Citrus Sinensis ID: 028649

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200------

MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVAVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKAYEGVPAPYDKVKRMVIPDALKVLRLQKGHKYCLLGRLASEVGWNYYDTIRELEKKRKERSQVAYERKKQLNKLRAKAEKVAEEKLGSQLDILAPVKY

ccccccccccEEEEEcccccHHHHHHHHHHHHccccEEEEEEcccEEEEccHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHccccccHHHHHHHcccccccccccccccccccccHHHHHHHHHcccccEEEHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc

*****GICAKRVVVDARHHMLGRLASIVAKELLNGQKVVAVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKAYEGVPAPYDKVKRMVIPDALKVLRLQKGHKYCLLGRLASEVGWNYYDTIRELEKKRKERSQVAYER*K******************SQLDILAPVKY

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
60S ribosomal protein L13a-4		confident	Q9FKC0
60S ribosomal protein L13a		probable	O65055
60S ribosomal protein L16-B		probable	O42991

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZKR, chain j
Confidence level:very confident
Coverage over the Query: 12-147
View the alignment between query and template
View the model in PyMOL