BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 028606
         (206 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3QFU|A Chain A, Crystal Structure Of Yeast Hsp70 (BipKAR2) COMPLEXED WITH
           ADP
          Length = 394

 Score = 26.9 bits (58), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 5/59 (8%)

Query: 5   FDLQAS---TYVGG-DFDALKVTKSILKSIATDQPVDDNDLNLLQGKLKKQFSGKKFLL 59
           F++QA+   T++GG DFD  K+ + ++K+      +D +D N    KLK++    K  L
Sbjct: 230 FEVQATSGDTHLGGEDFD-YKIVRQLIKAFKKKHGIDVSDNNKALAKLKREAEKAKRAL 287


>pdb|3QFP|A Chain A, Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE DOMAIN
 pdb|3QML|A Chain A, The Structural Analysis Of Sil1-Bip Complex Reveals The
           Mechanism For Sil1 To Function As A Novel Nucleotide
           Exchange Factor
 pdb|3QML|B Chain B, The Structural Analysis Of Sil1-Bip Complex Reveals The
           Mechanism For Sil1 To Function As A Novel Nucleotide
           Exchange Factor
          Length = 390

 Score = 26.6 bits (57), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 5/59 (8%)

Query: 5   FDLQAS---TYVGG-DFDALKVTKSILKSIATDQPVDDNDLNLLQGKLKKQFSGKKFLL 59
           F++QA+   T++GG DFD  K+ + ++K+      +D +D N    KLK++    K  L
Sbjct: 226 FEVQATSGDTHLGGEDFD-YKIVRQLIKAFKKKHGIDVSDNNKALAKLKREAEKAKRAL 283


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.137    0.411 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,127,988
Number of Sequences: 62578
Number of extensions: 235384
Number of successful extensions: 531
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 531
Number of HSP's gapped (non-prelim): 2
length of query: 206
length of database: 14,973,337
effective HSP length: 94
effective length of query: 112
effective length of database: 9,091,005
effective search space: 1018192560
effective search space used: 1018192560
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)