-.+.+.
T Consensus         1 M~~k~viFD~DGTL~dt~~~~~~~~~~~~~~~g~~~~~~~~~~~--------~--~-~~~~~~~~~~~~~-~~~~~~~~~   68 (187)
T d2fi1a1           1 MKYHDYIWDLGGTLLDNYETSTAAFVETLALYGITQDHDSVYQA--------L--K-VSTPFAIETFAPN-LENFLEKYK   68 (187)
T ss_dssp             CCCSEEEECTBTTTBCHHHHHHHHHHHHHHHTTCCCCHHHHHHH--------H--H-HCHHHHHHHHCTT-CTTHHHHHH
T ss_pred             CCCCEEEEeCCCCcccCHHHHHHHHHHHHHHcCCCccHHHHHhh--------h--h-ccchhhhhhhhHH-HHHHHHHHH
Confidence            78999999999999992  2233344433   332  2222111        1  1 1122222333221 111122222


Q ss_pred             HHH---HhcCCcchhHHHHHHHHhHCCCeEEEEcCcHHHHHHHHHhCCcccccCeEEEccccCCCCCChHHHHHhhhhh
Q 028576          127 ICM---KKGYAYLDGVEELLHELKQSNYEMHAFTNYPIWYEIIEDKLKISTYLSWTFCSCVIGMFSKQCLKERGNLILI  202 (207)
Q Consensus       127 ~~~---~~~~~~~pgv~elL~~Lk~~G~kl~IlTN~~~~~~~il~~~~l~~yFD~v~~S~evg~~KPdPeiy~~~~~~~  202 (207)
                      +..   .....++||+.++|++|+++|++++|+||++......++++++.++||.+++|++++..||+|++|+.++.-.
T Consensus        69 ~~~~~~~~~~~~~~gv~~~l~~l~~~g~~~~i~Sn~~~~~~~~l~~~~l~~~fd~i~~~~~~~~~KP~p~~~~~~~~~~  147 (187)
T d2fi1a1          69 ENEARELEHPILFEGVSDLLEDISNQGGRHFLVSHRNDQVLEILEKTSIAAYFTEVVTSSSGFKRKPNPESMLYLREKY  147 (187)
T ss_dssp             HHHHHHTTSCCBCTTHHHHHHHHHHTTCEEEEECSSCTHHHHHHHHTTCGGGEEEEECGGGCCCCTTSCHHHHHHHHHT
T ss_pred             HHHHHHhhcCcccchhHHHHHHHHhhhccccccccCccchhhhhhhhccccccccccccccccccCCCHHHHHHHHHHc
Confidence            221   2345688999999999999999999999987665566789999999999999999999999999999998743



>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d2bdea1 c.108.1.23 (A:2-459) Cytosolic IMP-GMP specific 5'-nucleotidase {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure