BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 028606
(206 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3QFU|A Chain A, Crystal Structure Of Yeast Hsp70 (BipKAR2) COMPLEXED WITH
ADP
Length = 394
Score = 26.9 bits (58), Expect = 8.5, Method: Compositional matrix adjust.
Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 5/59 (8%)
Query: 5 FDLQAS---TYVGG-DFDALKVTKSILKSIATDQPVDDNDLNLLQGKLKKQFSGKKFLL 59
F++QA+ T++GG DFD K+ + ++K+ +D +D N KLK++ K L
Sbjct: 230 FEVQATSGDTHLGGEDFD-YKIVRQLIKAFKKKHGIDVSDNNKALAKLKREAEKAKRAL 287
>pdb|3QFP|A Chain A, Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE DOMAIN
pdb|3QML|A Chain A, The Structural Analysis Of Sil1-Bip Complex Reveals The
Mechanism For Sil1 To Function As A Novel Nucleotide
Exchange Factor
pdb|3QML|B Chain B, The Structural Analysis Of Sil1-Bip Complex Reveals The
Mechanism For Sil1 To Function As A Novel Nucleotide
Exchange Factor
Length = 390
Score = 26.6 bits (57), Expect = 9.2, Method: Compositional matrix adjust.
Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 5/59 (8%)
Query: 5 FDLQAS---TYVGG-DFDALKVTKSILKSIATDQPVDDNDLNLLQGKLKKQFSGKKFLL 59
F++QA+ T++GG DFD K+ + ++K+ +D +D N KLK++ K L
Sbjct: 226 FEVQATSGDTHLGGEDFD-YKIVRQLIKAFKKKHGIDVSDNNKALAKLKREAEKAKRAL 283
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.321 0.137 0.411
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,127,988
Number of Sequences: 62578
Number of extensions: 235384
Number of successful extensions: 531
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 531
Number of HSP's gapped (non-prelim): 2
length of query: 206
length of database: 14,973,337
effective HSP length: 94
effective length of query: 112
effective length of database: 9,091,005
effective search space: 1018192560
effective search space used: 1018192560
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)