Citrus Sinensis ID: 028629


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200------
MKLGALGLPAYRTFSLEELEEATNNFDTSAFMGEGSKGQMYRGRLKNGTFIAIRCLKMKKSHSTRNFMHHIELISKLRHCHLVSALGHCFECYFDDSSVSRIFLIFEYVPNGTLRSWISEGHAWQSLTWTQRISAAIGVARGIQFLHTGIVPGVFSNNLKITDILLDQNLVAKISSYNLPLLAENAEKVGHVTPYSGSINPTNSAR
ccccccccccEEEEcHHHHHHHHcccccccccccccccccEEEEEccccEEEEEEEccccccHHHHHHHHHHHHHcccccccccEEEEEccccccccccccEEEEEEEEccccHHHHHccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccccccccc
cccccccccccccccHHHHHHHHccccHHccccccccccEEccEcccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHEEEEEcccccccccccEEEEEEEcccccHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEccHHHHHEEcccccccHcHccHHEEccccccccEEEEccccccHHHHcc
mklgalglpayrtfSLEELEEAtnnfdtsafmgegskgqmyrgrlkngTFIAIRCLKMKKSHSTRNFMHHIELISKLRHCHLVSalghcfecyfddssvsRIFLIFEyvpngtlrswiseghawqslTWTQRISAAIGVARGIQflhtgivpgvfsnnlkiTDILLDQNLVAKIssynlpllaenaekvghvtpysgsinptnsar
mklgalglpayRTFSLEELEEATNNFDTSAFMGEGSKGQMYRGRLKNGTFIAIRCLKMKKSHSTRNFMHHIELISKLRHCHLVSALGHCFECYFDDSSVSRIFLIFEYVPNGTLRSWISEGHAWQSLTWTQRISAAIGVARGIQFLHTGIVPGVFSNNLKITDILLDQNLVAKISSYNLPLLAENaekvghvtpysgsinptnsar
MKLGALGLPAYRTFSLEELEEATNNFDTSAFMGEGSKGQMYRGRLKNGTFIAIRCLKMKKSHSTRNFMHHIELISKLRHCHLVSALGHCFECYFDDSSVSRIFLIFEYVPNGTLRSWISEGHAWQSLTWTQRISAAIGVARGIQFLHTGIVPGVFSNNLKITDILLDQNLVAKISSYNLPLLAENAEKVGHVTPYSGSINPTNSAR
********PAYRTFSL**********************QMYRGRLKNGTFIAIRCLKMKKSHSTRNFMHHIELISKLRHCHLVSALGHCFECYFDDSSVSRIFLIFEYVPNGTLRSWISEGHAWQSLTWTQRISAAIGVARGIQFLHTGIVPGVFSNNLKITDILLDQNLVAKISSYNLPLLAENAEKVGH***************
**********YRTFSLEELEEATNNFDTSAFMGEGSKGQMYRGRLKNGTFIA****************HHIELISKLRHCHLVSALGHCFECYFDDSSVSRIFLIFEYVPNGTLRSWISEGHAWQSLTWTQRISAAIGVARGIQFLHTGIVPGVFSNNLKITDILLDQNLVAKISSYNLPLLAENAEKVGHVTPYSGSINPTNSA*
MKLGALGLPAYRTFSLEELEEATNNFDTSAFMGEGSKGQMYRGRLKNGTFIAIRCLKMKKSHSTRNFMHHIELISKLRHCHLVSALGHCFECYFDDSSVSRIFLIFEYVPNGTLRSWISEGHAWQSLTWTQRISAAIGVARGIQFLHTGIVPGVFSNNLKITDILLDQNLVAKISSYNLPLLAENAEKVGHVTPYSGSINPTNSAR
****ALGLPAYRTFSLEELEEATNNFDTSAFMGEGSKGQMYRGRLKNGTFIAIRCLKMKKSHSTRNFMHHIELISKLRHCHLVSALGHCFECYFDDSSVSRIFLIFEYVPNGTLRSWISEGHAWQSLTWTQRISAAIGVARGIQFLHTGIVPGVFSNNLKITDILLDQNLVAKISSYNLPLLAENAEKVGHVTPYSGSINPTNSAR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLGALGLPAYRTFSLEELEEATNNFDTSAFMGEGSKGQMYRGRLKNGTFIAIRCLKMKKSHSTRNFMHHIELISKLRHCHLVSALGHCFECYFDDSSVSRIFLIFEYVPNGTLRSWISEGHAWQSLTWTQRISAAIGVARGIQFLHTGIVPGVFSNNLKITDILLDQNLVAKISSYNLPLLAENAEKVGHVTPYSGSINPTNSAR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query206 2.2.26 [Sep-21-2011]
Q8LFN2 802 Probable inactive leucine yes no 0.956 0.245 0.776 9e-90
Q9M9S4 728 Probable LRR receptor-lik no no 0.902 0.255 0.494 4e-52
C0LGJ9 742 Probable LRR receptor-lik no no 0.902 0.250 0.454 2e-45
Q9LK35 855 Receptor-like protein kin no no 0.776 0.187 0.404 2e-31
Q9SJT0 871 Probable receptor-like pr no no 0.800 0.189 0.411 1e-30
Q9FID9 880 Probable receptor-like pr no no 0.849 0.198 0.362 1e-30
Q9SA72 849 Probable receptor-like pr no no 0.776 0.188 0.422 2e-30
Q9T020 878 Probable receptor-like pr no no 0.776 0.182 0.404 3e-30
Q9FLJ8 842 Probable receptor-like pr no no 0.839 0.205 0.385 8e-30
Q9FID8 873 Putative receptor-like pr no no 0.883 0.208 0.350 1e-29
>sp|Q8LFN2|Y3037_ARATH Probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 OS=Arabidopsis thaliana GN=At3g03770 PE=2 SV=1 Back     alignment and function desciption
 Score =  329 bits (843), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 153/197 (77%), Positives = 172/197 (87%)

Query: 1   MKLGALGLPAYRTFSLEELEEATNNFDTSAFMGEGSKGQMYRGRLKNGTFIAIRCLKMKK 60
           MKLG LGLPAYRTFSLEELE ATNNF++SAFMGEGS+GQ+YRGRLK+G+F+AIRCLKMKK
Sbjct: 452 MKLGGLGLPAYRTFSLEELEYATNNFESSAFMGEGSQGQIYRGRLKDGSFVAIRCLKMKK 511

Query: 61  SHSTRNFMHHIELISKLRHCHLVSALGHCFECYFDDSSVSRIFLIFEYVPNGTLRSWISE 120
           S ST+N MHHIELI+KLRH HLVS LGHCFECY DDS+VSR+F +FEYVPNG LR+WIS+
Sbjct: 512 SCSTQNLMHHIELIAKLRHRHLVSVLGHCFECYLDDSTVSRMFFVFEYVPNGELRTWISD 571

Query: 121 GHAWQSLTWTQRISAAIGVARGIQFLHTGIVPGVFSNNLKITDILLDQNLVAKISSYNLP 180
           GH  + LTW QRIS AIGVA+GIQFLHTGIVPGV+ NNLK+TDILLD NL AK+SSYNLP
Sbjct: 572 GHMGRLLTWEQRISVAIGVAKGIQFLHTGIVPGVYDNNLKMTDILLDNNLAAKLSSYNLP 631

Query: 181 LLAENAEKVGHVTPYSG 197
           LL E   KVG V   SG
Sbjct: 632 LLVEGLGKVGQVGSRSG 648





Arabidopsis thaliana (taxid: 3702)
>sp|Q9M9S4|Y1143_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g14390 OS=Arabidopsis thaliana GN=At1g14390 PE=2 SV=1 Back     alignment and function description
>sp|C0LGJ9|Y2278_ARATH Probable LRR receptor-like serine/threonine-protein kinase At2g02780 OS=Arabidopsis thaliana GN=At2g02780 PE=2 SV=1 Back     alignment and function description
>sp|Q9LK35|THE1_ARATH Receptor-like protein kinase THESEUS 1 OS=Arabidopsis thaliana GN=THE1 PE=1 SV=1 Back     alignment and function description
>sp|Q9SJT0|Y2214_ARATH Probable receptor-like protein kinase At2g21480 OS=Arabidopsis thaliana GN=At2g21480 PE=3 SV=1 Back     alignment and function description
>sp|Q9FID9|Y5389_ARATH Probable receptor-like protein kinase At5g38990 OS=Arabidopsis thaliana GN=At5g38990 PE=2 SV=1 Back     alignment and function description
>sp|Q9SA72|Y1357_ARATH Probable receptor-like protein kinase At1g30570 OS=Arabidopsis thaliana GN=At1g30570 PE=1 SV=1 Back     alignment and function description
>sp|Q9T020|Y4391_ARATH Probable receptor-like protein kinase At4g39110 OS=Arabidopsis thaliana GN=At4g39110 PE=1 SV=1 Back     alignment and function description
>sp|Q9FLJ8|Y5613_ARATH Probable receptor-like protein kinase At5g61350 OS=Arabidopsis thaliana GN=At5g61350 PE=2 SV=1 Back     alignment and function description
>sp|Q9FID8|Y5900_ARATH Putative receptor-like protein kinase At5g39000 OS=Arabidopsis thaliana GN=At5g39000 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query206
224144836 774 predicted protein [Populus trichocarpa] 1.0 0.266 0.834 1e-100
255569464 782 leucine-rich repeat protein, putative [R 1.0 0.263 0.810 6e-98
225439195 786 PREDICTED: probable inactive leucine-ric 0.917 0.240 0.862 5e-94
224123880 784 predicted protein [Populus trichocarpa] 1.0 0.262 0.815 7e-94
147854936 746 hypothetical protein VITISV_020032 [Viti 0.917 0.253 0.862 8e-94
297833056 802 hypothetical protein ARALYDRAFT_477625 [ 0.956 0.245 0.791 3e-89
18396660 802 leucine-rich repeat protein kinase-like 0.956 0.245 0.776 5e-88
6006864 803 hypothetical protein [Arabidopsis thalia 0.917 0.235 0.783 8e-86
27311539 652 expressed protein [Arabidopsis thaliana] 0.917 0.289 0.783 9e-86
357508805 774 hypothetical protein MTR_7g086420 [Medic 0.883 0.235 0.774 2e-82
>gi|224144836|ref|XP_002325432.1| predicted protein [Populus trichocarpa] gi|222862307|gb|EEE99813.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  368 bits (944), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 187/206 (90%)

Query: 1   MKLGALGLPAYRTFSLEELEEATNNFDTSAFMGEGSKGQMYRGRLKNGTFIAIRCLKMKK 60
           MKLGALGLP YRTFSLEE+EEATNNFDTSAFMGEGS+GQMYRGRLK+G+F+AIRCLKMK+
Sbjct: 450 MKLGALGLPPYRTFSLEEVEEATNNFDTSAFMGEGSQGQMYRGRLKDGSFVAIRCLKMKR 509

Query: 61  SHSTRNFMHHIELISKLRHCHLVSALGHCFECYFDDSSVSRIFLIFEYVPNGTLRSWISE 120
           SHST+NFMHHIELISKLRH HLVSALGHCFECY DDSSVSRIFL+FEYVPNGTLRSWIS 
Sbjct: 510 SHSTQNFMHHIELISKLRHRHLVSALGHCFECYLDDSSVSRIFLVFEYVPNGTLRSWISG 569

Query: 121 GHAWQSLTWTQRISAAIGVARGIQFLHTGIVPGVFSNNLKITDILLDQNLVAKISSYNLP 180
           GHAWQ L WT RI+AAIGVA+GIQFLHTGIVPGV+SNNLKITD+LLDQNL+AKISSYNLP
Sbjct: 570 GHAWQKLQWTHRIAAAIGVAKGIQFLHTGIVPGVYSNNLKITDVLLDQNLIAKISSYNLP 629

Query: 181 LLAENAEKVGHVTPYSGSINPTNSAR 206
           LLAEN   V H T    S + + SAR
Sbjct: 630 LLAENKGMVVHGTSSGASKDLSTSAR 655




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255569464|ref|XP_002525699.1| leucine-rich repeat protein, putative [Ricinus communis] gi|223534999|gb|EEF36682.1| leucine-rich repeat protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225439195|ref|XP_002269509.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 [Vitis vinifera] gi|296085894|emb|CBI31218.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224123880|ref|XP_002319187.1| predicted protein [Populus trichocarpa] gi|222857563|gb|EEE95110.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147854936|emb|CAN80270.1| hypothetical protein VITISV_020032 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297833056|ref|XP_002884410.1| hypothetical protein ARALYDRAFT_477625 [Arabidopsis lyrata subsp. lyrata] gi|297330250|gb|EFH60669.1| hypothetical protein ARALYDRAFT_477625 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18396660|ref|NP_566213.1| leucine-rich repeat protein kinase-like protein [Arabidopsis thaliana] gi|334185060|ref|NP_001189801.1| leucine-rich repeat protein kinase-like protein [Arabidopsis thaliana] gi|75155911|sp|Q8LFN2.1|Y3037_ARATH RecName: Full=Probable inactive leucine-rich repeat receptor-like protein kinase At3g03770; Flags: Precursor gi|21536973|gb|AAM61314.1| unknown [Arabidopsis thaliana] gi|224589557|gb|ACN59312.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana] gi|332640463|gb|AEE73984.1| leucine-rich repeat protein kinase-like protein [Arabidopsis thaliana] gi|332640464|gb|AEE73985.1| leucine-rich repeat protein kinase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|6006864|gb|AAF00640.1|AC009540_17 hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|27311539|gb|AAO00735.1| expressed protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357508805|ref|XP_003624691.1| hypothetical protein MTR_7g086420 [Medicago truncatula] gi|87162732|gb|ABD28527.1| Protein kinase [Medicago truncatula] gi|355499706|gb|AES80909.1| hypothetical protein MTR_7g086420 [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query206
TAIR|locus:2079339 802 AT3G03770 [Arabidopsis thalian 0.956 0.245 0.776 6.6e-81
TAIR|locus:2167326680 AT5G63410 [Arabidopsis thalian 0.888 0.269 0.464 1.9e-44
TAIR|locus:2050080 871 AT2G21480 [Arabidopsis thalian 0.800 0.189 0.411 1.9e-30
TAIR|locus:2151349 855 THE1 "THESEUS1" [Arabidopsis t 0.864 0.208 0.388 1e-29
TAIR|locus:2136338 878 AT4G39110 [Arabidopsis thalian 0.796 0.186 0.408 1.4e-29
TAIR|locus:2152312 880 AT5G38990 [Arabidopsis thalian 0.883 0.206 0.360 3e-29
TAIR|locus:2204564 849 HERK2 "hercules receptor kinas 0.864 0.209 0.404 5.8e-29
TAIR|locus:2177202 873 AT5G39000 [Arabidopsis thalian 0.883 0.208 0.360 1.3e-28
TAIR|locus:2062824 565 NCRK [Arabidopsis thaliana (ta 0.873 0.318 0.376 2.1e-28
TAIR|locus:2178707 824 AT5G24010 [Arabidopsis thalian 0.781 0.195 0.385 4.7e-28
TAIR|locus:2079339 AT3G03770 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 812 (290.9 bits), Expect = 6.6e-81, P = 6.6e-81
 Identities = 153/197 (77%), Positives = 172/197 (87%)

Query:     1 MKLGALGLPAYRTFSLEELEEATNNFDTSAFMGEGSKGQMYRGRLKNGTFIAIRCLKMKK 60
             MKLG LGLPAYRTFSLEELE ATNNF++SAFMGEGS+GQ+YRGRLK+G+F+AIRCLKMKK
Sbjct:   452 MKLGGLGLPAYRTFSLEELEYATNNFESSAFMGEGSQGQIYRGRLKDGSFVAIRCLKMKK 511

Query:    61 SHSTRNFMHHIELISKLRHCHLVSALGHCFECYFDDSSVSRIFLIFEYVPNGTLRSWISE 120
             S ST+N MHHIELI+KLRH HLVS LGHCFECY DDS+VSR+F +FEYVPNG LR+WIS+
Sbjct:   512 SCSTQNLMHHIELIAKLRHRHLVSVLGHCFECYLDDSTVSRMFFVFEYVPNGELRTWISD 571

Query:   121 GHAWQSLTWTQRISAAIGVARGIQFLHTGIVPGVFSNNLKITDILLDQNLVAKISSYNLP 180
             GH  + LTW QRIS AIGVA+GIQFLHTGIVPGV+ NNLK+TDILLD NL AK+SSYNLP
Sbjct:   572 GHMGRLLTWEQRISVAIGVAKGIQFLHTGIVPGVYDNNLKMTDILLDNNLAAKLSSYNLP 631

Query:   181 LLAENAEKVGHVTPYSG 197
             LL E   KVG V   SG
Sbjct:   632 LLVEGLGKVGQVGSRSG 648




GO:0004672 "protein kinase activity" evidence=IEA;ISS
GO:0004674 "protein serine/threonine kinase activity" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0009718 "anthocyanin-containing compound biosynthetic process" evidence=RCA
GO:0009744 "response to sucrose stimulus" evidence=RCA
GO:0010224 "response to UV-B" evidence=RCA
TAIR|locus:2167326 AT5G63410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2050080 AT2G21480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151349 THE1 "THESEUS1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2136338 AT4G39110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152312 AT5G38990 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2204564 HERK2 "hercules receptor kinase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2177202 AT5G39000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062824 NCRK [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2178707 AT5G24010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8LFN2Y3037_ARATHNo assigned EC number0.77660.95630.2456yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_fgenesh4_pm.C_LG_XIX0116
hypothetical protein (774 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query206
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 2e-15
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 2e-15
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 1e-14
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 1e-13
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 4e-13
pfam00069260 pfam00069, Pkinase, Protein kinase domain 4e-13
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 1e-10
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 5e-10
cd05069260 cd05069, PTKc_Yes, Catalytic domain of the Protein 1e-09
cd05071262 cd05071, PTKc_Src, Catalytic domain of the Protein 2e-09
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 2e-09
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 2e-09
COG0515 384 COG0515, SPS1, Serine/threonine protein kinase [Ge 3e-09
cd05049280 cd05049, PTKc_Trk, Catalytic domain of the Protein 5e-09
cd05070260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 8e-09
cd05048283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 1e-08
cd05033266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 3e-08
cd05093288 cd05093, PTKc_TrkB, Catalytic domain of the Protei 4e-08
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 1e-07
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 2e-07
cd05067260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 2e-07
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 4e-07
cd05038 284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 4e-07
cd05089 297 cd05089, PTKc_Tie1, Catalytic domain of the Protei 6e-07
cd05088 303 cd05088, PTKc_Tie2, Catalytic domain of the Protei 8e-07
cd05092280 cd05092, PTKc_TrkA, Catalytic domain of the Protei 1e-06
cd05065269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 3e-06
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 3e-06
cd05047270 cd05047, PTKc_Tie, Catalytic domain of Tie Protein 4e-06
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 4e-06
cd07840 287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 5e-06
cd05066267 cd05066, PTKc_EphR_A, Catalytic domain of the Prot 5e-06
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 7e-06
cd07833 288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 9e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-06
cd05080 283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 1e-05
cd05097295 cd05097, PTKc_DDR_like, Catalytic domain of Discoi 1e-05
cd05112256 cd05112, PTKc_Itk, Catalytic domain of the Protein 1e-05
cd05581 280 cd05581, STKc_PDK1, Catalytic domain of the Protei 1e-05
cd07846 286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 1e-05
cd05072261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 1e-05
cd05085250 cd05085, PTKc_Fer, Catalytic domain of the Protein 2e-05
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 3e-05
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 3e-05
cd05044269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 4e-05
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 4e-05
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 5e-05
cd05094291 cd05094, PTKc_TrkC, Catalytic domain of the Protei 7e-05
cd05045290 cd05045, PTKc_RET, Catalytic domain of the Protein 1e-04
cd05068261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 1e-04
cd05580 290 cd05580, STKc_PKA, Catalytic domain of the Protein 1e-04
cd06644 292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 3e-04
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 3e-04
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 3e-04
cd05063268 cd05063, PTKc_EphR_A2, Catalytic domain of the Pro 4e-04
cd05617 327 cd05617, STKc_aPKC_zeta, Catalytic domain of the P 4e-04
cd05615 323 cd05615, STKc_cPKC_alpha, Catalytic domain of the 5e-04
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 6e-04
cd05589 324 cd05589, STKc_PKN, Catalytic domain of the Protein 7e-04
cd05619 316 cd05619, STKc_nPKC_theta, Catalytic domain of the 7e-04
cd05087269 cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of t 0.001
cd05612 291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 0.001
cd07831 282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 0.002
cd07845 309 cd07845, STKc_CDK10, Catalytic domain of the Serin 0.002
cd05591 321 cd05591, STKc_nPKC_epsilon, Catalytic domain of th 0.003
cd05056270 cd05056, PTKc_FAK, Catalytic domain of the Protein 0.003
cd05588 329 cd05588, STKc_aPKC, Catalytic domain of the Protei 0.004
cd05096304 cd05096, PTKc_DDR1, Catalytic domain of the Protei 0.004
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
 Score = 71.5 bits (176), Expect = 2e-15
 Identities = 41/151 (27%), Positives = 75/151 (49%), Gaps = 17/151 (11%)

Query: 33  GEGSKGQMYRGRLKN-GTFIAIRCLKMKKSHSTRNFMHH-IELISKLRHCHLVSALGHCF 90
           GEG  G +Y  R K  G  +AI+ +K + S S    +   IE++ KL H ++V      +
Sbjct: 2   GEGGFGTVYLARDKKTGKKVAIKIIKKEDSSSLLEELLREIEILKKLNHPNIV----KLY 57

Query: 91  ECYFDDSSVSRIFLIFEYVPNGTLRSWISEGHAWQSLTWTQRISAAIGVARGIQFLH-TG 149
             + D++    ++L+ EY   G+L+  + E      L+  + +   + +  G+++LH  G
Sbjct: 58  GVFEDEN---HLYLVMEYCEGGSLKDLLKENE--GKLSEDEILRILLQILEGLEYLHSNG 112

Query: 150 IVPGVFSNNLKITDILLDQ-NLVAKISSYNL 179
           I+      +LK  +ILLD  N   K++ + L
Sbjct: 113 IIHR----DLKPENILLDSDNGKVKLADFGL 139


Protein Kinases (PKs), catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The PK family is part of a larger superfamily that includes the catalytic domains of RIO kinases, aminoglycoside phosphotransferase, choline kinase, phosphoinositide 3-kinase (PI3K), and actin-fragmin kinase. PKs make up a large family of serine/threonine kinases, protein tyrosine kinases (PTKs), and dual-specificity PKs that phosphorylate both serine/threonine and tyrosine residues of target proteins. Majority of protein phosphorylation, about 95%, occurs on serine residues while only 1% occurs on tyrosine residues. Protein phosphorylation is a mechanism by which a wide variety of cellular proteins, such as enzymes and membrane channels, are reversibly regulated in response to certain stimuli. PKs often function as components of signal transduction pathways in which one kinase activates a second kinase, which in turn, may act on other kinases; this sequential action transmits a signal from the cell surface to target proteins, which results in cellular responses. The PK family is one of the largest known protein families with more than 100 homologous yeast enzymes and 550 human proteins. A fraction of PK family members are pseudokinases that lack crucial residues for catalytic activity. The mutiplicity of kinases allows for specific regulation according to substrate, tissue distribution, and cellular localization. PKs regulate many cellular processes including proliferation, division, differentiation, motility, survival, metabolism, cell-cycle progression, cytoskeletal rearrangement, immunity, and neuronal functions. Many kinases are implicated in the development of various human diseases including different types of cancer. Length = 215

>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|133220 cd05089, PTKc_Tie1, Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>gnl|CDD|133219 cd05088, PTKc_Tie2, Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|88330 cd05047, PTKc_Tie, Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|173646 cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>gnl|CDD|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 206
KOG1187 361 consensus Serine/threonine protein kinase [Signal 100.0
KOG0595 429 consensus Serine/threonine-protein kinase involved 100.0
KOG0615 475 consensus Serine/threonine protein kinase Chk2 and 100.0
KOG0575 592 consensus Polo-like serine/threonine protein kinas 100.0
KOG0581 364 consensus Mitogen-activated protein kinase kinase 100.0
KOG0598 357 consensus Ribosomal protein S6 kinase and related 100.0
KOG0593 396 consensus Predicted protein kinase KKIAMRE [Genera 100.0
KOG0192 362 consensus Tyrosine kinase specific for activated ( 100.0
KOG0600 560 consensus Cdc2-related protein kinase [Cell cycle 100.0
KOG0659 318 consensus Cdk activating kinase (CAK)/RNA polymera 100.0
KOG0661 538 consensus MAPK related serine/threonine protein ki 100.0
KOG0616 355 consensus cAMP-dependent protein kinase catalytic 100.0
KOG0591 375 consensus NIMA (never in mitosis)-related G2-speci 100.0
KOG0583 370 consensus Serine/threonine protein kinase [Signal 100.0
KOG0198 313 consensus MEKK and related serine/threonine protei 100.0
KOG0585 576 consensus Ca2+/calmodulin-dependent protein kinase 100.0
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 100.0
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 100.0
KOG0611 668 consensus Predicted serine/threonine protein kinas 100.0
KOG0663 419 consensus Protein kinase PITSLRE and related kinas 100.0
KOG0578 550 consensus p21-activated serine/threonine protein k 100.0
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 100.0
KOG0605 550 consensus NDR and related serine/threonine kinases 100.0
KOG0197468 consensus Tyrosine kinases [Signal transduction me 100.0
KOG0594 323 consensus Protein kinase PCTAIRE and related kinas 100.0
KOG0658 364 consensus Glycogen synthase kinase-3 [Carbohydrate 100.0
cd05631 285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.98
cd05628 363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.98
cd05600 333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.97
cd05612 291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.97
cd05599 364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.97
PTZ00263 329 protein kinase A catalytic subunit; Provisional 99.97
cd05571 323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.97
KOG0589 426 consensus Serine/threonine protein kinase [General 99.97
cd05621 370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.97
cd05629 377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.97
cd05626 381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.97
cd05595 323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.97
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 99.97
PTZ00426 340 cAMP-dependent protein kinase catalytic subunit; P 99.97
cd05598 376 STKc_LATS Catalytic domain of the Protein Serine/T 99.97
cd05625 382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.97
KOG0660 359 consensus Mitogen-activated protein kinase [Signal 99.97
KOG0032 382 consensus Ca2+/calmodulin-dependent protein kinase 99.97
cd05593 328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.97
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 99.97
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.97
KOG0193 678 consensus Serine/threonine protein kinase RAF [Sig 99.97
cd05573 350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.97
KOG0582 516 consensus Ste20-like serine/threonine protein kina 99.97
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.97
cd07871 288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.97
cd05585 312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.97
KOG0694 694 consensus Serine/threonine protein kinase [Signal 99.97
cd05624 331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.97
cd05597 331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.97
cd05596 370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.97
cd05627 360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.97
cd05601 330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.97
cd05584 323 STKc_p70S6K Catalytic domain of the Protein Serine 99.97
cd05594 325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.97
cd05605 285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.97
KOG0599 411 consensus Phosphorylase kinase gamma subunit [Carb 99.97
cd06649 331 PKc_MEK2 Catalytic domain of the dual-specificity 99.97
cd05587 324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.97
KOG0584 632 consensus Serine/threonine protein kinase [General 99.97
KOG0577 948 consensus Serine/threonine protein kinase [Signal 99.97
cd07869 303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.97
cd07848 287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.97
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.97
cd05589 324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.97
KOG0986 591 consensus G protein-coupled receptor kinase [Signa 99.97
PTZ00267 478 NIMA-related protein kinase; Provisional 99.97
KOG0194 474 consensus Protein tyrosine kinase [Signal transduc 99.97
cd05618 329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.97
cd05588 329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.97
cd07859 338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.97
cd05614 332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.97
cd06650 333 PKc_MEK1 Catalytic domain of the dual-specificity 99.97
cd05616 323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.97
cd05623 332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.97
cd05582 318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.97
cd07862 290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.97
cd05603 321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.97
KOG1989 738 consensus ARK protein kinase family [Signal transd 99.97
cd05590 320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.97
cd05604 325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.97
cd05591 321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.97
PLN00034 353 mitogen-activated protein kinase kinase; Provision 99.97
cd05592 316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.97
cd05632 285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.96
cd05575 323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.96
cd05607 277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.96
cd05615 323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.96
PHA03212 391 serine/threonine kinase US3; Provisional 99.96
cd07876 359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.96
cd05617 327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.96
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 99.96
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.96
cd05630 285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.96
KOG2052 513 consensus Activin A type IB receptor, serine/threo 99.96
cd05602 325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.96
cd05619 316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.96
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.96
cd05580 290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.96
PTZ00036 440 glycogen synthase kinase; Provisional 99.96
cd05620 316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.96
cd07863 288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.96
cd07872 309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.96
KOG0667 586 consensus Dual-specificity tyrosine-phosphorylatio 99.96
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.96
cd07874 355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.96
cd05108 316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.96
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.96
cd05608 280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.96
KOG4236 888 consensus Serine/threonine protein kinase PKC mu/P 99.96
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.96
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.96
PHA02988283 hypothetical protein; Provisional 99.96
cd05570 318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.96
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.96
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.96
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.96
PHA03209 357 serine/threonine kinase US3; Provisional 99.96
cd06656 297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.96
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.96
cd06654 296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.96
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.96
cd05586 330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.96
KOG0201 467 consensus Serine/threonine protein kinase [Signal 99.96
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.96
KOG0586 596 consensus Serine/threonine protein kinase [General 99.96
cd06644 292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.96
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.96
cd06615 308 PKc_MEK Catalytic domain of the dual-specificity P 99.96
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.96
cd07875 364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.96
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.96
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.96
cd07853 372 STKc_NLK Catalytic domain of the Serine/Threonine 99.96
PTZ00283 496 serine/threonine protein kinase; Provisional 99.96
cd06622 286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.96
cd06611 280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.96
KOG0610 459 consensus Putative serine/threonine protein kinase 99.96
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.96
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.96
cd06643 282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.96
cd07878 343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.96
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.96
cd06655 296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.96
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.96
KOG4721 904 consensus Serine/threonine protein kinase, contain 99.96
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.96
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.96
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.96
cd07861 285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.96
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.96
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.96
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 99.96
KOG4717 864 consensus Serine/threonine protein kinase [Signal 99.96
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.96
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.96
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.96
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.96
cd07873 301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.96
cd07847 286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.96
KOG0607 463 consensus MAP kinase-interacting kinase and relate 99.96
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.96
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.96
cd06619 279 PKc_MKK5 Catalytic domain of the dual-specificity 99.96
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.96
cd06609 274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.96
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.96
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 99.96
KOG0033 355 consensus Ca2+/calmodulin-dependent protein kinase 99.96
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.96
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.96
PHA03211 461 serine/threonine kinase US3; Provisional 99.96
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.96
cd07841 298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.95
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.95
KOG0690 516 consensus Serine/threonine protein kinase [Signal 99.95
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.95
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.95
cd07868 317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.95
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.95
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.95
cd07832 286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.95
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.95
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.95
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 99.95
cd05088 303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.95
KOG3653 534 consensus Transforming growth factor beta/activin 99.95
cd05574 316 STKc_phototropin_like Catalytic domain of Phototro 99.95
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.95
cd07846 286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.95
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.95
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.95
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.95
cd06617 283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.95
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.95
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.95
cd05609 305 STKc_MAST Catalytic domain of the Protein Serine/T 99.95
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.95
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.95
cd07870 291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.95
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.95
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.95
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.95
cd07839 284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.95
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.95
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.95
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.95
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.95
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.95
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.95
cd06659 297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.95
KOG1026774 consensus Nerve growth factor receptor TRKA and re 99.95
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.95
KOG1094807 consensus Discoidin domain receptor DDR1 [Signal t 99.95
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.95
cd05089 297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.95
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.95
KOG0666 438 consensus Cyclin C-dependent kinase CDK8 [Transcri 99.95
KOG0196 996 consensus Tyrosine kinase, EPH (ephrin) receptor f 99.95
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.95
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.95
KOG0662 292 consensus Cyclin-dependent kinase CDK5 [Intracellu 99.95
cd07844 291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.95
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.95
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.95
cd07833 288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.95
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.95
PHA03207 392 serine/threonine kinase US3; Provisional 99.95
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.95
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.95
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.95
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.95
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.95
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.95
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.95
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.95
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.95
cd06647 293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.95
cd06642 277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.95
cd07843 293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.95
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.95
cd05577 277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.95
cd07836 284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.95
cd06620 284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.95
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.95
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.95
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.95
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.95
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.95
cd07867 317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.95
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.95
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.95
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.95
cd06917 277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.95
PTZ00284 467 protein kinase; Provisional 99.95
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.95
cd05613 290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.95
cd07860 284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.95
cd06640 277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.95
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.95
cd07850 353 STKc_JNK Catalytic domain of the Serine/Threonine 99.95
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.95
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.95
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.95
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.95
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.95
cd08227 327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.95
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.95
cd06641 277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.95
PRK09188 365 serine/threonine protein kinase; Provisional 99.95
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.95
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.95
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.95
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.95
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.95
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.95
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.95
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.95
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.95
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.95
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 99.95
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.95
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.95
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.95
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.95
cd07835 283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.95
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.95
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.94
cd07865 310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.94
cd07845 309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.94
cd06621 287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.94
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.94
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.94
cd05100 334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.94
cd07842 316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.94
cd06657 292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.94
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.94
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.94
cd07855 334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.94
cd07849 336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.94
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.94
KOG1095 1025 consensus Protein tyrosine kinase [Signal transduc 99.94
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.94
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.94
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.94
cd06607 307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.94
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.94
cd05099 314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.94
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.94
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.94
cd07864 302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.94
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.94
cd07840 287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.94
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.94
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.94
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.94
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.94
cd05633 279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.94
cd05110 303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.94
cd07837 295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.94
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 99.94
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.94
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 99.94
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.94
cd07831 282 STKc_MOK Catalytic domain of the Serine/Threonine 99.94
cd07830 283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.94
KOG0604 400 consensus MAP kinase-activated protein kinase 2 [S 99.94
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 99.94
cd07858 337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.94
cd07852 337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.94
cd07880 343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.94
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.94
cd07877 345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.94
PLN00009 294 cyclin-dependent kinase A; Provisional 99.94
cd05606 278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.94
cd07856 328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.94
cd07834 330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.94
PHA03210 501 serine/threonine kinase US3; Provisional 99.94
cd06635 317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.94
KOG1152772 consensus Signal transduction serine/threonine kin 99.94
PTZ00024 335 cyclin-dependent protein kinase; Provisional 99.94
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.94
cd06618 296 PKc_MKK7 Catalytic domain of the dual-specificity 99.94
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.94
cd06616 288 PKc_MKK4 Catalytic domain of the dual-specificity 99.94
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.94
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 99.94
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 99.93
cd07866 311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.93
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 99.93
cd05118 283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.93
KOG0608 1034 consensus Warts/lats-like serine threonine kinases 99.93
cd07854 342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.93
cd07857 332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.93
cd07838 287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.93
cd06633 313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.93
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.93
cd05583 288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.93
cd07829 282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.93
cd07879 342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.93
PLN03224 507 probable serine/threonine protein kinase; Provisio 99.93
cd08216 314 PK_STRAD Pseudokinase domain of STE20-related kina 99.93
KOG1006 361 consensus Mitogen-activated protein kinase (MAPK) 99.93
KOG0983 391 consensus Mitogen-activated protein kinase (MAPK) 99.93
cd06634 308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.93
KOG1151 775 consensus Tousled-like protein kinase [Signal tran 99.93
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.93
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.93
cd08226 328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.93
cd07851 343 STKc_p38 Catalytic domain of the Serine/Threonine 99.93
KOG0596 677 consensus Dual specificity; serine/threonine and t 99.92
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.92
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.92
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 99.92
KOG0669 376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 99.92
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.92
PHA02882294 putative serine/threonine kinase; Provisional 99.92
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.91
KOG0576 829 consensus Mitogen-activated protein kinase kinase 99.91
KOG0671 415 consensus LAMMER dual specificity kinases [Signal 99.91
KOG0664 449 consensus Nemo-like MAPK-related serine/threonine 99.91
KOG0668 338 consensus Casein kinase II, alpha subunit [Signal 99.91
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.91
KOG0614 732 consensus cGMP-dependent protein kinase [Signal tr 99.91
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 99.9
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.9
KOG0695 593 consensus Serine/threonine protein kinase [Signal 99.9
KOG0696 683 consensus Serine/threonine protein kinase [Signal 99.9
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.9
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 99.89
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.89
KOG0200 609 consensus Fibroblast/platelet-derived growth facto 99.87
KOG0670 752 consensus U4/U6-associated splicing factor PRP4 [R 99.87
KOG1345 378 consensus Serine/threonine kinase [Signal transduc 99.86
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 99.86
PRK10345210 hypothetical protein; Provisional 99.86
KOG0665 369 consensus Jun-N-terminal kinase (JNK) [Signal tran 99.86
KOG1027 903 consensus Serine/threonine protein kinase and endo 99.86
KOG1163 341 consensus Casein kinase (serine/threonine/tyrosine 99.85
smart00090237 RIO RIO-like kinase. 99.85
KOG1290 590 consensus Serine/threonine protein kinase [Signal 99.84
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.84
PRK14879211 serine/threonine protein kinase; Provisional 99.83
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 99.83
KOG1165 449 consensus Casein kinase (serine/threonine/tyrosine 99.83
PRK12274218 serine/threonine protein kinase; Provisional 99.83
KOG1167 418 consensus Serine/threonine protein kinase of the C 99.82
KOG1164 322 consensus Casein kinase (serine/threonine/tyrosine 99.82
PRK09605535 bifunctional UGMP family protein/serine/threonine 99.81
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 99.81
COG0515 384 SPS1 Serine/threonine protein kinase [General func 99.78
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 99.75
KOG1024563 consensus Receptor-like protein tyrosine kinase RY 99.75
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 99.74
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 99.71
KOG1166974 consensus Mitotic checkpoint serine/threonine prot 99.7
PLN00181 793 protein SPA1-RELATED; Provisional 99.69
TIGR01982 437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 99.63
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 99.61
KOG0590 601 consensus Checkpoint kinase and related serine/thr 99.6
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 99.53
PRK04750 537 ubiB putative ubiquinone biosynthesis protein UbiB 99.52
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 99.5
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 99.49
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 99.45
KOG3087229 consensus Serine/threonine protein kinase [General 99.43
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.4
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 99.39
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 99.35
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 99.31
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.3
KOG3741 655 consensus Poly(A) ribonuclease subunit [RNA proces 99.26
KOG1023 484 consensus Natriuretic peptide receptor, guanylate 99.26
KOG4158 598 consensus BRPK/PTEN-induced protein kinase [Signal 99.25
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 99.25
KOG1243 690 consensus Protein kinase [General function predict 99.22
KOG1033516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 99.21
COG0478304 RIO-like serine/threonine protein kinase fused to 99.19
KOG0590 601 consensus Checkpoint kinase and related serine/thr 99.14
KOG0606 1205 consensus Microtubule-associated serine/threonine 99.13
PRK09902216 hypothetical protein; Provisional 99.03
PF06293206 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; 99.03
KOG0601 524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 98.97
COG0661 517 AarF Predicted unusual protein kinase [General fun 98.96
KOG1266 458 consensus Protein kinase [Signal transduction mech 98.94
PF06176229 WaaY: Lipopolysaccharide core biosynthesis protein 98.88
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 98.82
COG1718268 RIO1 Serine/threonine protein kinase involved in c 98.81
KOG1235 538 consensus Predicted unusual protein kinase [Genera 98.78
TIGR02172226 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogou 98.62
PF01636239 APH: Phosphotransferase enzyme family This family 98.56
COG2112201 Predicted Ser/Thr protein kinase [Signal transduct 98.53
PF12260188 PIP49_C: Protein-kinase domain of FAM69; InterPro: 98.52
cd05150244 APH Aminoglycoside 3'-phosphotransferase (APH). Th 98.43
PLN02876 822 acyl-CoA dehydrogenase 98.25
COG4248 637 Uncharacterized protein with protein kinase and he 98.25
cd05157235 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. 98.18
TIGR02721256 ycfN_thiK thiamine kinase. Members of this family 98.14
cd05155235 APH_ChoK_like_1 Uncharacterized bacterial proteins 98.09
cd05153296 HomoserineK_II Homoserine Kinase, type II. Homoser 98.06
PF10707199 YrbL-PhoP_reg: PhoP regulatory network protein Yrb 98.06
PRK05231319 homoserine kinase; Provisional 97.97
KOG2270 520 consensus Serine/threonine protein kinase involved 97.97
KOG2268 465 consensus Serine/threonine protein kinase [Signal 97.94
cd05156302 ChoK_euk Choline Kinase (ChoK) in eukaryotes. The 97.87
TIGR00938307 thrB_alt homoserine kinase, Neisseria type. Homose 97.82
PRK10593 297 hypothetical protein; Provisional 97.82
PRK09550 401 mtnK methylthioribose kinase; Reviewed 97.77
PF13095207 FTA2: Kinetochore Sim4 complex subunit FTA2 97.71
PLN02236344 choline kinase 97.59
KOG2137 700 consensus Protein kinase [Signal transduction mech 97.49
KOG0606 1205 consensus Microtubule-associated serine/threonine 97.42
cd05152276 MPH2' Macrolide 2'-Phosphotransferase (MPH2'). MPH 97.33
KOG0576 829 consensus Mitogen-activated protein kinase kinase 97.31
PLN02421330 phosphotransferase, alcohol group as acceptor/kina 97.28
COG3173321 Predicted aminoglycoside phosphotransferase [Gener 97.19
TIGR01767 370 MTRK 5-methylthioribose kinase. This enzyme is inv 97.16
PRK11768 325 serine/threonine protein kinase; Provisional 97.08
PLN02756 418 S-methyl-5-thioribose kinase 96.93
COG2334331 Putative homoserine kinase type II (protein kinase 96.71
PRK12396 409 5-methylribose kinase; Reviewed 96.69
PTZ00384 383 choline kinase; Provisional 96.62
COG5072488 ALK1 Serine/threonine kinase of the haspin family 96.6
PRK06148 1013 hypothetical protein; Provisional 96.3
PTZ00296 442 choline kinase; Provisional 96.3
PHA03111444 Ser/Thr kinase; Provisional 95.95
PRK10271188 thiK thiamine kinase; Provisional 95.88
PF03881288 Fructosamin_kin: Fructosamine kinase; InterPro: IP 95.73
PF01633211 Choline_kinase: Choline/ethanolamine kinase; Inter 95.68
PF05445434 Pox_ser-thr_kin: Poxvirus serine/threonine protein 95.53
COG0510269 ycfN Thiamine kinase and related kinases [Coenzyme 95.21
PF03109119 ABC1: ABC1 family; InterPro: IPR004147 This entry 95.05
TIGR02906313 spore_CotS spore coat protein, CotS family. Member 94.81
smart00587196 CHK ZnF_C4 abd HLH domain containing kinases domai 94.01
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=3.4e-41  Score=267.33  Aligned_cols=188  Identities=36%  Similarity=0.695  Sum_probs=165.6

Q ss_pred             ccceeCHHHHHHHhcCCcccceeccCcceeEEEEEEeCCcEEEEEEeecCCCccHHHHHHHHHHHhccCCCceeeecccc
Q 028629           10 AYRTFSLEELEEATNNFDTSAFMGEGSKGQMYRGRLKNGTFIAIRCLKMKKSHSTRNFMHHIELISKLRHCHLVSALGHC   89 (206)
Q Consensus        10 ~~~~~~~~~~~~~~~~~~~~~~lg~g~~g~v~~~~~~~~~~vaiK~~~~~~~~~~~~~~~e~~~l~~l~h~~i~~~~~~~   89 (206)
                      ..+.|++.++..++++|.....||+|+||.||+|...++..||||++........++|.+|++++.+++|+|+++++|+|
T Consensus        61 ~~~~fs~~el~~AT~~Fs~~~~ig~Ggfg~VYkG~l~~~~~vAVK~~~~~~~~~~~eF~~Ei~~ls~l~H~Nlv~LlGyC  140 (361)
T KOG1187|consen   61 PLRSFSYDELRKATNNFSESNLIGEGGFGTVYKGVLSDGTVVAVKRLSSNSGQGEREFLNEVEILSRLRHPNLVKLLGYC  140 (361)
T ss_pred             CcceeeHHHHHHHHhCCchhcceecCCCeEEEEEEECCCCEEEEEEecCCCCcchhHHHHHHHHHhcCCCcCcccEEEEE
Confidence            57889999999999999999999999999999999988899999988755432156699999999999999999999999


Q ss_pred             ccccccCCCCc-eEEEEEeecCCCCHHHHHhcCCCCcccCHHHHHHHHHHHHHHHHHHhcCCCCceeccCCccccEEecC
Q 028629           90 FECYFDDSSVS-RIFLIFEYVPNGTLRSWISEGHAWQSLTWTQRISAAIGVARGIQFLHTGIVPGVFSNNLKITDILLDQ  168 (206)
Q Consensus        90 ~~~~~~~~~~~-~~~lv~e~~~~~~L~~~~~~~~~~~~~~~~~~~~~~~~i~~~l~~lH~~~~~~i~h~dl~p~nil~~~  168 (206)
                      .+       .+ ..+||+||+++|+|.+++...... +++|..+..||.++|+||.|||+....+|+||||||+|||+|+
T Consensus       141 ~e-------~~~~~~LVYEym~nGsL~d~L~~~~~~-~L~W~~R~kIa~g~A~gL~yLH~~~~~~iiHrDiKssNILLD~  212 (361)
T KOG1187|consen  141 LE-------GGEHRLLVYEYMPNGSLEDHLHGKKGE-PLDWETRLKIALGAARGLAYLHEGCPPPIIHRDIKSSNILLDE  212 (361)
T ss_pred             ec-------CCceEEEEEEccCCCCHHHHhCCCCCC-CCCHHHHHHHHHHHHHHHHHHccCCCCCEecCCCCHHHeeECC
Confidence            86       44 599999999999999999876532 7899999999999999999999976568999999999999999


Q ss_pred             CCceeEccCCccccccc-ccccccc-ccCccccCCCCCC
Q 028629          169 NLVAKISSYNLPLLAEN-AEKVGHV-TPYSGSINPTNSA  205 (206)
Q Consensus       169 ~~~~kl~df~~a~~~~~-~~~~~~~-~~~~~y~aPE~~~  205 (206)
                      ++++||+|||+|+.... ....... .||.||+||||..
T Consensus       213 ~~~aKlsDFGLa~~~~~~~~~~~~~~~gt~gY~~PEy~~  251 (361)
T KOG1187|consen  213 DFNAKLSDFGLAKLGPEGDTSVSTTVMGTFGYLAPEYAS  251 (361)
T ss_pred             CCCEEccCccCcccCCccccceeeecCCCCccCChhhhc
Confidence            99999999999976654 3333333 8999999999874



>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>KOG3087 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>KOG3741 consensus Poly(A) ribonuclease subunit [RNA processing and modification] Back     alignment and domain information
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PRK09902 hypothetical protein; Provisional Back     alignment and domain information
>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>KOG1266 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY) Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1235 consensus Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172 Back     alignment and domain information
>PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily Back     alignment and domain information
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12260 PIP49_C: Protein-kinase domain of FAM69; InterPro: IPR022049 Family with sequence similarity 69 has three members (A, B and C) Back     alignment and domain information
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH) Back     alignment and domain information
>PLN02876 acyl-CoA dehydrogenase Back     alignment and domain information
>COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only] Back     alignment and domain information
>cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes Back     alignment and domain information
>TIGR02721 ycfN_thiK thiamine kinase Back     alignment and domain information
>cd05155 APH_ChoK_like_1 Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members Back     alignment and domain information
>cd05153 HomoserineK_II Homoserine Kinase, type II Back     alignment and domain information
>PF10707 YrbL-PhoP_reg: PhoP regulatory network protein YrbL; InterPro: IPR019647 This entry represents proteins that are activated by the protein PhoP Back     alignment and domain information
>PRK05231 homoserine kinase; Provisional Back     alignment and domain information
>KOG2270 consensus Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2268 consensus Serine/threonine protein kinase [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>cd05156 ChoK_euk Choline Kinase (ChoK) in eukaryotes Back     alignment and domain information
>TIGR00938 thrB_alt homoserine kinase, Neisseria type Back     alignment and domain information
>PRK10593 hypothetical protein; Provisional Back     alignment and domain information
>PRK09550 mtnK methylthioribose kinase; Reviewed Back     alignment and domain information
>PF13095 FTA2: Kinetochore Sim4 complex subunit FTA2 Back     alignment and domain information
>PLN02236 choline kinase Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>cd05152 MPH2' Macrolide 2'-Phosphotransferase (MPH2') Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>PLN02421 phosphotransferase, alcohol group as acceptor/kinase Back     alignment and domain information
>COG3173 Predicted aminoglycoside phosphotransferase [General function prediction only] Back     alignment and domain information
>TIGR01767 MTRK 5-methylthioribose kinase Back     alignment and domain information
>PRK11768 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PLN02756 S-methyl-5-thioribose kinase Back     alignment and domain information
>COG2334 Putative homoserine kinase type II (protein kinase fold) [General function prediction only] Back     alignment and domain information
>PRK12396 5-methylribose kinase; Reviewed Back     alignment and domain information
>PTZ00384 choline kinase; Provisional Back     alignment and domain information
>COG5072 ALK1 Serine/threonine kinase of the haspin family [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK06148 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00296 choline kinase; Provisional Back     alignment and domain information
>PHA03111 Ser/Thr kinase; Provisional Back     alignment and domain information
>PRK10271 thiK thiamine kinase; Provisional Back     alignment and domain information
>PF03881 Fructosamin_kin: Fructosamine kinase; InterPro: IPR016477 Ketosamines derive from a non-enzymatic reaction between a sugar and a protein [] Back     alignment and domain information
>PF01633 Choline_kinase: Choline/ethanolamine kinase; InterPro: IPR002573 Choline kinase, (ATP:choline phosphotransferase, 2 Back     alignment and domain information
>PF05445 Pox_ser-thr_kin: Poxvirus serine/threonine protein kinase; InterPro: IPR008790 This family of proteins contain poxvirus serine/threonine protein kinases, which are essential for phosphorylation of virion proteins during virion assembly Back     alignment and domain information
>COG0510 ycfN Thiamine kinase and related kinases [Coenzyme transport and metabolism] Back     alignment and domain information
>PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] Back     alignment and domain information
>TIGR02906 spore_CotS spore coat protein, CotS family Back     alignment and domain information
>smart00587 CHK ZnF_C4 abd HLH domain containing kinases domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query206
3tl8_A 349 The Avrptob-Bak1 Complex Reveals Two Structurally S 1e-21
3hgk_A 327 Crystal Structure Of Effect Protein Avrptob Complex 2e-21
2qkw_B 321 Structural Basis For Activation Of Plant Immunity B 2e-21
3uim_A 326 Structural Basis For The Impact Of Phosphorylation 3e-21
2nry_A 307 Crystal Structure Of Irak-4 Length = 307 2e-16
2oib_A 301 Crystal Structure Of Irak4 Kinase Domain Apo Form L 2e-16
2nru_A 307 Crystal Structure Of Irak-4 Length = 307 2e-16
2o8y_A 298 Apo Irak4 Kinase Domain Length = 298 4e-15
3p86_A309 Crystal Structure Of Ctr1 Kinase Domain Mutant D676 9e-10
3ppz_A309 Crystal Structure Of Ctr1 Kinase Domain In Complex 2e-09
3g6h_A286 Src Thr338ile Inhibited In The Dfg-Asp-Out Conforma 1e-08
3dqw_A286 C-Src Kinase Domain Thr338ile Mutant In Complex Wit 1e-08
2qq7_A286 Crystal Structure Of Drug Resistant Src Kinase Doma 1e-08
2qoo_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 1e-08
2bdf_A279 Src Kinase In Complex With Inhibitor Ap23451 Length 1e-08
2qok_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 1e-08
2qoi_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 2e-08
3u4w_A275 Src In Complex With Dna-Templated Macrocyclic Inhib 2e-08
3svv_A286 Crystal Structure Of T338c C-Src Covalently Bound T 2e-08
2qof_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f 2e-08
1fmk_A452 Crystal Structure Of Human Tyrosine-Protein Kinase 2e-08
3d7u_B277 Structural Basis For The Recognition Of C-Src By It 2e-08
2oiq_A286 Crystal Structure Of Chicken C-Src Kinase Domain In 2e-08
1y57_A452 Structure Of Unphosphorylated C-Src In Complex With 2e-08
2h8h_A535 Src Kinase In Complex With A Quinazoline Inhibitor 2e-08
2qol_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596:y 2e-08
1ksw_A452 Structure Of Human C-Src Tyrosine Kinase (Thr338gly 3e-08
2hwo_A286 Crystal Structure Of Src Kinase Domain In Complex W 3e-08
2qod_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y602f 3e-08
3oez_A286 Crystal Structure Of The L317i Mutant Of The Chicke 4e-08
3geq_A286 Structural Basis For The Chemical Rescue Of Src Kin 4e-08
3fxx_A 371 Human Epha3 Kinase And Juxtamembrane Region Bound T 4e-08
2gsf_A 373 The Human Epha3 Receptor Tyrosine Kinase And Juxtam 4e-08
2ptk_A453 Chicken Src Tyrosine Kinase Length = 453 5e-08
1yi6_A276 C-Term Tail Segment Of Human Tyrosine Kinase (258-5 5e-08
1yol_A283 Crystal Structure Of Src Kinase Domain In Complex W 5e-08
3kmw_A271 Crystal Structure Of The IlkALPHA-Parvin Core Compl 6e-08
1yoj_A283 Crystal Structure Of Src Kinase Domain Length = 283 6e-08
3coh_A268 Crystal Structure Of Aurora-A In Complex With A Pen 6e-08
2wqb_A 324 Structure Of The Tie2 Kinase Domain In Complex With 6e-08
3dzq_A 361 Human Epha3 Kinase Domain In Complex With Inhibitor 1e-07
2qon_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 1e-07
2qoc_A 344 Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp 1e-07
2oo8_X 317 Synthesis, Structural Analysis, And Sar Studies Of 2e-07
1fvr_A 327 Tie2 Kinase Domain Length = 327 2e-07
2dq7_X 283 Crystal Structure Of Fyn Kinase Domain Complexed Wi 2e-07
4asz_A299 Crystal Structure Of Apo Trkb Kinase Domain Length 3e-07
2j4z_A306 Structure Of Aurora-2 In Complex With Pha-680626 Le 4e-07
2bmc_A306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 4e-07
2qo7_A 373 Human Epha3 Kinase And Juxtamembrane Region, Dephos 4e-07
3lxn_A 318 Structural And Thermodynamic Characterization Of Th 4e-07
1muo_A297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 5e-07
3lau_A287 Crystal Structure Of Aurora2 Kinase In Complex With 5e-07
2xng_A283 Structure Of Aurora-A Bound To A Selective Imidazop 5e-07
1ol5_A282 Structure Of Aurora-A 122-403, Phosphorylated On Th 6e-07
2xru_A280 Aurora-A T288e Complexed With Pha-828300 Length = 2 6e-07
2c6d_A275 Aurora A Kinase Activated Mutant (T287d) In Complex 6e-07
2x6d_A285 Aurora-A Bound To An Inhibitor Length = 285 6e-07
3h0y_A268 Aurora A In Complex With A Bisanilinopyrimidine Len 6e-07
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 6e-07
3nrm_A283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 6e-07
3fdn_A279 Structure-Based Drug Design Of Novel Aurora Kinase 6e-07
2j50_A280 Structure Of Aurora-2 In Complex With Pha-739358 Le 6e-07
2w1c_A275 Structure Determination Of Aurora Kinase In Complex 6e-07
3o50_A267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 6e-07
2dwb_A285 Aurora-A Kinase Complexed With Amppnp Length = 285 6e-07
3qbn_A281 Structure Of Human Aurora A In Complex With A Diami 6e-07
3r21_A271 Design, Synthesis, And Biological Evaluation Of Pyr 6e-07
2w1d_A275 Structure Determination Of Aurora Kinase In Complex 6e-07
3e5a_A268 Crystal Structure Of Aurora A In Complex With Vx-68 7e-07
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 7e-07
2c6e_A283 Aurora A Kinase Activated Mutant (T287d) In Complex 7e-07
3ha6_A268 Crystal Structure Of Aurora A In Complex With Tpx2 7e-07
3kmu_A271 Crystal Structure Of The IlkALPHA-Parvin Core Compl 8e-07
2wtv_A285 Aurora-A Inhibitor Structure Length = 285 9e-07
1ol6_A282 Structure Of Unphosphorylated D274n Mutant Of Auror 9e-07
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 9e-07
2xne_A272 Structure Of Aurora-A Bound To An Imidazopyrazine I 1e-06
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 1e-06
3nyx_A 302 Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-T 1e-06
2qob_A 344 Human Epha3 Kinase Domain, Base Structure Length = 1e-06
3nz0_A 302 Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 3 1e-06
2hel_A 306 Crystal Structure Of A Mutant Epha4 Kinase Domain ( 1e-06
3d14_A272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 2e-06
3daj_A272 Crystal Structure Of Aurora A Complexed With An Inh 2e-06
2r2p_A295 Kinase Domain Of Human Ephrin Type-A Receptor 5 (Ep 3e-06
2bfx_B284 Mechanism Of Aurora-B Activation By Incenp And Inhi 4e-06
2vrx_A285 Structure Of Aurora B Kinase In Complex With Zm4474 4e-06
2bfy_A284 Complex Of Aurora-B With Incenp And Hesperidin. Len 5e-06
1jpa_A 312 Crystal Structure Of Unphosphorylated Ephb2 Recepto 6e-06
2y6m_A 291 Crystal Structure Of Epha4 Kinase Domain Length = 2 8e-06
1mqb_A 333 Crystal Structure Of Ephrin A2 (Epha2) Receptor Pro 9e-06
2xyu_A 285 Crystal Structure Of Epha4 Kinase Domain In Complex 9e-06
2xa4_A 298 Inhibitors Of Jak2 Kinase Domain Length = 298 1e-05
3kul_A 325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 1e-05
4e1z_A 291 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 1e-05
2rei_A318 Kinase Domain Of Human Ephrin Type-a Receptor 7 (ep 1e-05
4e20_A 290 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 1e-05
3a4o_X 286 Lyn Kinase Domain Length = 286 1e-05
4bbe_A 298 Aminoalkylpyrimidine Inhibitor Complexes With Jak2 1e-05
3sxr_A268 Crystal Structure Of Bmx Non-Receptor Tyrosine Kina 2e-05
3kul_B 325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 2e-05
2zv7_A279 Lyn Tyrosine Kinase Domain, Apo Form Length = 279 2e-05
4aoj_A329 Human Trka In Complex With The Inhibitor Az-23 Leng 3e-05
3qgw_A286 Crystal Structure Of Itk Kinase Bound To An Inhibit 3e-05
4aw5_A 291 Complex Of The Ephb4 Kinase Domain With An Oxindole 3e-05
4f0i_A300 Crystal Structure Of Apo Trka Length = 300 3e-05
4gt5_A306 Crystal Structure Of The Inactive Trka Kinase Domai 3e-05
2vwu_A 302 Ephb4 Kinase Domain Inhibitor Complex Length = 302 4e-05
3tjc_A 298 Co-Crystal Structure Of Jak2 With Thienopyridine 8 4e-05
4aqc_A 301 Triazolopyridine-Based Inhibitor Of Janus Kinase 2 4e-05
4e4m_A 302 Jak2 Kinase (Jh1 Domain) In Complex With Compound 3 4e-05
4hge_A 300 Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 4e-05
3rvg_A 303 Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido 4e-05
3q32_A 301 Structure Of Janus Kinase 2 With A Pyrrolotriazine 4e-05
2w1i_A 326 Structure Determination Of Aurora Kinase In Complex 4e-05
3e62_A 293 Fragment Based Discovery Of Jak-2 Inhibitors Length 4e-05
2b7a_A 293 The Structural Basis Of Janus Kinase 2 Inhibition B 4e-05
3io7_A 313 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Sel 4e-05
3lpb_A 295 Crystal Structure Of Jak2 Complexed With A Potent 2 4e-05
3ugc_A 295 Structural Basis Of Jak2 Inhibition By The Type Ii 4e-05
3jy9_A 311 Janus Kinase 2 Inhibitors Length = 311 4e-05
2jed_A 352 The Crystal Structure Of The Kinase Domain Of The P 5e-05
3txo_A 353 Pkc Eta Kinase In Complex With A Naphthyridine Leng 5e-05
1ua2_A 346 Crystal Structure Of Human Cdk7 Length = 346 7e-05
3miy_A266 X-Ray Crystal Structure Of Itk Complexed With Sunit 7e-05
3s95_A 310 Crystal Structure Of The Human Limk1 Kinase Domain 7e-05
3v5j_A266 Crystal Structure Of Interleukin-2 Inducible T-Cell 7e-05
3k54_A283 Structures Of Human Bruton's Tyrosine Kinase In Act 7e-05
1sm2_A264 Crystal Structure Of The Phosphorylated Interleukin 8e-05
4hct_A269 Crystal Structure Of Itk In Complex With Compound 5 8e-05
3gvu_A292 The Crystal Structure Of Human Abl2 In Complex With 8e-05
2hen_A 286 Crystal Structure Of The Ephb2 Receptor Kinase Doma 1e-04
4e6d_A 298 Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex W 1e-04
4af3_A292 Human Aurora B Kinase In Complex With Incenp And Vx 1e-04
3gen_A283 The 1.6 A Crystal Structure Of Human Bruton's Tyros 1e-04
1k2p_A263 Crystal Structure Of Bruton's Tyrosine Kinase Domai 1e-04
3pix_A274 Crystal Structure Of Btk Kinase Domain Complexed Wi 1e-04
3ocs_A271 Crystal Structure Of Bruton's Tyrosine Kinase In Co 2e-04
3oct_A265 Crystal Structure Of Bruton's Tyrosine Kinase Mutan 2e-04
3p08_A267 Crystal Structure Of The Human Btk Kinase Domain Le 2e-04
3iw4_A 360 Crystal Structure Of Pkc Alpha In Complex With Nvp- 2e-04
3v5q_A297 Discovery Of A Selective Trk Inhibitor With Efficac 2e-04
1xjd_A 345 Crystal Structure Of Pkc-Theta Complexed With Staur 2e-04
2ivv_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 5e-04
3dk7_A277 Crystal Structure Of Mutant Abl Kinase Domain In Co 5e-04
2ivs_A314 Crystal Structure Of Non-Phosphorylated Ret Tyrosin 5e-04
2ivt_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 6e-04
2a19_B284 Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Leng 6e-04
3t9t_A267 Crystal Structure Of Btk Mutant (F435t,K596r) Compl 8e-04
3vw6_A269 Crystal Structure Of Human Apoptosis Signal-Regulat 8e-04
2clq_A295 Structure Of Mitogen-Activated Protein Kinase Kinas 9e-04
>pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 Back     alignment and structure

Iteration: 1

Score = 99.8 bits (247), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 57/194 (29%), Positives = 98/194 (50%), Gaps = 18/194 (9%) Query: 12 RTFSLEELEEATNNFDTSAFMGEGSKGQMYRGRLKNGTFIAIRCLKMKKSHSTR-NFMHH 70 + FSL EL+ A++NF +G G G++Y+GRL +GT +A++ LK ++ F Sbjct: 26 KRFSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGTLVAVKRLKEERXQGGELQFQTE 85 Query: 71 IELISKLRHCHLVSALGHCFECYFDDSSVSRIFLIFEYVPNGTLRSWISEGHAWQ-SLTW 129 +E+IS H +L+ G C + + L++ Y+ NG++ S + E Q L W Sbjct: 86 VEMISMAVHRNLLRLRGFCM-------TPTERLLVYPYMANGSVASCLRERPESQPPLDW 138 Query: 130 TQRISAAIGVARGIQFLHTGIVPGVFSNNLKITDILLDQNLVAKISSYNLPLLAENAEK- 188 +R A+G ARG+ +LH P + ++K +ILLD+ A + + L L + + Sbjct: 139 PKRQRIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDXH 198 Query: 189 --------VGHVTP 194 +GH+ P Sbjct: 199 VXXAVRGTIGHIAP 212
>pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 Back     alignment and structure
>pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 Back     alignment and structure
>pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 Back     alignment and structure
>pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 Back     alignment and structure
>pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 Back     alignment and structure
>pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|3G6H|A Chain A, Src Thr338ile Inhibited In The Dfg-Asp-Out Conformation Length = 286 Back     alignment and structure
>pdb|3DQW|A Chain A, C-Src Kinase Domain Thr338ile Mutant In Complex With Atpgs Length = 286 Back     alignment and structure
>pdb|2QQ7|A Chain A, Crystal Structure Of Drug Resistant Src Kinase Domain With Irreversible Inhibitor Length = 286 Back     alignment and structure
>pdb|2QOO|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742f Triple Mutant Length = 373 Back     alignment and structure
>pdb|2BDF|A Chain A, Src Kinase In Complex With Inhibitor Ap23451 Length = 279 Back     alignment and structure
>pdb|2QOK|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:s768a Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QOI|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f Double Mutant Length = 373 Back     alignment and structure
>pdb|3U4W|A Chain A, Src In Complex With Dna-Templated Macrocyclic Inhibitor Mc4b Length = 275 Back     alignment and structure
>pdb|3SVV|A Chain A, Crystal Structure Of T338c C-Src Covalently Bound To Vinylsulfonamide- Pyrazolopyrimidine 9 Length = 286 Back     alignment and structure
>pdb|2QOF|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f Mutant Length = 373 Back     alignment and structure
>pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 Back     alignment and structure
>pdb|3D7U|B Chain B, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 277 Back     alignment and structure
>pdb|2OIQ|A Chain A, Crystal Structure Of Chicken C-Src Kinase Domain In Complex With The Cancer Drug Imatinib. Length = 286 Back     alignment and structure
>pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 Back     alignment and structure
>pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 Back     alignment and structure
>pdb|2QOL|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596:y602:s768g Triple Mutant Length = 373 Back     alignment and structure
>pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 Back     alignment and structure
>pdb|2HWO|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Covalent Inhibitor Length = 286 Back     alignment and structure
>pdb|2QOD|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y602f Mutant Length = 373 Back     alignment and structure
>pdb|3OEZ|A Chain A, Crystal Structure Of The L317i Mutant Of The Chicken C-Src Tyrosine Kinase Domain Complexed With Imatinib Length = 286 Back     alignment and structure
>pdb|3GEQ|A Chain A, Structural Basis For The Chemical Rescue Of Src Kinase Activity Length = 286 Back     alignment and structure
>pdb|3FXX|A Chain A, Human Epha3 Kinase And Juxtamembrane Region Bound To Substrate Kqwdnye[ptyr]iw Length = 371 Back     alignment and structure
>pdb|2GSF|A Chain A, The Human Epha3 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 373 Back     alignment and structure
>pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 Back     alignment and structure
>pdb|1YI6|A Chain A, C-Term Tail Segment Of Human Tyrosine Kinase (258-533) Length = 276 Back     alignment and structure
>pdb|1YOL|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Cgp77675 Length = 283 Back     alignment and structure
>pdb|3KMW|A Chain A, Crystal Structure Of The IlkALPHA-Parvin Core Complex (Mgatp) Length = 271 Back     alignment and structure
>pdb|1YOJ|A Chain A, Crystal Structure Of Src Kinase Domain Length = 283 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|2WQB|A Chain A, Structure Of The Tie2 Kinase Domain In Complex With A Thiazolopyrimidine Inhibitor Length = 324 Back     alignment and structure
>pdb|3DZQ|A Chain A, Human Epha3 Kinase Domain In Complex With Inhibitor Awl-Ii- 38.3 Length = 361 Back     alignment and structure
>pdb|2QON|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742a Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 Back     alignment and structure
>pdb|2OO8|X Chain X, Synthesis, Structural Analysis, And Sar Studies Of Triazine Derivatives As Potent, Selective Tie-2 Inhibitors Length = 317 Back     alignment and structure
>pdb|1FVR|A Chain A, Tie2 Kinase Domain Length = 327 Back     alignment and structure
>pdb|2DQ7|X Chain X, Crystal Structure Of Fyn Kinase Domain Complexed With Staurosporine Length = 283 Back     alignment and structure
>pdb|4ASZ|A Chain A, Crystal Structure Of Apo Trkb Kinase Domain Length = 299 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|2QO7|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Dephosphorylated, Amp-Pnp Bound Length = 373 Back     alignment and structure
>pdb|3LXN|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 318 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|3KMU|A Chain A, Crystal Structure Of The IlkALPHA-Parvin Core Complex (Apo) Length = 271 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|3NYX|A Chain A, Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-Thiadiazole- Thiophene Inhibitor Length = 302 Back     alignment and structure
>pdb|2QOB|A Chain A, Human Epha3 Kinase Domain, Base Structure Length = 344 Back     alignment and structure
>pdb|3NZ0|A Chain A, Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 302 Back     alignment and structure
>pdb|2HEL|A Chain A, Crystal Structure Of A Mutant Epha4 Kinase Domain (Y742a) Length = 306 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|2R2P|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 5 (Epha5) Length = 295 Back     alignment and structure
>pdb|2VRX|A Chain A, Structure Of Aurora B Kinase In Complex With Zm447439 Length = 285 Back     alignment and structure
>pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 Back     alignment and structure
>pdb|1JPA|A Chain A, Crystal Structure Of Unphosphorylated Ephb2 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 312 Back     alignment and structure
>pdb|2Y6M|A Chain A, Crystal Structure Of Epha4 Kinase Domain Length = 291 Back     alignment and structure
>pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (Epha2) Receptor Protein Kinase Length = 333 Back     alignment and structure
>pdb|2XYU|A Chain A, Crystal Structure Of Epha4 Kinase Domain In Complex With Vuf 12058 Length = 285 Back     alignment and structure
>pdb|2XA4|A Chain A, Inhibitors Of Jak2 Kinase Domain Length = 298 Back     alignment and structure
>pdb|3KUL|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|4E1Z|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 291 Back     alignment and structure
>pdb|2REI|A Chain A, Kinase Domain Of Human Ephrin Type-a Receptor 7 (epha7) Length = 318 Back     alignment and structure
>pdb|4E20|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 290 Back     alignment and structure
>pdb|3A4O|X Chain X, Lyn Kinase Domain Length = 286 Back     alignment and structure
>pdb|4BBE|A Chain A, Aminoalkylpyrimidine Inhibitor Complexes With Jak2 Length = 298 Back     alignment and structure
>pdb|3SXR|A Chain A, Crystal Structure Of Bmx Non-Receptor Tyrosine Kinase Complex With Dasatinib Length = 268 Back     alignment and structure
>pdb|3KUL|B Chain B, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|2ZV7|A Chain A, Lyn Tyrosine Kinase Domain, Apo Form Length = 279 Back     alignment and structure
>pdb|4AOJ|A Chain A, Human Trka In Complex With The Inhibitor Az-23 Length = 329 Back     alignment and structure
>pdb|3QGW|A Chain A, Crystal Structure Of Itk Kinase Bound To An Inhibitor Length = 286 Back     alignment and structure
>pdb|4AW5|A Chain A, Complex Of The Ephb4 Kinase Domain With An Oxindole Inhibitor Length = 291 Back     alignment and structure
>pdb|4F0I|A Chain A, Crystal Structure Of Apo Trka Length = 300 Back     alignment and structure
>pdb|4GT5|A Chain A, Crystal Structure Of The Inactive Trka Kinase Domain Length = 306 Back     alignment and structure
>pdb|2VWU|A Chain A, Ephb4 Kinase Domain Inhibitor Complex Length = 302 Back     alignment and structure
>pdb|3TJC|A Chain A, Co-Crystal Structure Of Jak2 With Thienopyridine 8 Length = 298 Back     alignment and structure
>pdb|4AQC|A Chain A, Triazolopyridine-Based Inhibitor Of Janus Kinase 2 Length = 301 Back     alignment and structure
>pdb|4E4M|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|4HGE|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 Length = 300 Back     alignment and structure
>pdb|3RVG|A Chain A, Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido[4,3-B]indol-4- Carboxamide Inhibitor Length = 303 Back     alignment and structure
>pdb|3Q32|A Chain A, Structure Of Janus Kinase 2 With A Pyrrolotriazine Inhibitor Length = 301 Back     alignment and structure
>pdb|2W1I|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 326 Back     alignment and structure
>pdb|3E62|A Chain A, Fragment Based Discovery Of Jak-2 Inhibitors Length = 293 Back     alignment and structure
>pdb|2B7A|A Chain A, The Structural Basis Of Janus Kinase 2 Inhibition By A Potent And Specific Pan-Janus Kinase Inhibitor Length = 293 Back     alignment and structure
>pdb|3IO7|A Chain A, 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Selective Inhibitors Of Jak2 Length = 313 Back     alignment and structure
>pdb|3LPB|A Chain A, Crystal Structure Of Jak2 Complexed With A Potent 2,8-Diaryl Quinoxaline Inhibitor Length = 295 Back     alignment and structure
>pdb|3UGC|A Chain A, Structural Basis Of Jak2 Inhibition By The Type Ii Inhibtor Nvp-Bbt594 Length = 295 Back     alignment and structure
>pdb|3JY9|A Chain A, Janus Kinase 2 Inhibitors Length = 311 Back     alignment and structure
>pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 Back     alignment and structure
>pdb|3TXO|A Chain A, Pkc Eta Kinase In Complex With A Naphthyridine Length = 353 Back     alignment and structure
>pdb|1UA2|A Chain A, Crystal Structure Of Human Cdk7 Length = 346 Back     alignment and structure
>pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 Back     alignment and structure
>pdb|3S95|A Chain A, Crystal Structure Of The Human Limk1 Kinase Domain In Complex With Staurosporine Length = 310 Back     alignment and structure
>pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 Back     alignment and structure
>pdb|3K54|A Chain A, Structures Of Human Bruton's Tyrosine Kinase In Active And Inactive Conformations Suggests A Mechanism Of Activation For Tec Family Kinases Length = 283 Back     alignment and structure
>pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 Back     alignment and structure
>pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 Back     alignment and structure
>pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 Back     alignment and structure
>pdb|2HEN|A Chain A, Crystal Structure Of The Ephb2 Receptor Kinase Domain In Complex With Adp Length = 286 Back     alignment and structure
>pdb|4E6D|A Chain A, Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex With Compound 7 Length = 298 Back     alignment and structure
>pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 Back     alignment and structure
>pdb|3GEN|A Chain A, The 1.6 A Crystal Structure Of Human Bruton's Tyrosine Kinase Bound To A Pyrrolopyrimidine-Containing Compound Length = 283 Back     alignment and structure
>pdb|1K2P|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Domain Length = 263 Back     alignment and structure
>pdb|3PIX|A Chain A, Crystal Structure Of Btk Kinase Domain Complexed With 2-Isopropyl-7- (4-Methyl-Piperazin-1-Yl)-4-(5-Methyl-2h-Pyrazol-3- Ylamino)-2h- Phthalazin-1-One Length = 274 Back     alignment and structure
>pdb|3OCS|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase In Complex With Inhibitor Cgi1746 Length = 271 Back     alignment and structure
>pdb|3OCT|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Mutant V555r In Complex With Dasatinib Length = 265 Back     alignment and structure
>pdb|3P08|A Chain A, Crystal Structure Of The Human Btk Kinase Domain Length = 267 Back     alignment and structure
>pdb|3IW4|A Chain A, Crystal Structure Of Pkc Alpha In Complex With Nvp-Aeb071 Length = 360 Back     alignment and structure
>pdb|3V5Q|A Chain A, Discovery Of A Selective Trk Inhibitor With Efficacy In Rodent Cancer Tumor Models Length = 297 Back     alignment and structure
>pdb|1XJD|A Chain A, Crystal Structure Of Pkc-Theta Complexed With Staurosporine At 2a Resolution Length = 345 Back     alignment and structure
>pdb|2IVV|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Complexed With The Inhibitor Pp1 Length = 314 Back     alignment and structure
>pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 Back     alignment and structure
>pdb|2IVS|A Chain A, Crystal Structure Of Non-Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|2IVT|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|2A19|B Chain B, Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Length = 284 Back     alignment and structure
>pdb|3T9T|A Chain A, Crystal Structure Of Btk Mutant (F435t,K596r) Complexed With Imidazo[1,5-A]quinoxaline Length = 267 Back     alignment and structure
>pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 Back     alignment and structure
>pdb|2CLQ|A Chain A, Structure Of Mitogen-Activated Protein Kinase Kinase Kinase 5 Length = 295 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query206
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 8e-50
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 7e-43
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 4e-36
3soc_A 322 Activin receptor type-2A; structural genomics cons 8e-29
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 3e-24
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 8e-21
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 3e-20
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 6e-20
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 2e-19
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 1e-17
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 2e-17
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 3e-17
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 4e-17
3q4u_A 301 Activin receptor type-1; structural genomics conso 5e-17
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 9e-16
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 4e-15
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 5e-15
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 3e-14
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 4e-13
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 6e-13
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 1e-12
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 1e-12
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 1e-12
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 2e-12
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 2e-12
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 3e-12
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 3e-12
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 4e-12
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 4e-12
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 5e-12
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 5e-12
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 5e-12
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 5e-12
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 5e-12
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 9e-12
4aoj_A329 High affinity nerve growth factor receptor; transf 1e-11
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 2e-11
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 2e-11
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 3e-11
3pls_A 298 Macrophage-stimulating protein receptor; protein k 3e-11
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 4e-11
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 5e-11
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 8e-11
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 1e-10
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 1e-10
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 1e-10
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 1e-10
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 2e-10
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 2e-10
3v5q_A297 NT-3 growth factor receptor; kinase domain, kinase 3e-10
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 3e-10
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 3e-10
3zzw_A289 Tyrosine-protein kinase transmembrane receptor RO; 4e-10
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 4e-10
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 4e-10
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 4e-10
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 6e-10
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 6e-10
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 7e-10
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 7e-10
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 8e-10
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 8e-10
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 1e-09
2xir_A316 Vascular endothelial growth factor receptor 2; ang 1e-09
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 1e-09
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 2e-09
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 2e-09
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 2e-09
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 4e-09
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 5e-09
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 5e-09
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 6e-09
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 7e-09
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 7e-09
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 7e-09
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 8e-09
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 1e-08
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 2e-08
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 2e-08
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 4e-08
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 5e-08
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 5e-08
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 6e-08
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 6e-08
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 4e-07
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 7e-07
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 1e-06
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 1e-06
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 1e-06
2a19_B284 Interferon-induced, double-stranded RNA-activated 2e-06
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 2e-06
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 4e-06
4apc_A 350 Serine/threonine-protein kinase NEK1; transferase; 1e-05
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 1e-05
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 1e-05
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 5e-05
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 1e-04
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 1e-04
2vuw_A 336 Serine/threonine-protein kinase haspin; cell cycle 2e-04
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 2e-04
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 3e-04
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 3e-04
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 3e-04
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 6e-04
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 6e-04
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
 Score =  163 bits (414), Expect = 8e-50
 Identities = 61/183 (33%), Positives = 96/183 (52%), Gaps = 12/183 (6%)

Query: 12  RTFSLEELEEATNNFDTSAFMGEGSKGQMYRGRLKNGTFIAIRCLKMKKSHSTRNFMHHI 71
               L +LEEATNNFD    +G G  G++Y+G L++G  +A++    + S     F   I
Sbjct: 27  YRVPLVDLEEATNNFDHKFLIGHGVFGKVYKGVLRDGAKVALKRRTPESSQGIEEFETEI 86

Query: 72  ELISKLRHCHLVSALGHCFECYFDDSSVSRIFLIFEYVPNGTLRSWIS-EGHAWQSLTWT 130
           E +S  RH HLVS +G C E          I LI++Y+ NG L+  +        S++W 
Sbjct: 87  ETLSFCRHPHLVSLIGFCDE------RNEMI-LIYKYMENGNLKRHLYGSDLPTMSMSWE 139

Query: 131 QRISAAIGVARGIQFLHTGIVPGVFSNNLKITDILLDQNLVAKISSYNLPLLAENAEKVG 190
           QR+   IG ARG+ +LHT     +   ++K  +ILLD+N V KI+ + +       ++  
Sbjct: 140 QRLEICIGAARGLHYLHTR---AIIHRDVKSINILLDENFVPKITDFGISKKGTELDQ-T 195

Query: 191 HVT 193
           H++
Sbjct: 196 HLS 198


>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Length = 336 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query206
4b9d_A 350 Serine/threonine-protein kinase NEK1; transferase, 100.0
4fih_A 346 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
4aw0_A 311 HPDK1, 3-phosphoinositide-dependent protein kinase 100.0
4fie_A 423 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 100.0
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 100.0
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 100.0
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
4aoj_A329 High affinity nerve growth factor receptor; transf 100.0
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 100.0
3ubd_A 304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 100.0
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 100.0
3hmm_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
4ase_A353 Vascular endothelial growth factor receptor 2; tra 100.0
4b99_A 398 Mitogen-activated protein kinase 7; transferase, i 100.0
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 100.0
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 100.0
4f9c_A 361 Cell division cycle 7-related protein kinase; Ser/ 100.0
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 100.0
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 100.0
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 100.0
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 100.0
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 100.0
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 100.0
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 100.0
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 100.0
3zgw_A 347 Maternal embryonic leucine zipper kinase; transfer 100.0
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 100.0
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 100.0
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 100.0
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 100.0
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 100.0
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 100.0
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 100.0
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 100.0
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 100.0
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 100.0
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 100.0
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 100.0
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 100.0
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 100.0
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 100.0
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 100.0
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 100.0
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 100.0
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 100.0
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 100.0
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 100.0
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 100.0
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 100.0
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 100.0
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 100.0
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 100.0
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 100.0
3o0g_A 292 Cell division protein kinase 5; kinase activator c 100.0
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 100.0
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 100.0
3niz_A 311 Rhodanese family protein; structural genomics, str 100.0
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 100.0
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 100.0
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 100.0
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 100.0
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 100.0
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 100.0
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 100.0
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 100.0
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 100.0
3soc_A 322 Activin receptor type-2A; structural genomics cons 100.0
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 100.0
3rp9_A 458 Mitogen-activated protein kinase; structural genom 100.0
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 100.0
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 100.0
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 100.0
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 100.0
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 99.98
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 99.98
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.98
2eue_A275 Carbon catabolite derepressing protein kinase; kin 99.98
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 99.98
3q4u_A 301 Activin receptor type-1; structural genomics conso 99.98
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 99.98
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.98
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 99.98
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 99.98
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 99.98
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 99.98
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 99.98
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.98
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.98
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 99.98
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 99.98
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 99.98
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 99.98
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 99.98
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 99.98
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 99.98
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 99.98
3ork_A 311 Serine/threonine protein kinase; structural genomi 99.98
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 99.98
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 99.98
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.98
3bhy_A283 Death-associated protein kinase 3; death associate 99.98
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 99.97
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.97
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.97
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.97
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 99.97
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.97
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.97
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.97
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 99.97
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 99.97
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.97
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.97
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 99.97
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 99.97
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.97
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.97
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.97
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 99.97
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 99.97
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 99.97
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 99.97
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.97
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.97
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 99.97
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.97
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 99.97
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 99.97
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 99.97
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 99.97
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.97
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.97
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 99.97
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 99.97
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 99.97
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.97
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 99.97
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 99.97
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.97
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 99.97
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.97
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 99.97
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 99.97
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 99.97
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.97
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 99.97
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.97
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.97
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.97
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 99.97
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.97
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 99.97
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 99.97
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.97
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.97
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.97
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 99.97
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 99.97
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 99.97
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.97
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 99.97
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.97
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 99.97
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 99.97
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.97
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 99.97
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 99.97
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 99.97
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 99.97
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.97
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.97
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 99.97
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 99.97
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 99.97
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.97
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.97
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 99.97
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.97
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 99.97
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.97
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 99.97
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 99.97
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.97
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 99.97
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.97
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 99.97
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.97
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.97
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.97
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.97
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.97
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 99.97
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.97
1csn_A 298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.97
3fme_A 290 Dual specificity mitogen-activated protein kinase; 99.97
2xir_A316 Vascular endothelial growth factor receptor 2; ang 99.97
3an0_A 340 Dual specificity mitogen-activated protein kinase; 99.97
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.97
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 99.97
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.97
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 99.97
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 99.97
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 99.97
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.97
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.97
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.97
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.97
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 99.97
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.97
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 99.97
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.97
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 99.97
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.97
3pls_A298 Macrophage-stimulating protein receptor; protein k 99.97
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.97
4exu_A 371 Mitogen-activated protein kinase 13; P38 kinase, t 99.97
2v62_A 345 Serine/threonine-protein kinase VRK2; transferase, 99.97
3aln_A 327 Dual specificity mitogen-activated protein kinase; 99.97
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.96
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.96
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.96
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.96
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 99.96
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.96
2jii_A 352 Serine/threonine-protein kinase VRK3 molecule: VA 99.96
3uzp_A 296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.96
4hgt_A 296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.96
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.96
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 99.96
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.96
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.96
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 99.96
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 99.96
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.96
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.96
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.96
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 99.96
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 99.96
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.96
2dyl_A 318 Dual specificity mitogen-activated protein kinase 99.96
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 99.96
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.96
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 99.96
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.96
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 99.96
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 99.95
3uqc_A286 Probable conserved transmembrane protein; structur 99.95
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 99.94
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.94
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 99.94
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.92
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 99.89
4gyi_A 397 RIO2 kinase; protein kinase, ADP complex, phosphoa 99.8
3tm0_A263 Aminoglycoside 3'-phosphotransferase; protein kina 99.47
1nd4_A264 Aminoglycoside 3'-phosphotransferase; protein kina 99.38
3dxp_A359 Putative acyl-COA dehydrogenase; protein kinase-li 99.26
3r70_A320 Aminoglycoside phosphotransferase; structural geno 98.95
3sg8_A304 APH(2'')-ID; antibiotic resistance enzyme, transfe 98.89
3tdw_A306 Gentamicin resistance protein; kinase, phosphoryl 98.81
4gkh_A272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 98.74
2olc_A 397 MTR kinase, methylthioribose kinase; kinase ADP-2H 98.66
3d1u_A288 Putative fructosamine-3-kinase; YP_290396.1, struc 98.64
3ats_A 357 Putative uncharacterized protein; hypothetical pro 98.58
3ovc_A362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 98.49
2q83_A346 YTAA protein; 2635576, structural genomics, joint 98.21
3f7w_A288 Putative fructosamine-3-kinase; YP_290396.1, struc 98.09
3dxq_A 301 Choline/ethanolamine kinase family protein; NP_106 98.07
1zyl_A328 Hypothetical protein YIHE; putative protein kinase 97.95
3jr1_A 312 Putative fructosamine-3-kinase; YP_719053.1, struc 97.93
2pyw_A 420 Uncharacterized protein; 5-methylthioribose kinase 97.91
2ppq_A322 HSK, HK, homoserine kinase; structural genomics, M 97.83
3csv_A333 Aminoglycoside phosphotransferase; YP_614837.1, ph 97.73
1nw1_A 429 Choline kinase (49.2 KD); phospholipid synthesis, 97.73
3feg_A 379 Choline/ethanolamine kinase; non-protein kinase, c 97.66
2qg7_A 458 Ethanolamine kinase PV091845; malaria, SGC, struct 97.58
3i1a_A339 Spectinomycin phosphotransferase; protein kinase, 97.45
3f2s_A401 CK, chetk-alpha, choline kinase alpha; non-protein 97.34
3c5i_A 369 Choline kinase; choline, kinase, malaria, transfer 97.26
3mes_A 424 Choline kinase; malaria, structural genomics, stru 96.8
3g15_A401 CK, chetk-alpha, choline kinase alpha; non-protein 96.43
4ano_A219 ESSB; membrane protein, membrane secretion, ESS ty 92.48
4ann_A215 ESSB; membrane protein, membrane secretion, ESS ty 90.34
2yle_A 229 Protein spire homolog 1; actin-binding protein, ac 86.85
3cxl_A 463 N-chimerin; SH2, RHO-GAP, structural genomics cons 83.35
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
Probab=100.00  E-value=4.4e-43  Score=276.12  Aligned_cols=171  Identities=12%  Similarity=0.249  Sum_probs=144.9

Q ss_pred             hcCCcccceeccCcceeEEEEEEe-CCcEEEEEEeecCC--CccHHHHHHHHHHHhccCCCceeeeccccccccccCCCC
Q 028629           23 TNNFDTSAFMGEGSKGQMYRGRLK-NGTFIAIRCLKMKK--SHSTRNFMHHIELISKLRHCHLVSALGHCFECYFDDSSV   99 (206)
Q Consensus        23 ~~~~~~~~~lg~g~~g~v~~~~~~-~~~~vaiK~~~~~~--~~~~~~~~~e~~~l~~l~h~~i~~~~~~~~~~~~~~~~~   99 (206)
                      .++|+.++.||+|+||.||+|+.. +|+.||+|++....  ....+.+.+|++++++++||||+++++++.+       .
T Consensus        23 me~Y~~~~~lG~G~fg~V~~a~~~~~~~~vAiK~i~~~~~~~~~~~~~~~E~~il~~l~HpnIV~~~~~~~~-------~   95 (350)
T 4b9d_A           23 MEKYVRLQKIGEGSFGKAILVKSTEDGRQYVIKEINISRMSSKEREESRREVAVLANMKHPNIVQYRESFEE-------N   95 (350)
T ss_dssp             CCCEEEEEEC------CEEEEEETTTCCEEEEEEEECTTSCHHHHHHHHHHHHHHHHCCCTTBCCEEEEEEE-------T
T ss_pred             ccceEEeEEEecCCCeEEEEEEECCCCCEEEEEEEehHHCCHHHHHHHHHHHHHHHHCCCCCCCcEEEEEEE-------C
Confidence            478999999999999999999976 79999999997654  2334678999999999999999999999876       6


Q ss_pred             ceEEEEEeecCCCCHHHHHhcCCCCcccCHHHHHHHHHHHHHHHHHHhcCCCCceeccCCccccEEecCCCceeEccCCc
Q 028629          100 SRIFLIFEYVPNGTLRSWISEGHAWQSLTWTQRISAAIGVARGIQFLHTGIVPGVFSNNLKITDILLDQNLVAKISSYNL  179 (206)
Q Consensus       100 ~~~~lv~e~~~~~~L~~~~~~~~~~~~~~~~~~~~~~~~i~~~l~~lH~~~~~~i~h~dl~p~nil~~~~~~~kl~df~~  179 (206)
                      +.+|+||||++||+|.+++..... ..+++..++.|+.||+.||.|||+   .+|+||||||+|||+++++.+||+|||+
T Consensus        96 ~~~yiVmEy~~gg~L~~~i~~~~~-~~~~e~~~~~~~~qi~~aL~ylH~---~~IiHRDlKp~NILl~~~g~vKl~DFGl  171 (350)
T 4b9d_A           96 GSLYIVMDYCEGGDLFKRINAQKG-VLFQEDQILDWFVQICLALKHVHD---RKILHRDIKSQNIFLTKDGTVQLGDFGI  171 (350)
T ss_dssp             TEEEEEEECCTTCBHHHHHHHTTT-CCCCHHHHHHHHHHHHHHHHHHHH---TTCEETTCCGGGEEECTTCCEEECSTTE
T ss_pred             CEEEEEEeCCCCCcHHHHHHHcCC-CCCCHHHHHHHHHHHHHHHHHHHH---CCeeeccCCHHHEEECCCCCEEEccccc
Confidence            789999999999999999976533 457899999999999999999999   7999999999999999999999999999


Q ss_pred             cccccccc-cccccccCccccCCCCC
Q 028629          180 PLLAENAE-KVGHVTPYSGSINPTNS  204 (206)
Q Consensus       180 a~~~~~~~-~~~~~~~~~~y~aPE~~  204 (206)
                      |+...... .....+||+.|||||..
T Consensus       172 a~~~~~~~~~~~~~~GT~~YmAPE~l  197 (350)
T 4b9d_A          172 ARVLNSTVELARACIGTPYYLSPEIC  197 (350)
T ss_dssp             ESCCCHHHHHHHHHHSCCTTCCHHHH
T ss_pred             ceeecCCcccccccCCCccccCHHHH
Confidence            99876543 34457899999999964



>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* Back     alignment and structure
>3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* Back     alignment and structure
>2q83_A YTAA protein; 2635576, structural genomics, joint center for structu genomics, JCSG, protein structure initiative, PSI-2, transf; HET: ADN CIT UNL; 2.50A {Bacillus subtilis} Back     alignment and structure
>3f7w_A Putative fructosamine-3-kinase; YP_290396.1, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.85A {Thermobifida fusca YX} Back     alignment and structure
>3dxq_A Choline/ethanolamine kinase family protein; NP_106042.1, STR genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 2.55A {Mesorhizobium loti} Back     alignment and structure
>1zyl_A Hypothetical protein YIHE; putative protein kinase, structural genomics, PSI, protein structure initiative; 2.80A {Escherichia coli} SCOP: d.144.1.6 Back     alignment and structure
>3jr1_A Putative fructosamine-3-kinase; YP_719053.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.32A {Haemophilus somnus 129PT} Back     alignment and structure
>2pyw_A Uncharacterized protein; 5-methylthioribose kinase, plant methionine recycling, refol transferase; HET: SR1 ADP; 1.90A {Arabidopsis thaliana} Back     alignment and structure
>2ppq_A HSK, HK, homoserine kinase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: d.144.1.6 Back     alignment and structure
>3csv_A Aminoglycoside phosphotransferase; YP_614837.1, phosphotransferase enzyme family, structural genomics, JOIN for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>1nw1_A Choline kinase (49.2 KD); phospholipid synthesis, protein kinase fold, transferase; 2.02A {Caenorhabditis elegans} SCOP: d.144.1.8 Back     alignment and structure
>3feg_A Choline/ethanolamine kinase; non-protein kinase, choline kinase, structural genomics CONS SGC, hemicholinium-3, phosphorylation; HET: HC7 ADP AMP; 1.30A {Homo sapiens} PDB: 3lq3_A* 2ig7_A* Back     alignment and structure
>2qg7_A Ethanolamine kinase PV091845; malaria, SGC, structural genomics consortium, transferase; 2.41A {Plasmodium vivax} Back     alignment and structure
>3i1a_A Spectinomycin phosphotransferase; protein kinase, aminoglycoside phosphotransferase, antibiotic resistance; HET: MES PG4; 1.70A {Legionella pneumophila} PDB: 3i0q_A* 3i0o_A* 3q2m_A* Back     alignment and structure
>3c5i_A Choline kinase; choline, kinase, malaria, transferase, structural genomics, structural genomics consortium; 2.20A {Plasmodium knowlesi} PDB: 3fi8_A* Back     alignment and structure
>3mes_A Choline kinase; malaria, structural genomics, structural genomics consortium, SGC, transferase; HET: ADP DME PT3; 2.35A {Cryptosporidium parvum} Back     alignment and structure
>3g15_A CK, chetk-alpha, choline kinase alpha; non-protein kinase, structural genomics CONS SGC, hemicholinium-3, transferase; HET: ADP HC6; 1.70A {Homo sapiens} PDB: 3f2r_A* 2i7q_A 2cko_A 2ckp_A* 2ckq_A* Back     alignment and structure
>4ano_A ESSB; membrane protein, membrane secretion, ESS type V secretion S; HET: MSE; 1.70A {Geobacillus thermodenitrificans ng80-2organism_taxid} Back     alignment and structure
>4ann_A ESSB; membrane protein, membrane secretion, ESS type VII secretion virulence; 1.05A {Staphylococcus aureus subsp} Back     alignment and structure
>2yle_A Protein spire homolog 1; actin-binding protein, actin polymerization; 1.80A {Homo sapiens} PDB: 2ylf_A 3r7g_A 3rbw_A Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 206
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 3e-26
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 1e-24
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 1e-24
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 4e-24
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 1e-23
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 1e-23
d1vjya_ 303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 2e-23
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 2e-23
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 7e-23
d1s9ja_ 322 d.144.1.7 (A:) Dual specificity mitogen-activated 8e-23
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 2e-22
d2jfla1 288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 3e-22
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 1e-21
d1u5ra_ 309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 6e-21
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 1e-19
d1u59a_ 285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 1e-19
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 1e-19
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 1e-19
d1p4oa_ 308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 2e-19
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 4e-19
d1r0pa_ 311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 5e-19
d1yhwa1 293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 6e-19
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 2e-18
d1koaa2 350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 2e-18
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 3e-18
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 3e-18
d1fvra_ 309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 4e-18
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 5e-18
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 7e-18
d1koba_ 352 d.144.1.7 (A:) Twitchin, kinase domain {California 1e-17
d1omwa3 364 d.144.1.7 (A:186-549) G-protein coupled receptor k 1e-17
d1a06a_ 307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 2e-17
d1q5ka_ 350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 2e-17
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 2e-17
d1uu3a_ 288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 4e-17
d1xkka_ 317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 5e-17
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 7e-17
d1pmea_ 345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 1e-16
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 2e-16
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 4e-15
d1tkia_ 321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 9e-15
d2ozaa1 335 d.144.1.7 (A:51-385) MAP kinase activated protein 1e-14
d3blha1 318 d.144.1.7 (A:8-325) Cell division protein kinase 9 5e-14
d1ua2a_ 299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 6e-14
d1ob3a_ 286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 6e-14
d1xjda_ 320 d.144.1.7 (A:) Protein kinase C, theta type {Human 6e-13
d1fota_ 316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 1e-12
d1o6la_ 337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 2e-12
d1gz8a_ 298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 4e-12
d1blxa_ 305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 4e-12
d3bqca1 328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 4e-12
d1ckia_ 299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 5e-12
d1jksa_ 293 d.144.1.7 (A:) Death-associated protein kinase, Da 1e-11
d1rdqe_ 350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 5e-11
d1vzoa_ 322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 2e-10
d1unla_ 292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 3e-10
d2gfsa1 348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 3e-09
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 1e-06
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: ephb2 receptor tyrosine kinase
species: Mouse (Mus musculus) [TaxId: 10090]
 Score =  100 bits (249), Expect = 3e-26
 Identities = 46/203 (22%), Positives = 83/203 (40%), Gaps = 26/203 (12%)

Query: 13  TFSLEELEEATNNFDTSAFM---------GEGSKGQMYRGRLK----NGTFIAIRCLKMK 59
            F+ E+  EA   F     +         G G  G++  G LK       F+AI+ LK  
Sbjct: 6   PFTFEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSG 65

Query: 60  KSHST-RNFMHHIELISKLRHCHLVSALGHCFECYFDDSSVSRIFLIFEYVPNGTLRSWI 118
            +    R+F+    ++ +  H +++       E     S+   + +I E++ NG+L S++
Sbjct: 66  YTEKQRRDFLSEASIMGQFDHPNVIH-----LEGVVTKST--PVMIITEFMENGSLDSFL 118

Query: 119 SEGHAWQSLTWTQRISAAIGVARGIQFLHTGIVPGVFSNNLKITDILLDQNLVAKISSYN 178
            +       T  Q +    G+A G+++L           +L   +IL++ NLV K+S + 
Sbjct: 119 RQNDGQF--TVIQLVGMLRGIAAGMKYLAD---MNYVHRDLAARNILVNSNLVCKVSDFG 173

Query: 179 LPLLAENAEKVGHVTPYSGSINP 201
           L    E+       T   G   P
Sbjct: 174 LSRFLEDDTSDPTYTSALGGKIP 196


>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query206
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d1yhwa1 293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2jfla1 288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d1s9ja_ 322 Dual specificity mitogen-activated protein kinase 100.0
d1koaa2 350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d1uu3a_ 288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d1a06a_ 307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d1o6la_ 337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1u5ra_ 309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1fota_ 316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d1jksa_ 293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 100.0
d1tkia_ 321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 100.0
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d2ozaa1 335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d1xjda_ 320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d1gz8a_ 298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d1ua2a_ 299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 100.0
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 100.0
d1xkka_ 317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 100.0
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 100.0
d1vjya_ 303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 100.0
d1fvra_ 309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 100.0
d1ob3a_ 286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 100.0
d3bqca1 328 Protein kinase CK2, alpha subunit {Rattus norvegic 100.0
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 100.0
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 100.0
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 100.0
d1blxa_ 305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d1r0pa_ 311 Hepatocyte growth factor receptor, c-MET {Human (H 100.0
d1pmea_ 345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 100.0
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 100.0
d1cm8a_ 346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 100.0
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 100.0
d3blha1 318 Cell division protein kinase 9, CDK9 {Human (Homo 100.0
d1unla_ 292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 100.0
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 100.0
d1csna_ 293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 100.0
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 100.0
d1vzoa_ 322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 100.0
d1ckia_ 299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.98
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.95
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.91
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 98.79
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 98.29
d2pula1 392 Methylthioribose kinase MtnK {Bacillus subtilis [T 98.25
d1zyla1 325 RdoA {Escherichia coli [TaxId: 562]} 97.92
d1nw1a_ 395 Choline kinase {Caenorhabditis elegans [TaxId: 623 97.63
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 97.62
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Cell cycle checkpoint kinase chk1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.9e-41  Score=257.83  Aligned_cols=169  Identities=21%  Similarity=0.305  Sum_probs=145.9

Q ss_pred             hcCCcccceeccCcceeEEEEEEe-CCcEEEEEEeecCCC-ccHHHHHHHHHHHhccCCCceeeeccccccccccCCCCc
Q 028629           23 TNNFDTSAFMGEGSKGQMYRGRLK-NGTFIAIRCLKMKKS-HSTRNFMHHIELISKLRHCHLVSALGHCFECYFDDSSVS  100 (206)
Q Consensus        23 ~~~~~~~~~lg~g~~g~v~~~~~~-~~~~vaiK~~~~~~~-~~~~~~~~e~~~l~~l~h~~i~~~~~~~~~~~~~~~~~~  100 (206)
                      .++|+..+.||+|+||.||+|..+ +|+.||+|++..... ...+.+.+|++++++++||||+++++++.+       .+
T Consensus         4 ~~dy~~~~~lG~G~fg~V~~~~~~~~~~~vAiK~i~~~~~~~~~~~~~~Ei~~l~~l~HpnIv~~~~~~~~-------~~   76 (271)
T d1nvra_           4 VEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKEICINKMLNHENVVKFYGHRRE-------GN   76 (271)
T ss_dssp             TTEEEEEEEEEEETTEEEEEEEETTTCCEEEEEEEECC-------CHHHHHHHHHTCCCTTBCCEEEEEEE-------TT
T ss_pred             CcceEEEEEEecCcCeEEEEEEECCCCCEEEEEEEehhhcchHHHHHHHHHHHHHhCCCCCEeeEeeeecc-------Cc
Confidence            457999999999999999999986 799999999976542 334568899999999999999999999876       67


Q ss_pred             eEEEEEeecCCCCHHHHHhcCCCCcccCHHHHHHHHHHHHHHHHHHhcCCCCceeccCCccccEEecCCCceeEccCCcc
Q 028629          101 RIFLIFEYVPNGTLRSWISEGHAWQSLTWTQRISAAIGVARGIQFLHTGIVPGVFSNNLKITDILLDQNLVAKISSYNLP  180 (206)
Q Consensus       101 ~~~lv~e~~~~~~L~~~~~~~~~~~~~~~~~~~~~~~~i~~~l~~lH~~~~~~i~h~dl~p~nil~~~~~~~kl~df~~a  180 (206)
                      .+++||||+++|+|.+++...   ..+++..+..++.|++.||.|||+   .+|+||||||+|||+++++.+||+|||+|
T Consensus        77 ~~~ivmEy~~gg~L~~~l~~~---~~l~e~~~~~i~~qi~~al~ylH~---~~IiHrDiKp~NILl~~~~~~KL~DFG~a  150 (271)
T d1nvra_          77 IQYLFLEYCSGGELFDRIEPD---IGMPEPDAQRFFHQLMAGVVYLHG---IGITHRDIKPENLLLDERDNLKISDFGLA  150 (271)
T ss_dssp             EEEEEEECCTTEEGGGGSBTT---TBCCHHHHHHHHHHHHHHHHHHHH---TTEECSCCCGGGEEECTTCCEEECCCTTC
T ss_pred             eeEEEEeccCCCcHHHHHhcC---CCCCHHHHHHHHHHHHHHHHHHHH---cCCccCcccHHHEEECCCCCEEEccchhh
Confidence            899999999999999998765   469999999999999999999999   79999999999999999999999999999


Q ss_pred             ccccccc---cccccccCccccCCCCC
Q 028629          181 LLAENAE---KVGHVTPYSGSINPTNS  204 (206)
Q Consensus       181 ~~~~~~~---~~~~~~~~~~y~aPE~~  204 (206)
                      +......   ......||+.|||||..
T Consensus       151 ~~~~~~~~~~~~~~~~GT~~Y~APE~~  177 (271)
T d1nvra_         151 TVFRYNNRERLLNKMCGTLPYVAPELL  177 (271)
T ss_dssp             EECEETTEECCBCCCCSCGGGSCTHHH
T ss_pred             eeeccCCccccccceeeCcCccCHhHh
Confidence            8765332   33456899999999953



>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure