BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 028583
         (207 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2D5D|A Chain A, Structure Of Biotin Carboxyl Carrier Protein (74val Start)
           From Pyrococcus Horikoshi Ot3 Ligand Free Form Ii
 pdb|2D5D|B Chain B, Structure Of Biotin Carboxyl Carrier Protein (74val Start)
           From Pyrococcus Horikoshi Ot3 Ligand Free Form Ii
 pdb|2EVB|A Chain A, Structure Of Biotin Carboxyl Carrier Protein (74val Start)
           From Pyrococcus Horikoshi Ot3 Ligand Free Form I
 pdb|2EJF|C Chain C, Crystal Structure Of The Biotin Protein Ligase (Mutations
           R48a And K111a) And Biotin Carboxyl Carrier Protein
           Complex From Pyrococcus Horikoshii Ot3
 pdb|2EJF|D Chain D, Crystal Structure Of The Biotin Protein Ligase (Mutations
           R48a And K111a) And Biotin Carboxyl Carrier Protein
           Complex From Pyrococcus Horikoshii Ot3
 pdb|2EJG|C Chain C, Crystal Structure Of The Biotin Protein Ligase (Mutation
           R48a) And Biotin Carboxyl Carrier Protein Complex From
           Pyrococcus Horikoshii Ot3
 pdb|2EJG|D Chain D, Crystal Structure Of The Biotin Protein Ligase (Mutation
           R48a) And Biotin Carboxyl Carrier Protein Complex From
           Pyrococcus Horikoshii Ot3
          Length = 74

 Score = 28.1 bits (61), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 140 GEASFVL-SNKNEEEIPQEREGMQRRLPTKEKEELREGR 177
           G+   VL + K E EIP  R+G+ +R+  KE E +  G+
Sbjct: 30  GQGLLVLEAMKMENEIPSPRDGVVKRILVKEGEAVDTGQ 68


>pdb|2FUG|3 Chain 3, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus
 pdb|2FUG|C Chain C, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus
 pdb|2FUG|L Chain L, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus
 pdb|2FUG|U Chain U, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus
 pdb|3I9V|3 Chain 3, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus, Oxidized, 2 MolASU
 pdb|3I9V|C Chain C, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus, Oxidized, 2 MolASU
 pdb|3IAM|3 Chain 3, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus, Reduced, 2 MolASU,
           WITH BOUND NADH
 pdb|3IAM|C Chain C, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus, Reduced, 2 MolASU,
           WITH BOUND NADH
 pdb|3IAS|3 Chain 3, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus, Oxidized, 4 MolASU,
           RE-Refined To 3.15 Angstrom Resolution
 pdb|3IAS|C Chain C, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus, Oxidized, 4 MolASU,
           RE-Refined To 3.15 Angstrom Resolution
 pdb|3IAS|L Chain L, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus, Oxidized, 4 MolASU,
           RE-Refined To 3.15 Angstrom Resolution
 pdb|3IAS|U Chain U, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus, Oxidized, 4 MolASU,
           RE-Refined To 3.15 Angstrom Resolution
 pdb|3M9S|3 Chain 3, Crystal Structure Of Respiratory Complex I From Thermus
           Thermophilus
 pdb|3M9S|C Chain C, Crystal Structure Of Respiratory Complex I From Thermus
           Thermophilus
 pdb|2YBB|3 Chain 3, Fitted Model For Bovine  Mitochondrial Supercomplex
           I1iii2iv1 By Single Particle Cryo-Em (Emd-1876)
 pdb|4HEA|3 Chain 3, Crystal Structure Of The Entire Respiratory Complex I From
           Thermus Thermophilus
 pdb|4HEA|D Chain D, Crystal Structure Of The Entire Respiratory Complex I From
           Thermus Thermophilus
          Length = 783

 Score = 26.9 bits (58), Expect = 7.1,   Method: Composition-based stats.
 Identities = 34/126 (26%), Positives = 55/126 (43%), Gaps = 5/126 (3%)

Query: 81  EVQTYVIN-SARVLFLNERPQPKGPVGKGVSHLCEICGRSL--LDPFRFCSLGCKLEGIK 137
           E + +++N   RVL L+  P   G   +G   +  +   +L    PFR      K    +
Sbjct: 609 EKRGHLVNLEGRVLPLSPAPIENGE-AEGALQVLALLAEALGVRPPFRLHLEAQKALKAR 667

Query: 138 KNGEASFVLSNKNEEEIPQEREGMQRRLPTKEKEELREGRQQDMHRSTPPPTHSNSRRRK 197
           K  EA   LS + +E  P+ER+G     PT  K     G+ Q+  R+     H  + R +
Sbjct: 668 KVPEAMGRLSFRLKELRPKERKGAFYLRPTMWKAHQAVGKAQEAARAE-LWAHPETARAE 726

Query: 198 GIPQRA 203
            +P+ A
Sbjct: 727 ALPEGA 732


>pdb|1GM5|A Chain A, Structure Of Recg Bound To Three-Way Dna Junction
          Length = 780

 Score = 26.9 bits (58), Expect = 7.6,   Method: Composition-based stats.
 Identities = 15/61 (24%), Positives = 26/61 (42%)

Query: 48  SSRHKDHPVIQIRRSSYHDVVRVAEIQKALDISEVQTYVINSARVLFLNERPQPKGPVGK 107
           S   KD  +++     Y  +V    I+  +D+      VI +     L +  Q +G VG+
Sbjct: 624 SQEEKDRVMLEFAEGRYDILVSTTVIEVGIDVPRANVMVIENPERFGLAQLHQLRGRVGR 683

Query: 108 G 108
           G
Sbjct: 684 G 684


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.136    0.424 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,083,507
Number of Sequences: 62578
Number of extensions: 233738
Number of successful extensions: 404
Number of sequences better than 100.0: 15
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 12
Number of HSP's that attempted gapping in prelim test: 401
Number of HSP's gapped (non-prelim): 15
length of query: 207
length of database: 14,973,337
effective HSP length: 94
effective length of query: 113
effective length of database: 9,091,005
effective search space: 1027283565
effective search space used: 1027283565
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 49 (23.5 bits)