BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 028611
         (206 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2PK9|B Chain B, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The
           Phosphate-responsive Signal Transduction Pathway
 pdb|2PK9|D Chain D, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The
           Phosphate-responsive Signal Transduction Pathway
 pdb|2PMI|B Chain B, Structure Of The Pho85-Pho80 Cdk-Cyclin Complex Of The
           Phosphate- Responsive Signal Transduction Pathway With
           Bound Atp-Gamma-S
 pdb|2PMI|D Chain D, Structure Of The Pho85-Pho80 Cdk-Cyclin Complex Of The
           Phosphate- Responsive Signal Transduction Pathway With
           Bound Atp-Gamma-S
          Length = 293

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 68/125 (54%), Gaps = 3/125 (2%)

Query: 39  ISVFHGLTRPSISIQSYLERIFKYANCSPSCFIVAYVYLDRFVQRQPSLPINSFNVHRLL 98
           ++ +H    P+ISI +Y  R+ K+++      + +  Y+D      P   +NS   HR L
Sbjct: 64  LTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAHRFL 123

Query: 99  ITSVMVAAKFLDDMYYNNAYYAKVGGISTIEMNFLELDFLFGLSFHLNVTPNAFH-TYCT 157
           +T+  VA K L D +  NA+YAKVGG+   E+N LE DFL  +++   + P   + T C+
Sbjct: 124 LTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYR--IIPRDHNITLCS 181

Query: 158 YLQRE 162
             Q++
Sbjct: 182 IEQKQ 186


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.136    0.399 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,001,175
Number of Sequences: 62578
Number of extensions: 176491
Number of successful extensions: 365
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 364
Number of HSP's gapped (non-prelim): 1
length of query: 206
length of database: 14,973,337
effective HSP length: 94
effective length of query: 112
effective length of database: 9,091,005
effective search space: 1018192560
effective search space used: 1018192560
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 49 (23.5 bits)