BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 028590
(207 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q09MC9|NU5C_CITSI NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic OS=Citrus
sinensis GN=ndhF PE=3 SV=1
Length = 743
Score = 30.8 bits (68), Expect = 7.0, Method: Compositional matrix adjust.
Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 3/69 (4%)
Query: 18 KTLFFLITMLVSLLLFSAPVLLAIADTLLPSALLSASLSPSSLSLSTLSSHFNDYDFRYS 77
T+ F++ +LV LF + + + ++ S +LS L+PS L S+HF D+ Y
Sbjct: 544 NTILFVMLVLVLFPLFVGAIGIPLNQEVIESDILSKLLTPSINLLQQNSTHFVDW---YE 600
Query: 78 LVDIPLISI 86
+V P +S+
Sbjct: 601 VVKNPTLSV 609
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.328 0.140 0.405
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 67,216,435
Number of Sequences: 539616
Number of extensions: 2386975
Number of successful extensions: 7893
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 7891
Number of HSP's gapped (non-prelim): 6
length of query: 207
length of database: 191,569,459
effective HSP length: 112
effective length of query: 95
effective length of database: 131,132,467
effective search space: 12457584365
effective search space used: 12457584365
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 58 (26.9 bits)