BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 028611
(206 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2PK9|B Chain B, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The
Phosphate-responsive Signal Transduction Pathway
pdb|2PK9|D Chain D, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The
Phosphate-responsive Signal Transduction Pathway
pdb|2PMI|B Chain B, Structure Of The Pho85-Pho80 Cdk-Cyclin Complex Of The
Phosphate- Responsive Signal Transduction Pathway With
Bound Atp-Gamma-S
pdb|2PMI|D Chain D, Structure Of The Pho85-Pho80 Cdk-Cyclin Complex Of The
Phosphate- Responsive Signal Transduction Pathway With
Bound Atp-Gamma-S
Length = 293
Score = 71.6 bits (174), Expect = 3e-13, Method: Compositional matrix adjust.
Identities = 41/125 (32%), Positives = 68/125 (54%), Gaps = 3/125 (2%)
Query: 39 ISVFHGLTRPSISIQSYLERIFKYANCSPSCFIVAYVYLDRFVQRQPSLPINSFNVHRLL 98
++ +H P+ISI +Y R+ K+++ + + Y+D P +NS HR L
Sbjct: 64 LTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAHRFL 123
Query: 99 ITSVMVAAKFLDDMYYNNAYYAKVGGISTIEMNFLELDFLFGLSFHLNVTPNAFH-TYCT 157
+T+ VA K L D + NA+YAKVGG+ E+N LE DFL +++ + P + T C+
Sbjct: 124 LTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYR--IIPRDHNITLCS 181
Query: 158 YLQRE 162
Q++
Sbjct: 182 IEQKQ 186
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.325 0.136 0.399
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,001,175
Number of Sequences: 62578
Number of extensions: 176491
Number of successful extensions: 365
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 364
Number of HSP's gapped (non-prelim): 1
length of query: 206
length of database: 14,973,337
effective HSP length: 94
effective length of query: 112
effective length of database: 9,091,005
effective search space: 1018192560
effective search space used: 1018192560
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 49 (23.5 bits)