Citrus Sinensis ID: 028656


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200------
MESCFLNTLKTQPLWLLALFTIGSLSVLRLAFVILNWVYVNFLRPAKNLRKYGSWALVTGPTDGIGKSFAFQLAKTGLNLVLVGRNPDKLKDVSDSIQAKYAKTQIKSVVVDFSGDLDEGVERIKEAIEGLDVGVLINNVGISYPYARFFHEVDQVLLKNLIKVNVEGTTKVTQAVLPGMLKRKKGLSMLNIGKAELMCSVRFHYM
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEccccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHcccEEEEEEEEEcccccHHHHHHHHHHHccccccEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcccccccccccccc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHcccEEEEEccccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHccccEEEEEEEEcccccHHHHHHHHHHHccccEEEEEEcccccccccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccc
mescflntlktqPLWLLALFTIGSLSVLRLAFVILNWVYVNFLrpaknlrkygswalvtgptdgigKSFAFQLAKTGLNLvlvgrnpdklkdvSDSIQAKYAKTQIKSVVVDFSGDLDEGVERIKEAIEGLDVGVLINnvgisypyarfFHEVDQVLLKNLIKVNVEGTTKVTQAVLPgmlkrkkglsmlNIGKAELMCSVRFHYM
MESCFLNTLKTQPLWLLALFTIGSLSVLRLAFVILNWVYVNFLRPAKNLRKYGSWALVTGPTDGIGKSFAFQLAKTGLNLVLVGRNPDKLKDVSDSIQAkyaktqiksvvvDFSGDLDEGVERIKEaiegldvgvLINNVGISYPYARFFHEVDQVLLKNLIKVnvegttkvtqavlpgmlkrkkglsmlnigkAELMCSVRFHYM
MESCFLNTLKTQPLWLLALFTIGSLSVLRLAFVILNWVYVNFLRPAKNLRKYGSWALVTGPTDGIGKSFAFQLAKTGLNLVLVGRNPDKLKDVSDSIQAKYAKTQIKSVVVDFSGDLDEGVERIKEAIEGLDVGVLINNVGISYPYARFFHEVDQVLLKNLIKVNVEGTTKVTQAVLPGMLKRKKGLSMLNIGKAELMCSVRFHYM
***CFLNTLKTQPLWLLALFTIGSLSVLRLAFVILNWVYVNFLRPAKNLRKYGSWALVTGPTDGIGKSFAFQLAKTGLNLVLVGRNPDKLKDVSDSIQAKYAKTQIKSVVVDFSGDLDEGVERIKEAIEGLDVGVLINNVGISYPYARFFHEVDQVLLKNLIKVNVEGTTKVTQAVLPGMLKRKKGLSMLNIGKAELMCSVRFH**
***CF**TLKTQPLWLLALFTIGSLSVLRLAFVILNWVYVNFLRPAKNLRKYGSWALVTGPTDGIGKSFAFQLAKTGLNLVLVGRNPDKLKDVSDSIQAKYAKTQIKSVVVDFSGDLDEGVERIKEAIEGLDVGVLINNVGISYPYARFFHEVDQVLLKNLIKVNVEGTTKVTQAVLPGMLKRKKGLSMLNIGKAELMCSVRFHYM
MESCFLNTLKTQPLWLLALFTIGSLSVLRLAFVILNWVYVNFLRPAKNLRKYGSWALVTGPTDGIGKSFAFQLAKTGLNLVLVGRNPDKLKDVSDSIQAKYAKTQIKSVVVDFSGDLDEGVERIKEAIEGLDVGVLINNVGISYPYARFFHEVDQVLLKNLIKVNVEGTTKVTQAVLPGMLKRKKGLSMLNIGKAELMCSVRFHYM
MESCFLNTLKTQPLWLLALFTIGSLSVLRLAFVILNWVYVNFLRPAKNLRKYGSWALVTGPTDGIGKSFAFQLAKTGLNLVLVGRNPDKLKDVSDSIQAKYAKTQIKSVVVDFSGDLDEGVERIKEAIEGLDVGVLINNVGISYPYARFFHEVDQVLLKNLIKVNVEGTTKVTQAVLPGMLKRKKGLSMLNIGKAELMCSVRFHY*
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSiiHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESCFLNTLKTQPLWLLALFTIGSLSVLRLAFVILNWVYVNFLRPAKNLRKYGSWALVTGPTDGIGKSFAFQLAKTGLNLVLVGRNPDKLKDVSDSIQAKYAKTQIKSVVVDFSGDLDEGVERIKEAIEGLDVGVLINNVGISYPYARFFHEVDQVLLKNLIKVNVEGTTKVTQAVLPGMLKRKKGLSMLNIGKAELMCSVRFHYM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query206 2.2.26 [Sep-21-2011]
Q8L9C4 318 Very-long-chain 3-oxoacyl yes no 0.975 0.632 0.669 1e-78
Q9FYL6 312 Very-long-chain 3-oxoacyl no no 0.873 0.576 0.483 1e-42
A8N6B4 339 Very-long-chain 3-oxoacyl N/A no 0.888 0.539 0.407 3e-36
Q2UET3 346 Very-long-chain 3-oxoacyl yes no 0.922 0.549 0.391 2e-33
Q5B0R9 346 Very-long-chain 3-oxoacyl yes no 0.733 0.436 0.458 3e-32
A2QCH3 346 Very-long-chain 3-oxoacyl yes no 0.893 0.531 0.395 6e-32
Q6P7R8 312 Estradiol 17-beta-dehydro yes no 0.713 0.471 0.477 8e-32
Q1DNC5 349 Very-long-chain 3-oxoacyl N/A no 0.820 0.484 0.406 1e-31
B2B3L4 340 Very-long-chain 3-oxoacyl yes no 0.873 0.529 0.421 4e-31
A6SG70 331 Very-long-chain 3-oxoacyl N/A no 0.708 0.441 0.443 5e-31
>sp|Q8L9C4|KCR1_ARATH Very-long-chain 3-oxoacyl-CoA reductase 1 OS=Arabidopsis thaliana GN=KCR1 PE=1 SV=1 Back     alignment and function desciption
 Score =  292 bits (747), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 138/206 (66%), Positives = 174/206 (84%), Gaps = 5/206 (2%)

Query: 1   MESCFLNTLKTQPLWLLALFTIGSLSVLRLAFVILNWVYVNFLRPAKNLRKYGSWALVTG 60
           ME C     K+QP WLL LF +GS+S+ +  F +L   Y+ FLRP+KNLR+YGSWA++TG
Sbjct: 1   MEIC--TYFKSQPTWLLILFVLGSISIFKFIFTLLRSFYIYFLRPSKNLRRYGSWAIITG 58

Query: 61  PTDGIGKSFAFQLAKTGLNLVLVGRNPDKLKDVSDSIQAKYAKTQIKSVVVDFSGDLDEG 120
           PTDGIGK+FAFQLA+ GLNL+LV RNPDKLKDVSDSI++KY++TQI +VV+DFSGD+DEG
Sbjct: 59  PTDGIGKAFAFQLAQKGLNLILVARNPDKLKDVSDSIRSKYSQTQILTVVMDFSGDIDEG 118

Query: 121 VERIKEAIEGLDVGVLINNVGISYPYARFFHEVDQVLLKNLIKVNVEGTTKVTQAVLPGM 180
           V+RIKE+IEGLDVG+LINN G+SYPYA++FHEVD+ L+ NLIK+NVEGTTKVTQAVLP M
Sbjct: 119 VKRIKESIEGLDVGILINNAGMSYPYAKYFHEVDEELINNLIKINVEGTTKVTQAVLPNM 178

Query: 181 LKRKKGLSMLNIGK--AELMCSVRFH 204
           LKRKKG +++N+G   A L+ S  F+
Sbjct: 179 LKRKKG-AIINMGSGAAALIPSYPFY 203




Beta-ketoacyl-coenzyme A reductase required for the elongation of fatty acids precursors of sphingolipids, triacylglycerols, cuticular waxes and suberin. Responsible for the first reduction step in very long-chain fatty acids (VLCFAs) synthesis. Decreased expression of KCR1 (RNAi) leads to plants with fused vegetative and reproductive organs, and abnormal trichome, epidermal cell and root morphology. Cannot be complemented by KCR2.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 3EC: 3EC: 0
>sp|Q9FYL6|KCR2_ARATH Very-long-chain 3-oxoacyl-CoA reductase-like protein At1g24470 OS=Arabidopsis thaliana GN=KCR2 PE=2 SV=1 Back     alignment and function description
>sp|A8N6B4|MKAR_COPC7 Very-long-chain 3-oxoacyl-CoA reductase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_02019 PE=3 SV=1 Back     alignment and function description
>sp|Q2UET3|MKAR_ASPOR Very-long-chain 3-oxoacyl-CoA reductase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090026000492 PE=3 SV=1 Back     alignment and function description
>sp|Q5B0R9|MKAR_EMENI Very-long-chain 3-oxoacyl-CoA reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN5861 PE=3 SV=1 Back     alignment and function description
>sp|A2QCH3|MKAR_ASPNC Very-long-chain 3-oxoacyl-CoA reductase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An02g03570 PE=3 SV=1 Back     alignment and function description
>sp|Q6P7R8|DHB12_RAT Estradiol 17-beta-dehydrogenase 12 OS=Rattus norvegicus GN=Hsd17b12 PE=2 SV=1 Back     alignment and function description
>sp|Q1DNC5|MKAR_COCIM Very-long-chain 3-oxoacyl-CoA reductase OS=Coccidioides immitis (strain RS) GN=CIMG_08188 PE=3 SV=2 Back     alignment and function description
>sp|B2B3L4|MKAR_PODAN Very-long-chain 3-oxoacyl-CoA reductase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=Pa_6_6580 PE=3 SV=2 Back     alignment and function description
>sp|A6SG70|MKAR_BOTFB Very-long-chain 3-oxoacyl-CoA reductase OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_11561 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query206
62956018 320 3-ketoacyl-CoA reductase 1 [Gossypium hi 0.932 0.6 0.792 1e-85
224107711 320 predicted protein [Populus trichocarpa] 0.932 0.6 0.777 6e-84
225424552 320 PREDICTED: estradiol 17-beta-dehydrogena 0.932 0.6 0.777 2e-81
255547948 320 steroid dehydrogenase, putative [Ricinus 0.932 0.6 0.813 2e-81
357463161 320 Short-chain dehydrogenase/reductase [Med 0.932 0.6 0.751 9e-81
388519619 320 unknown [Medicago truncatula] 0.932 0.6 0.751 1e-80
28565597 319 putative 3-ketoacyl-CoA reductase 1 [Bra 0.975 0.630 0.684 3e-77
18408847 318 beta-ketoacyl reductase 1 [Arabidopsis t 0.975 0.632 0.669 6e-77
359806497 320 uncharacterized protein LOC100817128 [Gl 0.932 0.6 0.766 1e-76
449450411 320 PREDICTED: very-long-chain 3-oxoacyl-CoA 0.941 0.606 0.753 3e-76
>gi|62956018|gb|AAY23354.1| 3-ketoacyl-CoA reductase 1 [Gossypium hirsutum] Back     alignment and taxonomy information
 Score =  321 bits (823), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 176/193 (91%), Gaps = 1/193 (0%)

Query: 1   MESCFLNTLKTQPLWLLALFTIGSLSVLRLAFVILNWVYVNFLRPAKNLRKYGSWALVTG 60
           ME+CF +TLK QP W++ LFT+GSLS+L+ +FV L WV++NFLRP KNL+KYGSW LVTG
Sbjct: 1   MEACFFDTLKAQPFWVIFLFTLGSLSLLKFSFVFLKWVWINFLRPGKNLKKYGSWGLVTG 60

Query: 61  PTDGIGKSFAFQLAKTGLNLVLVGRNPDKLKDVSDSIQAKYAKTQIKSVVVDFSGDLDEG 120
           PTDGIGK FAFQLA+ GLNLVLVGRNPDKLKDVSDSI AKYAK QI++VVVDF+GDLDEG
Sbjct: 61  PTDGIGKGFAFQLARKGLNLVLVGRNPDKLKDVSDSILAKYAKIQIRTVVVDFTGDLDEG 120

Query: 121 VERIKEAIEGLDVGVLINNVGISYPYARFFHEVDQVLLKNLIKVNVEGTTKVTQAVLPGM 180
           V++IKE IEGLDVGVLINNVGISYPYAR+FHEVD+ LL NLIKVNVEGTTKVTQAVLPGM
Sbjct: 121 VKKIKETIEGLDVGVLINNVGISYPYARYFHEVDEELLVNLIKVNVEGTTKVTQAVLPGM 180

Query: 181 LKRKKGLSMLNIG 193
           +KRKKG +++NIG
Sbjct: 181 VKRKKG-AIVNIG 192




Source: Gossypium hirsutum

Species: Gossypium hirsutum

Genus: Gossypium

Family: Malvaceae

Order: Malvales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224107711|ref|XP_002314573.1| predicted protein [Populus trichocarpa] gi|222863613|gb|EEF00744.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225424552|ref|XP_002285316.1| PREDICTED: estradiol 17-beta-dehydrogenase 12 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255547948|ref|XP_002515031.1| steroid dehydrogenase, putative [Ricinus communis] gi|223546082|gb|EEF47585.1| steroid dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357463161|ref|XP_003601862.1| Short-chain dehydrogenase/reductase [Medicago truncatula] gi|355490910|gb|AES72113.1| Short-chain dehydrogenase/reductase [Medicago truncatula] Back     alignment and taxonomy information
>gi|388519619|gb|AFK47871.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|28565597|gb|AAO43448.1| putative 3-ketoacyl-CoA reductase 1 [Brassica napus] Back     alignment and taxonomy information
>gi|18408847|ref|NP_564905.1| beta-ketoacyl reductase 1 [Arabidopsis thaliana] gi|75301204|sp|Q8L9C4.1|KCR1_ARATH RecName: Full=Very-long-chain 3-oxoacyl-CoA reductase 1; AltName: Full=Beta-ketoacyl reductase 1; Short=AtKCR1; AltName: Full=Protein GLOSSY 8; Short=gl8At gi|21594872|gb|AAM66051.1| unknown [Arabidopsis thaliana] gi|332196567|gb|AEE34688.1| beta-ketoacyl reductase 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|359806497|ref|NP_001241510.1| uncharacterized protein LOC100817128 [Glycine max] gi|255647230|gb|ACU24083.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449450411|ref|XP_004142956.1| PREDICTED: very-long-chain 3-oxoacyl-CoA reductase 1-like [Cucumis sativus] gi|449527051|ref|XP_004170526.1| PREDICTED: very-long-chain 3-oxoacyl-CoA reductase 1-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query206
TAIR|locus:2008630 318 KCR1 "beta-ketoacyl reductase 0.975 0.632 0.669 6.7e-72
TAIR|locus:2023996 312 KCR2 "beta-ketoacyl reductase 0.873 0.576 0.483 5.9e-41
RGD|708367 312 Hsd17b12 "hydroxysteroid (17-b 0.839 0.554 0.442 6.7e-33
UNIPROTKB|Q6P7R8 312 Hsd17b12 "Estradiol 17-beta-de 0.839 0.554 0.442 6.7e-33
MGI|MGI:1926967 312 Hsd17b12 "hydroxysteroid (17-b 0.713 0.471 0.464 1.3e-31
ASPGD|ASPL0000007762 346 AN5861 [Emericella nidulans (t 0.844 0.502 0.421 2.6e-31
UNIPROTKB|A6H7H3 312 LOC789567 "LOC789567 protein" 0.907 0.599 0.419 3.3e-31
DICTYBASE|DDB_G0275049 307 DDB_G0275049 "short-chain dehy 0.825 0.553 0.389 1.8e-30
FB|FBgn0029975 321 CG1444 [Drosophila melanogaste 0.864 0.554 0.389 2.3e-30
UNIPROTKB|Q5E9H7 312 HSD17B12 "Estradiol 17-beta-de 0.868 0.573 0.410 2.3e-30
TAIR|locus:2008630 KCR1 "beta-ketoacyl reductase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 727 (261.0 bits), Expect = 6.7e-72, P = 6.7e-72
 Identities = 138/206 (66%), Positives = 174/206 (84%)

Query:     1 MESCFLNTLKTQPLWLLALFTIGSLSVLRLAFVILNWVYVNFLRPAKNLRKYGSWALVTG 60
             ME C     K+QP WLL LF +GS+S+ +  F +L   Y+ FLRP+KNLR+YGSWA++TG
Sbjct:     1 MEIC--TYFKSQPTWLLILFVLGSISIFKFIFTLLRSFYIYFLRPSKNLRRYGSWAIITG 58

Query:    61 PTDGIGKSFAFQLAKTGLNLVLVGRNPDKLKDVSDSIQAKYAKTQIKSVVVDFSGDLDEG 120
             PTDGIGK+FAFQLA+ GLNL+LV RNPDKLKDVSDSI++KY++TQI +VV+DFSGD+DEG
Sbjct:    59 PTDGIGKAFAFQLAQKGLNLILVARNPDKLKDVSDSIRSKYSQTQILTVVMDFSGDIDEG 118

Query:   121 VERIKEAIEGLDVGVLINNVGISYPYARFFHEVDQVLLKNLIKVNVEGTTKVTQAVLPGM 180
             V+RIKE+IEGLDVG+LINN G+SYPYA++FHEVD+ L+ NLIK+NVEGTTKVTQAVLP M
Sbjct:   119 VKRIKESIEGLDVGILINNAGMSYPYAKYFHEVDEELINNLIKINVEGTTKVTQAVLPNM 178

Query:   181 LKRKKGLSMLNIGK--AELMCSVRFH 204
             LKRKKG +++N+G   A L+ S  F+
Sbjct:   179 LKRKKG-AIINMGSGAAALIPSYPFY 203




GO:0000166 "nucleotide binding" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0016491 "oxidoreductase activity" evidence=IEA;ISS
GO:0045703 "ketoreductase activity" evidence=IDA
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0009790 "embryo development" evidence=IMP
GO:0018454 "acetoacetyl-CoA reductase activity" evidence=IMP
GO:0042761 "very long-chain fatty acid biosynthetic process" evidence=IMP
GO:0016126 "sterol biosynthetic process" evidence=RCA
GO:0046520 "sphingoid biosynthetic process" evidence=RCA
GO:0042335 "cuticle development" evidence=ISS
TAIR|locus:2023996 KCR2 "beta-ketoacyl reductase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|708367 Hsd17b12 "hydroxysteroid (17-beta) dehydrogenase 12" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6P7R8 Hsd17b12 "Estradiol 17-beta-dehydrogenase 12" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1926967 Hsd17b12 "hydroxysteroid (17-beta) dehydrogenase 12" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ASPGD|ASPL0000007762 AN5861 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|A6H7H3 LOC789567 "LOC789567 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0275049 DDB_G0275049 "short-chain dehydrogenase/reductase (SDR) family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0029975 CG1444 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q5E9H7 HSD17B12 "Estradiol 17-beta-dehydrogenase 12" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8L9C4KCR1_ARATH1, ., 1, ., 1, ., 3, 3, 00.66990.97570.6320yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query206
PLN02780 320 PLN02780, PLN02780, ketoreductase/ oxidoreductase 1e-126
cd05356239 cd05356, 17beta-HSD1_like_SDR_c, 17-beta-hydroxyst 2e-61
COG0300 265 COG0300, DltE, Short-chain dehydrogenases of vario 1e-26
PRK07666239 PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-24
cd05233234 cd05233, SDR_c, classical (c) SDRs 7e-23
PRK07454241 PRK07454, PRK07454, short chain dehydrogenase; Pro 2e-22
cd05332 257 cd05332, 11beta-HSD1_like_SDR_c, 11beta-hydroxyste 8e-21
cd08939239 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine 8e-20
COG4221246 COG4221, COG4221, Short-chain alcohol dehydrogenas 8e-20
cd05346249 cd05346, SDR_c5, classical (c) SDR, subgroup 5 4e-19
cd05333240 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein 8e-19
TIGR01830239 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier 8e-19
cd05374 248 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxyster 1e-17
cd05339243 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hy 2e-17
PRK05653246 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) 9e-17
PRK12826251 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-prote 1e-16
PRK05557248 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) 8e-16
PRK07201 657 PRK07201, PRK07201, short chain dehydrogenase; Pro 1e-15
PRK13394 262 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenas 1e-15
PRK09072 263 PRK09072, PRK09072, short chain dehydrogenase; Pro 2e-15
cd08934243 cd08934, CAD_SDR_c, clavulanic acid dehydrogenase 2e-15
cd05327 269 cd05327, retinol-DH_like_SDR_c_like, retinol dehyd 2e-15
cd05347248 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogena 3e-15
PRK05565247 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) 3e-15
PRK12429 258 PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenas 4e-15
cd05364253 cd05364, SDR_c11, classical (c) SDR, subgroup 11 6e-15
PRK08945247 PRK08945, PRK08945, putative oxoacyl-(acyl carrier 1e-14
COG1028251 COG1028, FabG, Dehydrogenases with different speci 1e-14
PRK07231251 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-14
TIGR01963 255 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase 2e-14
PRK05866 293 PRK05866, PRK05866, short chain dehydrogenase; Pro 2e-14
cd05325233 cd05325, carb_red_sniffer_like_SDR_c, carbonyl red 2e-14
cd05370228 cd05370, SDR_c2, classical (c) SDR, subgroup 2 3e-14
PRK12829 264 PRK12829, PRK12829, short chain dehydrogenase; Pro 4e-14
PRK09242257 PRK09242, PRK09242, tropinone reductase; Provision 1e-13
cd05344 253 cd05344, BKR_like_SDR_like, putative beta-ketoacyl 2e-13
PRK06181 263 PRK06181, PRK06181, short chain dehydrogenase; Pro 4e-13
cd05324225 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicu 6e-13
PRK08085254 PRK08085, PRK08085, gluconate 5-dehydrogenase; Pro 1e-12
cd05340236 cd05340, Ycik_SDR_c, Escherichia coli K-12 YCIK-li 3e-12
PRK07523255 PRK07523, PRK07523, gluconate 5-dehydrogenase; Pro 3e-12
PRK08226 263 PRK08226, PRK08226, short chain dehydrogenase; Pro 3e-12
cd05323244 cd05323, ADH_SDR_c_like, insect type alcohol dehyd 3e-12
PRK12825249 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) 6e-12
PRK07097 265 PRK07097, PRK07097, gluconate 5-dehydrogenase; Pro 1e-11
COG3967245 COG3967, DltE, Short-chain dehydrogenase involved 2e-11
cd05351244 cd05351, XR_like_SDR_c, xylulose reductase-like, c 2e-11
PRK07063 260 PRK07063, PRK07063, short chain dehydrogenase; Pro 2e-11
cd08940 258 cd08940, HBDH_SDR_c, d-3-hydroxybutyrate dehydroge 3e-11
cd08930250 cd08930, SDR_c8, classical (c) SDR, subgroup 8 4e-11
PRK05872 296 PRK05872, PRK05872, short chain dehydrogenase; Pro 4e-11
PRK06914 280 PRK06914, PRK06914, short chain dehydrogenase; Pro 4e-11
cd05354235 cd05354, SDR_c7, classical (c) SDR, subgroup 7 9e-11
PRK08324 681 PRK08324, PRK08324, short chain dehydrogenase; Val 1e-10
TIGR04316 250 TIGR04316, dhbA_paeA, 2,3-dihydro-2,3-dihydroxyben 1e-10
cd05353250 cd05353, hydroxyacyl-CoA-like_DH_SDR_c-like, (3R)- 2e-10
PRK06114254 PRK06114, PRK06114, short chain dehydrogenase; Pro 2e-10
PRK07814 263 PRK07814, PRK07814, short chain dehydrogenase; Pro 2e-10
PRK08589 272 PRK08589, PRK08589, short chain dehydrogenase; Val 3e-10
TIGR01829242 TIGR01829, AcAcCoA_reduct, acetoacetyl-CoA reducta 3e-10
cd05350239 cd05350, SDR_c6, classical (c) SDR, subgroup 6 4e-10
cd05368241 cd05368, DHRS6_like_SDR_c, human DHRS6-like, class 4e-10
cd05369249 cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reducta 5e-10
TIGR03206250 TIGR03206, benzo_BadH, 2-hydroxycyclohexanecarboxy 6e-10
PRK07109 334 PRK07109, PRK07109, short chain dehydrogenase; Pro 6e-10
TIGR02415 254 TIGR02415, 23BDH, acetoin reductases 8e-10
PRK12939250 PRK12939, PRK12939, short chain dehydrogenase; Pro 8e-10
PRK06484 520 PRK06484, PRK06484, short chain dehydrogenase; Val 1e-09
PRK12824245 PRK12824, PRK12824, acetoacetyl-CoA reductase; Pro 1e-09
cd05338246 cd05338, DHRS1_HSDL2-like_SDR_c, human dehydrogena 1e-09
cd05373238 cd05373, SDR_c10, classical (c) SDR, subgroup 10 1e-09
cd05337 255 cd05337, BKR_1_SDR_c, putative beta-ketoacyl acyl 2e-09
cd05343250 cd05343, Mgc4172-like_SDR_c, human Mgc4172-like, c 2e-09
cd08937 256 cd08937, DHB_DH-like_SDR_c, 1,6-dihydroxycyclohexa 2e-09
PRK07577234 PRK07577, PRK07577, short chain dehydrogenase; Pro 4e-09
cd05367241 cd05367, SPR-like_SDR_c, sepiapterin reductase (SP 5e-09
PRK06180 277 PRK06180, PRK06180, short chain dehydrogenase; Pro 5e-09
PRK12823 260 PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1 6e-09
PRK07774250 PRK07774, PRK07774, short chain dehydrogenase; Pro 6e-09
PRK07074 257 PRK07074, PRK07074, short chain dehydrogenase; Pro 7e-09
PRK08264238 PRK08264, PRK08264, short chain dehydrogenase; Val 9e-09
cd08932223 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like 9e-09
PRK06949258 PRK06949, PRK06949, short chain dehydrogenase; Pro 1e-08
PRK10538 248 PRK10538, PRK10538, malonic semialdehyde reductase 1e-08
PRK07067 257 PRK07067, PRK07067, sorbitol dehydrogenase; Provis 2e-08
PRK06179 270 PRK06179, PRK06179, short chain dehydrogenase; Pro 2e-08
PRK07832 272 PRK07832, PRK07832, short chain dehydrogenase; Pro 2e-08
cd09763 265 cd09763, DHRS1-like_SDR_c, human dehydrogenase/red 2e-08
PRK07890 258 PRK07890, PRK07890, short chain dehydrogenase; Pro 2e-08
PRK06841255 PRK06841, PRK06841, short chain dehydrogenase; Pro 2e-08
cd05352252 cd05352, MDH-like_SDR_c, mannitol dehydrogenase (M 3e-08
PRK06182 273 PRK06182, PRK06182, short chain dehydrogenase; Val 3e-08
PRK08213259 PRK08213, PRK08213, gluconate 5-dehydrogenase; Pro 4e-08
PRK06463 255 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) 4e-08
PRK09291 257 PRK09291, PRK09291, short chain dehydrogenase; Pro 4e-08
PRK05693 274 PRK05693, PRK05693, short chain dehydrogenase; Pro 5e-08
PRK07775 274 PRK07775, PRK07775, short chain dehydrogenase; Pro 6e-08
PRK06550 235 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) 6e-08
PRK06125 259 PRK06125, PRK06125, short chain dehydrogenase; Pro 7e-08
cd05341247 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta 7e-08
PRK07326237 PRK07326, PRK07326, short chain dehydrogenase; Pro 9e-08
PRK08217253 PRK08217, fabG, 3-ketoacyl-(acyl-carrier-protein) 9e-08
PRK08277 278 PRK08277, PRK08277, D-mannonate oxidoreductase; Pr 1e-07
PRK05875 276 PRK05875, PRK05875, short chain dehydrogenase; Pro 2e-07
PRK06398 258 PRK06398, PRK06398, aldose dehydrogenase; Validate 2e-07
cd05349246 cd05349, BKR_2_SDR_c, putative beta-ketoacyl acyl 2e-07
cd08945 258 cd08945, PKR_SDR_c, Polyketide ketoreductase, clas 2e-07
PRK12745 256 PRK12745, PRK12745, 3-ketoacyl-(acyl-carrier-prote 2e-07
cd05358253 cd05358, GlcDH_SDR_c, glucose 1 dehydrogenase (Glc 2e-07
PRK07677 252 PRK07677, PRK07677, short chain dehydrogenase; Pro 2e-07
PRK06138252 PRK06138, PRK06138, short chain dehydrogenase; Pro 3e-07
cd05360233 cd05360, SDR_c3, classical (c) SDR, subgroup 3 3e-07
PRK08643256 PRK08643, PRK08643, acetoin reductase; Validated 3e-07
cd05365242 cd05365, 7_alpha_HSDH_SDR_c, 7 alpha-hydroxysteroi 4e-07
cd08935 271 cd08935, mannonate_red_SDR_c, putative D-mannonate 5e-07
PRK06198 260 PRK06198, PRK06198, short chain dehydrogenase; Pro 5e-07
TIGR01832248 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogena 5e-07
PRK07825 273 PRK07825, PRK07825, short chain dehydrogenase; Pro 5e-07
PRK08063250 PRK08063, PRK08063, enoyl-(acyl carrier protein) r 6e-07
TIGR03971265 TIGR03971, SDR_subfam_1, oxidoreductase, SDR famil 8e-07
cd05362243 cd05362, THN_reductase-like_SDR_c, tetrahydroxynap 8e-07
cd05345248 cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl 8e-07
PRK12828239 PRK12828, PRK12828, short chain dehydrogenase; Pro 1e-06
PRK06171 266 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydro 1e-06
TIGR01500256 TIGR01500, sepiapter_red, sepiapterin reductase 1e-06
cd09808 255 cd09808, DHRS-12_like_SDR_c-like, human dehydrogen 1e-06
cd08943 250 cd08943, R1PA_ADH_SDR_c, rhamnulose-1-phosphate al 1e-06
PRK12743 256 PRK12743, PRK12743, oxidoreductase; Provisional 1e-06
pfam00106167 pfam00106, adh_short, short chain dehydrogenase 1e-06
PRK12935247 PRK12935, PRK12935, acetoacetyl-CoA reductase; Pro 1e-06
PRK12827249 PRK12827, PRK12827, short chain dehydrogenase; Pro 2e-06
cd05366 257 cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol 2e-06
PRK08219227 PRK08219, PRK08219, short chain dehydrogenase; Pro 2e-06
PRK07060245 PRK07060, PRK07060, short chain dehydrogenase; Pro 2e-06
cd05331 244 cd05331, DH-DHB-DH_SDR_c, 2,3 dihydro-2,3 dihydroz 2e-06
PRK08263 275 PRK08263, PRK08263, short chain dehydrogenase; Pro 2e-06
cd05330 257 cd05330, cyclohexanol_reductase_SDR_c, cyclohexano 2e-06
PRK07856 252 PRK07856, PRK07856, short chain dehydrogenase; Pro 3e-06
cd08942250 cd08942, RhlG_SDR_c, RhlG and related beta-ketoacy 3e-06
cd05355270 cd05355, SDR_c1, classical (c) SDR, subgroup 1 4e-06
cd05329251 cd05329, TR_SDR_c, tropinone reductase-I and II (T 4e-06
PRK06523 260 PRK06523, PRK06523, short chain dehydrogenase; Pro 4e-06
PRK06701290 PRK06701, PRK06701, short chain dehydrogenase; Pro 5e-06
PRK05854 313 PRK05854, PRK05854, short chain dehydrogenase; Pro 5e-06
cd08929226 cd08929, SDR_c4, classical (c) SDR, subgroup 4 5e-06
PRK07035252 PRK07035, PRK07035, short chain dehydrogenase; Pro 6e-06
PRK06194 287 PRK06194, PRK06194, hypothetical protein; Provisio 6e-06
PRK06484 520 PRK06484, PRK06484, short chain dehydrogenase; Val 1e-05
PRK06197 306 PRK06197, PRK06197, short chain dehydrogenase; Pro 1e-05
cd09806 258 cd09806, type1_17beta-HSD-like_SDR_c, human estrog 1e-05
PRK07478254 PRK07478, PRK07478, short chain dehydrogenase; Pro 2e-05
PRK08265 261 PRK08265, PRK08265, short chain dehydrogenase; Pro 2e-05
cd05359242 cd05359, ChcA_like_SDR_c, 1-cyclohexenylcarbonyl_c 2e-05
PRK12746254 PRK12746, PRK12746, short chain dehydrogenase; Pro 2e-05
PRK05650 270 PRK05650, PRK05650, short chain dehydrogenase; Pro 2e-05
PRK06935258 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrog 2e-05
PRK06500249 PRK06500, PRK06500, short chain dehydrogenase; Pro 3e-05
cd08936256 cd08936, CR_SDR_c, Porcine peroxisomal carbonyl re 3e-05
PRK08642253 PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) 3e-05
cd01078194 cd01078, NAD_bind_H4MPT_DH, NADP binding domain of 4e-05
cd05363 254 cd05363, SDH_SDR_c, Sorbitol dehydrogenase (SDH), 4e-05
PRK06139 330 PRK06139, PRK06139, short chain dehydrogenase; Pro 4e-05
PRK08703239 PRK08703, PRK08703, short chain dehydrogenase; Pro 4e-05
PRK12936245 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-prote 4e-05
PRK07062 265 PRK07062, PRK07062, short chain dehydrogenase; Pro 4e-05
cd08944246 cd08944, SDR_c12, classical (c) SDR, subgroup 12 5e-05
PRK06128300 PRK06128, PRK06128, oxidoreductase; Provisional 6e-05
PRK08220 252 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehy 7e-05
PRK12384 259 PRK12384, PRK12384, sorbitol-6-phosphate dehydroge 8e-05
TIGR02632 676 TIGR02632, RhaD_aldol-ADH, rhamnulose-1-phosphate 8e-05
PRK12937245 PRK12937, PRK12937, short chain dehydrogenase; Pro 9e-05
cd05326249 cd05326, secoisolariciresinol-DH_like_SDR_c, secoi 1e-04
PRK05867253 PRK05867, PRK05867, short chain dehydrogenase; Pro 1e-04
cd05371252 cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydr 1e-04
cd09762243 cd09762, HSDL2_SDR_c, human hydroxysteroid dehydro 1e-04
PRK08339 263 PRK08339, PRK08339, short chain dehydrogenase; Pro 1e-04
PRK06196 315 PRK06196, PRK06196, oxidoreductase; Provisional 1e-04
PRK06172253 PRK06172, PRK06172, short chain dehydrogenase; Pro 1e-04
PRK06057 255 PRK06057, PRK06057, short chain dehydrogenase; Pro 2e-04
PRK08655 437 PRK08655, PRK08655, prephenate dehydrogenase; Prov 2e-04
PRK06124256 PRK06124, PRK06124, gluconate 5-dehydrogenase; Pro 2e-04
PRK07069 251 PRK07069, PRK07069, short chain dehydrogenase; Val 2e-04
PRK08278 273 PRK08278, PRK08278, short chain dehydrogenase; Pro 3e-04
PRK12481251 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrog 3e-04
cd08931227 cd08931, SDR_c9, classical (c) SDR, subgroup 9 4e-04
PRK07102243 PRK07102, PRK07102, short chain dehydrogenase; Pro 4e-04
PRK06077252 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) 5e-04
cd11730206 cd11730, Tthb094_like_SDR_c, Tthb094 and related p 6e-04
PRK08267 260 PRK08267, PRK08267, short chain dehydrogenase; Pro 7e-04
PRK06113255 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydro 7e-04
cd08951 260 cd08951, DR_C-13_KR_SDR_c_like, daunorubicin C-13 0.001
pfam13460182 pfam13460, NAD_binding_10, NADH(P)-binding 0.001
PRK08936 261 PRK08936, PRK08936, glucose-1-dehydrogenase; Provi 0.002
PRK07576 264 PRK07576, PRK07576, short chain dehydrogenase; Pro 0.002
PRK06101240 PRK06101, PRK06101, short chain dehydrogenase; Pro 0.002
COG0604326 COG0604, Qor, NADPH:quinone reductase and related 0.003
cd09807 274 cd09807, retinol-DH_like_SDR_c, retinol dehydrogen 0.003
PRK12938246 PRK12938, PRK12938, acetyacetyl-CoA reductase; Pro 0.003
PRK07792 306 PRK07792, fabG, 3-ketoacyl-(acyl-carrier-protein) 0.003
cd09809 284 cd09809, human_WWOX_like_SDR_c-like, human WWOX (W 0.003
cd05271 273 cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ub 0.003
cd08953436 cd08953, KR_2_SDR_x, ketoreductase (KR), subgroup 0.004
PRK08340 259 PRK08340, PRK08340, glucose-1-dehydrogenase; Provi 0.004
>gnl|CDD|166421 PLN02780, PLN02780, ketoreductase/ oxidoreductase Back     alignment and domain information
 Score =  358 bits (921), Expect = e-126
 Identities = 161/193 (83%), Positives = 179/193 (92%), Gaps = 1/193 (0%)

Query: 1   MESCFLNTLKTQPLWLLALFTIGSLSVLRLAFVILNWVYVNFLRPAKNLRKYGSWALVTG 60
           ME CF++ LK+QPLWLL LF +GSLS+L+  F ILNWVYV FLRPAKNL+KYGSWALVTG
Sbjct: 1   MELCFVDKLKSQPLWLLVLFVLGSLSILKFFFTILNWVYVYFLRPAKNLKKYGSWALVTG 60

Query: 61  PTDGIGKSFAFQLAKTGLNLVLVGRNPDKLKDVSDSIQAKYAKTQIKSVVVDFSGDLDEG 120
           PTDGIGK FAFQLA+ GLNLVLV RNPDKLKDVSDSIQ+KY+KTQIK+VVVDFSGD+DEG
Sbjct: 61  PTDGIGKGFAFQLARKGLNLVLVARNPDKLKDVSDSIQSKYSKTQIKTVVVDFSGDIDEG 120

Query: 121 VERIKEAIEGLDVGVLINNVGISYPYARFFHEVDQVLLKNLIKVNVEGTTKVTQAVLPGM 180
           V+RIKE IEGLDVGVLINNVG+SYPYARFFHEVD+ LLKNLIKVNVEGTTKVTQAVLPGM
Sbjct: 121 VKRIKETIEGLDVGVLINNVGVSYPYARFFHEVDEELLKNLIKVNVEGTTKVTQAVLPGM 180

Query: 181 LKRKKGLSMLNIG 193
           LKRKKG +++NIG
Sbjct: 181 LKRKKG-AIINIG 192


Length = 320

>gnl|CDD|187614 cd05356, 17beta-HSD1_like_SDR_c, 17-beta-hydroxysteroid dehydrogenases (17beta-HSDs) types -1, -3, and -12, -like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|223377 COG0300, DltE, Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>gnl|CDD|236074 PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|212491 cd05233, SDR_c, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180984 PRK07454, PRK07454, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187593 cd05332, 11beta-HSD1_like_SDR_c, 11beta-hydroxysteroid dehydrogenase type 1 (11beta-HSD1)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187643 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine reductase (KDSR) and related proteins, classical (c) SDR Back     alignment and domain information
>gnl|CDD|226674 COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>gnl|CDD|187604 cd05346, SDR_c5, classical (c) SDR, subgroup 5 Back     alignment and domain information
>gnl|CDD|187594 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein reductase (BKR), involved in Type II FAS, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|233590 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>gnl|CDD|187632 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187598 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hydroxysteroid dehydrogenase XI-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235546 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|183775 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>gnl|CDD|235500 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|235962 PRK07201, PRK07201, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|184025 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236372 PRK09072, PRK09072, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187639 cd08934, CAD_SDR_c, clavulanic acid dehydrogenase (CAD), classical (c) SDR Back     alignment and domain information
>gnl|CDD|212492 cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187605 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogenase (Ga5DH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235506 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|237100 PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187622 cd05364, SDR_c11, classical (c) SDR, subgroup 11 Back     alignment and domain information
>gnl|CDD|236357 PRK08945, PRK08945, putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|223959 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|235975 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|211705 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>gnl|CDD|235631 PRK05866, PRK05866, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187586 cd05325, carb_red_sniffer_like_SDR_c, carbonyl reductase sniffer-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187628 cd05370, SDR_c2, classical (c) SDR, subgroup 2 Back     alignment and domain information
>gnl|CDD|183778 PRK12829, PRK12829, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181721 PRK09242, PRK09242, tropinone reductase; Provisional Back     alignment and domain information
>gnl|CDD|187602 cd05344, BKR_like_SDR_like, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR)-like, SDR Back     alignment and domain information
>gnl|CDD|235726 PRK06181, PRK06181, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187585 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicular carbonyl reductase (PTCR)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181225 PRK08085, PRK08085, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187599 cd05340, Ycik_SDR_c, Escherichia coli K-12 YCIK-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236040 PRK07523, PRK07523, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181305 PRK08226, PRK08226, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187584 cd05323, ADH_SDR_c_like, insect type alcohol dehydrogenase (ADH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|237218 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|235933 PRK07097, PRK07097, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|226476 COG3967, DltE, Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|187609 cd05351, XR_like_SDR_c, xylulose reductase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235924 PRK07063, PRK07063, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187644 cd08940, HBDH_SDR_c, d-3-hydroxybutyrate dehydrogenase (HBDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187635 cd08930, SDR_c8, classical (c) SDR, subgroup 8 Back     alignment and domain information
>gnl|CDD|235633 PRK05872, PRK05872, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180744 PRK06914, PRK06914, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187612 cd05354, SDR_c7, classical (c) SDR, subgroup 7 Back     alignment and domain information
>gnl|CDD|236241 PRK08324, PRK08324, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|213929 TIGR04316, dhbA_paeA, 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase Back     alignment and domain information
>gnl|CDD|187611 cd05353, hydroxyacyl-CoA-like_DH_SDR_c-like, (3R)-hydroxyacyl-CoA dehydrogenase-like, classical(c)-like SDRs Back     alignment and domain information
>gnl|CDD|180408 PRK06114, PRK06114, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181131 PRK07814, PRK07814, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181491 PRK08589, PRK08589, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|188169 TIGR01829, AcAcCoA_reduct, acetoacetyl-CoA reductase Back     alignment and domain information
>gnl|CDD|187608 cd05350, SDR_c6, classical (c) SDR, subgroup 6 Back     alignment and domain information
>gnl|CDD|187626 cd05368, DHRS6_like_SDR_c, human DHRS6-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187627 cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reductase (TER) and 2,4-dienoyl-CoA reductase (DECR), atypical (a) SDR Back     alignment and domain information
>gnl|CDD|132250 TIGR03206, benzo_BadH, 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|235935 PRK07109, PRK07109, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|131468 TIGR02415, 23BDH, acetoin reductases Back     alignment and domain information
>gnl|CDD|183833 PRK12939, PRK12939, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|183773 PRK12824, PRK12824, acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|187597 cd05338, DHRS1_HSDL2-like_SDR_c, human dehydrogenase/reductase (SDR family) member 1 (DHRS1) and human hydroxysteroid dehydrogenase-like protein 2 (HSDL2), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187631 cd05373, SDR_c10, classical (c) SDR, subgroup 10 Back     alignment and domain information
>gnl|CDD|187596 cd05337, BKR_1_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR), subgroup 1, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187601 cd05343, Mgc4172-like_SDR_c, human Mgc4172-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187642 cd08937, DHB_DH-like_SDR_c, 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase (DHB DH)-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|181044 PRK07577, PRK07577, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187625 cd05367, SPR-like_SDR_c, sepiapterin reductase (SPR)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180446 PRK06180, PRK06180, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183772 PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236094 PRK07774, PRK07774, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180823 PRK07074, PRK07074, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181335 PRK08264, PRK08264, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|212493 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|180773 PRK06949, PRK06949, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|182531 PRK10538, PRK10538, malonic semialdehyde reductase; Provisional Back     alignment and domain information
>gnl|CDD|235925 PRK07067, PRK07067, sorbitol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235725 PRK06179, PRK06179, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181139 PRK07832, PRK07832, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187664 cd09763, DHRS1-like_SDR_c, human dehydrogenase/reductase (SDR family) member 1 (DHRS1) -like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181159 PRK07890, PRK07890, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180723 PRK06841, PRK06841, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187610 cd05352, MDH-like_SDR_c, mannitol dehydrogenase (MDH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180448 PRK06182, PRK06182, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181295 PRK08213, PRK08213, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180576 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181762 PRK09291, PRK09291, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|168186 PRK05693, PRK05693, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181113 PRK07775, PRK07775, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180617 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|235703 PRK06125, PRK06125, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187600 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235990 PRK07326, PRK07326, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181297 PRK08217, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|236216 PRK08277, PRK08277, D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|180300 PRK05875, PRK05875, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235794 PRK06398, PRK06398, aldose dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187607 cd05349, BKR_2_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP]reductase (BKR), subgroup 2, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187649 cd08945, PKR_SDR_c, Polyketide ketoreductase, classical (c) SDR Back     alignment and domain information
>gnl|CDD|237188 PRK12745, PRK12745, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187616 cd05358, GlcDH_SDR_c, glucose 1 dehydrogenase (GlcDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181077 PRK07677, PRK07677, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235712 PRK06138, PRK06138, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187618 cd05360, SDR_c3, classical (c) SDR, subgroup 3 Back     alignment and domain information
>gnl|CDD|181518 PRK08643, PRK08643, acetoin reductase; Validated Back     alignment and domain information
>gnl|CDD|187623 cd05365, 7_alpha_HSDH_SDR_c, 7 alpha-hydroxysteroid dehydrogenase (7 alpha-HSDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187640 cd08935, mannonate_red_SDR_c, putative D-mannonate oxidoreductase, classical (c) SDR Back     alignment and domain information
>gnl|CDD|180462 PRK06198, PRK06198, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|188170 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>gnl|CDD|181136 PRK07825, PRK07825, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236145 PRK08063, PRK08063, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|234422 TIGR03971, SDR_subfam_1, oxidoreductase, SDR family Back     alignment and domain information
>gnl|CDD|187620 cd05362, THN_reductase-like_SDR_c, tetrahydroxynaphthalene/trihydroxynaphthalene reductase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187603 cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR), subgroup 3, classical (c) SDR Back     alignment and domain information
>gnl|CDD|237220 PRK12828, PRK12828, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180439 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|233441 TIGR01500, sepiapter_red, sepiapterin reductase Back     alignment and domain information
>gnl|CDD|187668 cd09808, DHRS-12_like_SDR_c-like, human dehydrogenase/reductase SDR family member (DHRS)-12/FLJ13639-like, classical (c)-like SDRs Back     alignment and domain information
>gnl|CDD|187647 cd08943, R1PA_ADH_SDR_c, rhamnulose-1-phosphate aldolase/alcohol dehydrogenase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|237187 PRK12743, PRK12743, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|215720 pfam00106, adh_short, short chain dehydrogenase Back     alignment and domain information
>gnl|CDD|183832 PRK12935, PRK12935, acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|237219 PRK12827, PRK12827, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187624 cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181298 PRK08219, PRK08219, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180817 PRK07060, PRK07060, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187592 cd05331, DH-DHB-DH_SDR_c, 2,3 dihydro-2,3 dihydrozybenzoate dehydrogenases, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181334 PRK08263, PRK08263, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187591 cd05330, cyclohexanol_reductase_SDR_c, cyclohexanol reductases, including levodione reductase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236116 PRK07856, PRK07856, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187646 cd08942, RhlG_SDR_c, RhlG and related beta-ketoacyl reductases, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187613 cd05355, SDR_c1, classical (c) SDR, subgroup 1 Back     alignment and domain information
>gnl|CDD|187590 cd05329, TR_SDR_c, tropinone reductase-I and II (TR-1, and TR-II)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180604 PRK06523, PRK06523, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235853 PRK06701, PRK06701, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235627 PRK05854, PRK05854, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187634 cd08929, SDR_c4, classical (c) SDR, subgroup 4 Back     alignment and domain information
>gnl|CDD|180802 PRK07035, PRK07035, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180458 PRK06194, PRK06194, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235737 PRK06197, PRK06197, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187666 cd09806, type1_17beta-HSD-like_SDR_c, human estrogenic 17beta-hydroxysteroid dehydrogenase type 1 (type 1 17beta-HSD)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180993 PRK07478, PRK07478, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236209 PRK08265, PRK08265, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187617 cd05359, ChcA_like_SDR_c, 1-cyclohexenylcarbonyl_coenzyme A_reductase (ChcA)_like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|183718 PRK12746, PRK12746, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235545 PRK05650, PRK05650, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180761 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235816 PRK06500, PRK06500, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187641 cd08936, CR_SDR_c, Porcine peroxisomal carbonyl reductase like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|181517 PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|133446 cd01078, NAD_bind_H4MPT_DH, NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>gnl|CDD|187621 cd05363, SDH_SDR_c, Sorbitol dehydrogenase (SDH), classical (c) SDR Back     alignment and domain information
>gnl|CDD|235713 PRK06139, PRK06139, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|169556 PRK08703, PRK08703, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|171820 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>gnl|CDD|180818 PRK07062, PRK07062, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187648 cd08944, SDR_c12, classical (c) SDR, subgroup 12 Back     alignment and domain information
>gnl|CDD|180413 PRK06128, PRK06128, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|236190 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|183489 PRK12384, PRK12384, sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|131680 TIGR02632, RhaD_aldol-ADH, rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|171821 PRK12937, PRK12937, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187587 cd05326, secoisolariciresinol-DH_like_SDR_c, secoisolariciresinol dehydrogenase (secoisolariciresinol-DH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|135631 PRK05867, PRK05867, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187629 cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydrogenase type 10 (HSD10)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187663 cd09762, HSDL2_SDR_c, human hydroxysteroid dehydrogenase-like protein 2 (HSDL2), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|169389 PRK08339, PRK08339, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235736 PRK06196, PRK06196, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|180440 PRK06172, PRK06172, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180371 PRK06057, PRK06057, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236326 PRK08655, PRK08655, prephenate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235702 PRK06124, PRK06124, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180822 PRK07069, PRK07069, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181349 PRK08278, PRK08278, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|171531 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187636 cd08931, SDR_c9, classical (c) SDR, subgroup 9 Back     alignment and domain information
>gnl|CDD|180838 PRK07102, PRK07102, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235693 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|212496 cd11730, Tthb094_like_SDR_c, Tthb094 and related proteins, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236210 PRK08267, PRK08267, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|135765 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187654 cd08951, DR_C-13_KR_SDR_c_like, daunorubicin C-13 ketoreductase (KR), classical (c)-like SDRs Back     alignment and domain information
>gnl|CDD|222146 pfam13460, NAD_binding_10, NADH(P)-binding Back     alignment and domain information
>gnl|CDD|181585 PRK08936, PRK08936, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236056 PRK07576, PRK07576, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180399 PRK06101, PRK06101, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223677 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>gnl|CDD|212495 cd09807, retinol-DH_like_SDR_c, retinol dehydrogenases (retinol-DHs), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|171822 PRK12938, PRK12938, acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|181120 PRK07792, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187669 cd09809, human_WWOX_like_SDR_c-like, human WWOX (WW domain-containing oxidoreductase)-like, classical (c)-like SDRs Back     alignment and domain information
>gnl|CDD|187579 cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, subunit 9, 39 kDa, (NDUFA9) -like, atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187656 cd08953, KR_2_SDR_x, ketoreductase (KR), subgroup 2, complex (x) SDRs Back     alignment and domain information
>gnl|CDD|169390 PRK08340, PRK08340, glucose-1-dehydrogenase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 206
PLN02780 320 ketoreductase/ oxidoreductase 100.0
KOG1201 300 consensus Hydroxysteroid 17-beta dehydrogenase 11 100.0
KOG1205 282 consensus Predicted dehydrogenase [Secondary metab 100.0
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 100.0
COG0300 265 DltE Short-chain dehydrogenases of various substra 100.0
KOG1014 312 consensus 17 beta-hydroxysteroid dehydrogenase typ 100.0
PRK08339 263 short chain dehydrogenase; Provisional 99.95
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 99.95
PRK07062 265 short chain dehydrogenase; Provisional 99.94
PRK06139 330 short chain dehydrogenase; Provisional 99.94
KOG1208 314 consensus Dehydrogenases with different specificit 99.94
PRK07063 260 short chain dehydrogenase; Provisional 99.94
KOG1610 322 consensus Corticosteroid 11-beta-dehydrogenase and 99.94
KOG1200256 consensus Mitochondrial/plastidial beta-ketoacyl-A 99.94
PRK05876 275 short chain dehydrogenase; Provisional 99.94
KOG0725 270 consensus Reductases with broad range of substrate 99.93
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.93
PLN02730 303 enoyl-[acyl-carrier-protein] reductase 99.93
PRK05872 296 short chain dehydrogenase; Provisional 99.93
PRK07478254 short chain dehydrogenase; Provisional 99.93
PRK08862227 short chain dehydrogenase; Provisional 99.93
PRK08589 272 short chain dehydrogenase; Validated 99.93
PRK05854 313 short chain dehydrogenase; Provisional 99.93
PRK08415 274 enoyl-(acyl carrier protein) reductase; Provisiona 99.93
PRK05867253 short chain dehydrogenase; Provisional 99.93
PRK07791 286 short chain dehydrogenase; Provisional 99.93
PRK07109 334 short chain dehydrogenase; Provisional 99.93
PRK09242257 tropinone reductase; Provisional 99.92
PLN02253 280 xanthoxin dehydrogenase 99.92
PRK07825 273 short chain dehydrogenase; Provisional 99.92
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 99.92
PRK06114254 short chain dehydrogenase; Provisional 99.92
PRK06505 271 enoyl-(acyl carrier protein) reductase; Provisiona 99.92
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 99.92
PRK08085254 gluconate 5-dehydrogenase; Provisional 99.92
PRK06125 259 short chain dehydrogenase; Provisional 99.92
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 99.92
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 99.92
PRK06194 287 hypothetical protein; Provisional 99.92
PRK07097 265 gluconate 5-dehydrogenase; Provisional 99.92
PRK08303 305 short chain dehydrogenase; Provisional 99.92
PRK07677 252 short chain dehydrogenase; Provisional 99.92
PRK06398 258 aldose dehydrogenase; Validated 99.92
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 99.92
PRK05717255 oxidoreductase; Validated 99.92
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.92
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 99.91
PRK05599246 hypothetical protein; Provisional 99.91
PRK06603 260 enoyl-(acyl carrier protein) reductase; Provisiona 99.91
KOG1210 331 consensus Predicted 3-ketosphinganine reductase [S 99.91
PRK08277 278 D-mannonate oxidoreductase; Provisional 99.91
PRK07523255 gluconate 5-dehydrogenase; Provisional 99.91
PRK05866 293 short chain dehydrogenase; Provisional 99.91
KOG4169 261 consensus 15-hydroxyprostaglandin dehydrogenase an 99.91
PRK08251248 short chain dehydrogenase; Provisional 99.91
PRK08265 261 short chain dehydrogenase; Provisional 99.91
PRK08690 261 enoyl-(acyl carrier protein) reductase; Provisiona 99.91
PRK12823 260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 99.91
PRK07035252 short chain dehydrogenase; Provisional 99.91
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 99.91
PRK08159 272 enoyl-(acyl carrier protein) reductase; Provisiona 99.91
PRK08340 259 glucose-1-dehydrogenase; Provisional 99.91
PRK07024 257 short chain dehydrogenase; Provisional 99.91
PRK06172253 short chain dehydrogenase; Provisional 99.91
PRK12747252 short chain dehydrogenase; Provisional 99.91
PRK06124256 gluconate 5-dehydrogenase; Provisional 99.91
PRK08278 273 short chain dehydrogenase; Provisional 99.91
PRK12384 259 sorbitol-6-phosphate dehydrogenase; Provisional 99.91
PRK07792 306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.91
PRK09186256 flagellin modification protein A; Provisional 99.91
PRK05993 277 short chain dehydrogenase; Provisional 99.91
PRK05855 582 short chain dehydrogenase; Validated 99.91
PRK07984 262 enoyl-(acyl carrier protein) reductase; Provisiona 99.91
PRK08643 256 acetoin reductase; Validated 99.91
TIGR01289 314 LPOR light-dependent protochlorophyllide reductase 99.9
PRK06997 260 enoyl-(acyl carrier protein) reductase; Provisiona 99.9
PRK06484 520 short chain dehydrogenase; Validated 99.9
PRK07814 263 short chain dehydrogenase; Provisional 99.9
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.9
PRK07831262 short chain dehydrogenase; Provisional 99.9
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 99.9
TIGR03325 262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 99.9
PRK06197 306 short chain dehydrogenase; Provisional 99.9
PRK07576 264 short chain dehydrogenase; Provisional 99.9
PRK06180 277 short chain dehydrogenase; Provisional 99.9
PRK07067 257 sorbitol dehydrogenase; Provisional 99.9
PRK05650 270 short chain dehydrogenase; Provisional 99.9
PRK06138252 short chain dehydrogenase; Provisional 99.9
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 99.9
PRK07890 258 short chain dehydrogenase; Provisional 99.9
PRK08703239 short chain dehydrogenase; Provisional 99.9
PRK06200 263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 99.9
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 99.9
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 99.9
PRK07904253 short chain dehydrogenase; Provisional 99.9
PRK09072 263 short chain dehydrogenase; Provisional 99.9
PRK08936 261 glucose-1-dehydrogenase; Provisional 99.9
PRK07832 272 short chain dehydrogenase; Provisional 99.9
PRK06484 520 short chain dehydrogenase; Validated 99.9
PRK06182 273 short chain dehydrogenase; Validated 99.9
PRK06128300 oxidoreductase; Provisional 99.9
PRK07856 252 short chain dehydrogenase; Provisional 99.9
PRK07985294 oxidoreductase; Provisional 99.9
PRK07102243 short chain dehydrogenase; Provisional 99.89
PLN00015 308 protochlorophyllide reductase 99.89
KOG1207245 consensus Diacetyl reductase/L-xylulose reductase 99.89
PRK06914 280 short chain dehydrogenase; Provisional 99.89
PRK12938246 acetyacetyl-CoA reductase; Provisional 99.89
PRK07453 322 protochlorophyllide oxidoreductase; Validated 99.89
PRK06179 270 short chain dehydrogenase; Provisional 99.89
PRK12743 256 oxidoreductase; Provisional 99.89
PRK07774250 short chain dehydrogenase; Provisional 99.89
PRK08263 275 short chain dehydrogenase; Provisional 99.89
PRK07454241 short chain dehydrogenase; Provisional 99.89
PRK06523 260 short chain dehydrogenase; Provisional 99.89
PRK08267 260 short chain dehydrogenase; Provisional 99.89
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.89
PRK06841255 short chain dehydrogenase; Provisional 99.89
PRK13394 262 3-hydroxybutyrate dehydrogenase; Provisional 99.89
PRK06463 255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.89
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.89
PRK12429 258 3-hydroxybutyrate dehydrogenase; Provisional 99.89
PRK06300 299 enoyl-(acyl carrier protein) reductase; Provisiona 99.89
PRK06057 255 short chain dehydrogenase; Provisional 99.89
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 99.89
PRK08628 258 short chain dehydrogenase; Provisional 99.89
TIGR02415 254 23BDH acetoin reductases. One member of this famil 99.89
PRK06196 315 oxidoreductase; Provisional 99.89
PRK08213259 gluconate 5-dehydrogenase; Provisional 99.89
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 99.89
PRK12939250 short chain dehydrogenase; Provisional 99.88
PRK07069 251 short chain dehydrogenase; Validated 99.88
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 99.88
PRK06949258 short chain dehydrogenase; Provisional 99.88
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.88
PRK12935247 acetoacetyl-CoA reductase; Provisional 99.88
PRK06171 266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 99.88
PRK06483236 dihydromonapterin reductase; Provisional 99.88
PRK05875 276 short chain dehydrogenase; Provisional 99.88
PRK07775 274 short chain dehydrogenase; Provisional 99.88
PRK08226 263 short chain dehydrogenase; Provisional 99.88
PRK06482 276 short chain dehydrogenase; Provisional 99.88
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 99.88
TIGR02632 676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 99.88
KOG1209 289 consensus 1-Acyl dihydroxyacetone phosphate reduct 99.88
PRK06500249 short chain dehydrogenase; Provisional 99.88
PRK09134258 short chain dehydrogenase; Provisional 99.88
PRK07201 657 short chain dehydrogenase; Provisional 99.87
PRK10538 248 malonic semialdehyde reductase; Provisional 99.87
PRK09291 257 short chain dehydrogenase; Provisional 99.87
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.87
PRK06701290 short chain dehydrogenase; Provisional 99.87
PRK06123248 short chain dehydrogenase; Provisional 99.87
PRK06198 260 short chain dehydrogenase; Provisional 99.87
PRK12937245 short chain dehydrogenase; Provisional 99.87
PRK06101240 short chain dehydrogenase; Provisional 99.87
PRK06947248 glucose-1-dehydrogenase; Provisional 99.87
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 99.87
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.86
PRK12746254 short chain dehydrogenase; Provisional 99.86
PRK05693 274 short chain dehydrogenase; Provisional 99.86
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 99.86
PRK12824245 acetoacetyl-CoA reductase; Provisional 99.86
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 99.86
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.86
PRK08220 252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 99.86
PRK06181 263 short chain dehydrogenase; Provisional 99.86
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 99.86
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.85
PRK07326237 short chain dehydrogenase; Provisional 99.85
TIGR01963 255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 99.85
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.85
PRK12744257 short chain dehydrogenase; Provisional 99.85
PRK12827249 short chain dehydrogenase; Provisional 99.85
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.85
COG1028251 FabG Dehydrogenases with different specificities ( 99.85
PRK06924251 short chain dehydrogenase; Provisional 99.85
PRK12828239 short chain dehydrogenase; Provisional 99.85
PRK08264238 short chain dehydrogenase; Validated 99.85
KOG1611249 consensus Predicted short chain-type dehydrogenase 99.85
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 99.85
PRK07060245 short chain dehydrogenase; Provisional 99.85
PRK12742237 oxidoreductase; Provisional 99.85
PRK07074 257 short chain dehydrogenase; Provisional 99.84
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.84
PRK05884223 short chain dehydrogenase; Provisional 99.84
PRK06940 275 short chain dehydrogenase; Provisional 99.84
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.84
PRK12367245 short chain dehydrogenase; Provisional 99.84
PRK12829 264 short chain dehydrogenase; Provisional 99.84
PRK08324 681 short chain dehydrogenase; Validated 99.84
PRK07023243 short chain dehydrogenase; Provisional 99.83
PRK08177225 short chain dehydrogenase; Provisional 99.83
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 99.83
PRK06720169 hypothetical protein; Provisional 99.82
PRK06953222 short chain dehydrogenase; Provisional 99.82
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.82
PRK08017 256 oxidoreductase; Provisional 99.82
PRK07041230 short chain dehydrogenase; Provisional 99.82
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 99.81
PRK07578199 short chain dehydrogenase; Provisional 99.81
PRK07424406 bifunctional sterol desaturase/short chain dehydro 99.81
PRK09135249 pteridine reductase; Provisional 99.81
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.81
PRK09009235 C factor cell-cell signaling protein; Provisional 99.81
PRK07577234 short chain dehydrogenase; Provisional 99.81
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.79
KOG1199260 consensus Short-chain alcohol dehydrogenase/3-hydr 99.77
PRK08219227 short chain dehydrogenase; Provisional 99.77
KOG1478 341 consensus 3-keto sterol reductase [Lipid transport 99.76
PRK07806 248 short chain dehydrogenase; Provisional 99.75
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 99.75
smart00822180 PKS_KR This enzymatic domain is part of bacterial 99.75
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 99.73
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 99.71
PLN03209 576 translocon at the inner envelope of chloroplast su 99.66
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 99.64
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 99.63
PLN02653 340 GDP-mannose 4,6-dehydratase 99.62
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 99.62
COG0623 259 FabI Enoyl-[acyl-carrier-protein] 99.6
KOG1204253 consensus Predicted dehydrogenase [Secondary metab 99.6
PLN02896 353 cinnamyl-alcohol dehydrogenase 99.56
PLN02986 322 cinnamyl-alcohol dehydrogenase family protein 99.56
PLN02240 352 UDP-glucose 4-epimerase 99.55
PLN02583 297 cinnamoyl-CoA reductase 99.55
PLN02572 442 UDP-sulfoquinovose synthase 99.55
PF02719 293 Polysacc_synt_2: Polysaccharide biosynthesis prote 99.54
PLN02214 342 cinnamoyl-CoA reductase 99.53
TIGR01472 343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 99.53
PLN02650 351 dihydroflavonol-4-reductase 99.52
PLN00198 338 anthocyanidin reductase; Provisional 99.51
PRK10217 355 dTDP-glucose 4,6-dehydratase; Provisional 99.51
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 99.51
KOG1502 327 consensus Flavonol reductase/cinnamoyl-CoA reducta 99.47
PRK10675 338 UDP-galactose-4-epimerase; Provisional 99.47
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 99.45
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 99.41
PRK13656 398 trans-2-enoyl-CoA reductase; Provisional 99.4
PRK10084 352 dTDP-glucose 4,6 dehydratase; Provisional 99.39
TIGR01181 317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 99.38
COG1087 329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 99.38
PLN00141 251 Tic62-NAD(P)-related group II protein; Provisional 99.37
TIGR01179 328 galE UDP-glucose-4-epimerase. This enzyme intercon 99.36
TIGR03466 328 HpnA hopanoid-associated sugar epimerase. The sequ 99.33
PF01073 280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 99.33
PRK12428 241 3-alpha-hydroxysteroid dehydrogenase; Provisional 99.31
PLN02427 386 UDP-apiose/xylose synthase 99.29
KOG1371 343 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo 99.27
PLN02686 367 cinnamoyl-CoA reductase 99.26
TIGR01746 367 Thioester-redct thioester reductase domain. It has 99.25
PRK11908 347 NAD-dependent epimerase/dehydratase family protein 99.21
PLN02260 668 probable rhamnose biosynthetic enzyme 99.2
CHL00194 317 ycf39 Ycf39; Provisional 99.2
PF01370 236 Epimerase: NAD dependent epimerase/dehydratase fam 99.18
PRK09987 299 dTDP-4-dehydrorhamnose reductase; Provisional 99.18
TIGR01214 287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 99.17
PRK08125 660 bifunctional UDP-glucuronic acid decarboxylase/UDP 99.15
PLN02206 442 UDP-glucuronate decarboxylase 99.15
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 99.14
PLN02166 436 dTDP-glucose 4,6-dehydratase 99.14
PRK07201 657 short chain dehydrogenase; Provisional 99.09
PLN02695 370 GDP-D-mannose-3',5'-epimerase 99.09
COG0451 314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 99.09
PRK11150 308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 99.06
PRK05865 854 hypothetical protein; Provisional 99.05
TIGR02197 314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 99.05
PF04321 286 RmlD_sub_bind: RmlD substrate binding domain; Inte 99.03
PLN02725 306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 99.02
PF07993 249 NAD_binding_4: Male sterility protein; InterPro: I 98.96
COG1091 281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 98.96
PF08643 299 DUF1776: Fungal family of unknown function (DUF177 98.96
PLN02503 605 fatty acyl-CoA reductase 2 98.95
COG1088 340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 98.92
PLN02778 298 3,5-epimerase/4-reductase 98.92
PLN02996 491 fatty acyl-CoA reductase 98.91
TIGR01777 292 yfcH conserved hypothetical protein TIGR01777. Thi 98.91
TIGR02114227 coaB_strep phosphopantothenate--cysteine ligase, s 98.86
KOG1430 361 consensus C-3 sterol dehydrogenase/3-beta-hydroxys 98.84
PRK08309177 short chain dehydrogenase; Provisional 98.81
COG3320 382 Putative dehydrogenase domain of multifunctional n 98.79
PRK12320 699 hypothetical protein; Provisional 98.77
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 98.72
PRK12548289 shikimate 5-dehydrogenase; Provisional 98.7
PRK06732229 phosphopantothenate--cysteine ligase; Validated 98.65
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 98.64
PLN02260 668 probable rhamnose biosynthetic enzyme 98.61
TIGR03649 285 ergot_EASG ergot alkaloid biosynthesis protein, AF 98.57
COG1090 297 Predicted nucleoside-diphosphate sugar epimerase [ 98.53
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 98.5
PLN00016 378 RNA-binding protein; Provisional 98.49
TIGR00521390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 98.49
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 98.34
KOG1429 350 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro 98.27
KOG1221 467 consensus Acyl-CoA reductase [Lipid transport and 98.26
KOG1202 2376 consensus Animal-type fatty acid synthase and rela 98.25
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 98.23
COG0702 275 Predicted nucleoside-diphosphate-sugar epimerases 98.21
COG1089 345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 98.21
PRK14982340 acyl-ACP reductase; Provisional 98.13
PRK09620229 hypothetical protein; Provisional 98.12
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 98.09
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 98.06
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 98.02
KOG4039238 consensus Serine/threonine kinase TIP30/CC3 [Signa 98.01
PTZ00325 321 malate dehydrogenase; Provisional 97.99
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 97.99
KOG1203 411 consensus Predicted dehydrogenase [Carbohydrate tr 97.98
PLN00106 323 malate dehydrogenase 97.93
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.91
COG2910211 Putative NADH-flavin reductase [General function p 97.85
KOG2865 391 consensus NADH:ubiquinone oxidoreductase, NDUFA9/3 97.83
PF04127185 DFP: DNA / pantothenate metabolism flavoprotein; I 97.79
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 97.79
cd01336 325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 97.75
KOG2733 423 consensus Uncharacterized membrane protein [Functi 97.73
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 97.71
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 97.65
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 97.63
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 97.61
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 97.59
COG4982 866 3-oxoacyl-[acyl-carrier protein] 97.57
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 97.57
PRK12549284 shikimate 5-dehydrogenase; Reviewed 97.56
cd05291 306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 97.56
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 97.52
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 97.51
cd08253325 zeta_crystallin Zeta-crystallin with NADP-dependen 97.47
cd05276323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 97.44
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 97.41
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 97.41
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 97.4
TIGR01758 324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 97.4
PRK05086 312 malate dehydrogenase; Provisional 97.39
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 97.35
PRK14027283 quinate/shikimate dehydrogenase; Provisional 97.35
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 97.34
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 97.33
PRK00066 315 ldh L-lactate dehydrogenase; Reviewed 97.31
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 97.3
PRK06849 389 hypothetical protein; Provisional 97.28
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 97.28
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 97.27
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 97.27
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 97.26
cd00704 323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 97.23
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 97.21
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 97.19
TIGR02824325 quinone_pig3 putative NAD(P)H quinone oxidoreducta 97.18
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 97.17
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 97.16
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 97.13
PRK13940414 glutamyl-tRNA reductase; Provisional 97.11
PRK08223287 hypothetical protein; Validated 97.11
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 97.1
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 97.1
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 97.09
cd01483143 E1_enzyme_family Superfamily of activating enzymes 97.08
KOG0747 331 consensus Putative NAD+-dependent epimerases [Carb 97.07
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 97.06
COG3268 382 Uncharacterized conserved protein [Function unknow 97.06
COG0569225 TrkA K+ transport systems, NAD-binding component [ 97.05
cd08244324 MDR_enoyl_red Possible enoyl reductase. Member ide 97.04
KOG4022236 consensus Dihydropteridine reductase DHPR/QDPR [Am 97.02
cd00650 263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 97.02
cd08268328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 97.02
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 96.96
cd05288329 PGDH Prostaglandin dehydrogenases. Prostaglandins 96.95
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 96.92
KOG1198347 consensus Zinc-binding oxidoreductase [Energy prod 96.9
COG2130340 Putative NADP-dependent oxidoreductases [General f 96.88
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 96.86
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 96.86
PRK05600 370 thiamine biosynthesis protein ThiF; Validated 96.85
cd05294 309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 96.84
PRK13982475 bifunctional SbtC-like/phosphopantothenoylcysteine 96.84
cd08292324 ETR_like_2 2-enoyl thioester reductase (ETR) like 96.83
PF1224278 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2 96.8
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 96.8
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 96.78
PLN02928347 oxidoreductase family protein 96.78
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 96.76
cd01489 312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 96.76
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 96.75
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 96.73
PRK07411 390 hypothetical protein; Validated 96.73
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 96.73
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 96.73
PRK13243333 glyoxylate reductase; Reviewed 96.72
PLN02740381 Alcohol dehydrogenase-like 96.72
PRK14968188 putative methyltransferase; Provisional 96.7
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 96.7
PRK15116268 sulfur acceptor protein CsdL; Provisional 96.67
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 96.67
PRK08328231 hypothetical protein; Provisional 96.65
PRK12480330 D-lactate dehydrogenase; Provisional 96.65
cd05282323 ETR_like 2-enoyl thioester reductase-like. 2-enoyl 96.63
PRK06436303 glycerate dehydrogenase; Provisional 96.63
PTZ00117 319 malate dehydrogenase; Provisional 96.6
PLN00203519 glutamyl-tRNA reductase 96.6
cd08291324 ETR_like_1 2-enoyl thioester reductase (ETR) like 96.6
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 96.59
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 96.57
cd05286320 QOR2 Quinone oxidoreductase (QOR). Quinone oxidore 96.57
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 96.56
PRK07878 392 molybdopterin biosynthesis-like protein MoeZ; Vali 96.55
PTZ00354334 alcohol dehydrogenase; Provisional 96.55
PRK06487317 glycerate dehydrogenase; Provisional 96.55
COG0039 313 Mdh Malate/lactate dehydrogenases [Energy producti 96.53
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 96.53
cd08297341 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These 96.52
cd08241323 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t 96.52
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 96.51
KOG0025354 consensus Zn2+-binding dehydrogenase (nuclear rece 96.5
cd01337 310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 96.49
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.48
cd08238410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 96.47
cd01338 322 MDH_choloroplast_like Chloroplast-like malate dehy 96.46
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 96.46
PRK07574385 formate dehydrogenase; Provisional 96.46
cd08250329 Mgc45594_like Mgc45594 gene product and other MDR 96.45
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 96.43
cd05290 307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 96.42
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 96.42
TIGR00715 256 precor6x_red precorrin-6x reductase. This enzyme w 96.42
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 96.41
PLN00112 444 malate dehydrogenase (NADP); Provisional 96.41
cd08290341 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi 96.41
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 96.39
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 96.38
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provision 96.35
PLN03139386 formate dehydrogenase; Provisional 96.34
cd05293 312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 96.34
cd01488 291 Uba3_RUB Ubiquitin activating enzyme (E1) subunit 96.34
TIGR01759 323 MalateDH-SF1 malate dehydrogenase. This model repr 96.34
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 96.32
TIGR01751398 crot-CoA-red crotonyl-CoA reductase. The enzyme mo 96.31
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 96.29
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.29
PRK12550272 shikimate 5-dehydrogenase; Reviewed 96.28
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 96.27
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 96.25
cd08246393 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- 96.24
cd08243320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 96.24
cd08231361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 96.22
PRK04148134 hypothetical protein; Provisional 96.21
PLN02602 350 lactate dehydrogenase 96.21
PLN02827378 Alcohol dehydrogenase-like 96.2
PRK06932314 glycerate dehydrogenase; Provisional 96.2
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 96.19
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 96.17
cd00300 300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 96.17
TIGR01381 664 E1_like_apg7 E1-like protein-activating enzyme Gsa 96.17
TIGR01772 312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 96.17
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 96.15
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 96.12
cd01490 435 Ube1_repeat2 Ubiquitin activating enzyme (E1), rep 96.11
PRK09496 453 trkA potassium transporter peripheral membrane com 96.1
PRK14851 679 hypothetical protein; Provisional 96.09
KOG1372 376 consensus GDP-mannose 4,6 dehydratase [Carbohydrat 96.07
cd05195293 enoyl_red enoyl reductase of polyketide synthase. 96.05
PTZ00082 321 L-lactate dehydrogenase; Provisional 96.0
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.98
PLN02494477 adenosylhomocysteinase 95.96
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 95.94
smart00829288 PKS_ER Enoylreductase. Enoylreductase in Polyketid 95.9
cd01486 307 Apg7 Apg7 is an E1-like protein, that activates tw 95.86
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 95.86
cd08235343 iditol_2_DH_like L-iditol 2-dehydrogenase. Putativ 95.85
PRK05442 326 malate dehydrogenase; Provisional 95.85
PF12076164 Wax2_C: WAX2 C-terminal domain; InterPro: IPR02194 95.84
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 95.83
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 95.81
cd08299373 alcohol_DH_class_I_II_IV class I, II, IV alcohol d 95.81
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 95.81
cd08274350 MDR9 Medium chain dehydrogenases/reductase (MDR)/z 95.8
PRK08306296 dipicolinate synthase subunit A; Reviewed 95.8
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 95.78
PRK06718202 precorrin-2 dehydrogenase; Reviewed 95.76
cd08269312 Zn_ADH9 Alcohol dehydrogenases of the MDR family. 95.76
cd08277365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 95.75
cd05285343 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a 95.75
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 95.74
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.72
PRK07877 722 hypothetical protein; Provisional 95.7
PRK06223 307 malate dehydrogenase; Reviewed 95.7
cd08284344 FDH_like_2 Glutathione-dependent formaldehyde dehy 95.69
PRK08655 437 prephenate dehydrogenase; Provisional 95.68
cd08251303 polyketide_synthase polyketide synthase. Polyketid 95.67
cd08249339 enoyl_reductase_like enoyl_reductase_like. Member 95.64
PRK10669558 putative cation:proton antiport protein; Provision 95.64
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 95.61
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 95.61
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 95.58
PRK11790 409 D-3-phosphoglycerate dehydrogenase; Provisional 95.56
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 95.56
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 95.53
PRK14852 989 hypothetical protein; Provisional 95.52
cd05292 308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 95.51
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 95.5
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
Probab=100.00  E-value=3.3e-36  Score=245.83  Aligned_cols=198  Identities=81%  Similarity=1.294  Sum_probs=178.6

Q ss_pred             CcccccccccchhHHHHHHHHHHHHHHHHHHHHHHHHHHhhhccCCcccccCCcEEEEECCCChHHHHHHHHHHHCCCcE
Q 028656            1 MESCFLNTLKTQPLWLLALFTIGSLSVLRLAFVILNWVYVNFLRPAKNLRKYGSWALVTGPTDGIGKSFAFQLAKTGLNL   80 (206)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~vlItGas~giG~~~a~~l~~~g~~V   80 (206)
                      ||-||+....++|+|+..++++|.+.++..++.++.+++..+.++.++++.+|++++||||++|||+++|++|+++|++|
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~lITGAs~GIG~alA~~La~~G~~V   80 (320)
T PLN02780          1 MELCFVDKLKSQPLWLLVLFVLGSLSILKFFFTILNWVYVYFLRPAKNLKKYGSWALVTGPTDGIGKGFAFQLARKGLNL   80 (320)
T ss_pred             CchhHHHHHhhchHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcccccccCCEEEEeCCCcHHHHHHHHHHHHCCCCE
Confidence            88899999999999999999999999999999999999988887777777789999999999999999999999999999


Q ss_pred             EEEEcChhhHHHHHHHHHHhcCCceEEEEEEecCCCchHHHHHHHHHhcCCCccEEEEeccccCCcccccccCCHHHHHH
Q 028656           81 VLVGRNPDKLKDVSDSIQAKYAKTQIKSVVVDFSGDLDEGVERIKEAIEGLDVGVLINNVGISYPYARFFHEVDQVLLKN  160 (206)
Q Consensus        81 ~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~id~lvnnAg~~~~~~~~~~~~~~~~~~~  160 (206)
                      ++++|++++++++.+++++.+++.++..+.+|++++.++.++++.+.+++.|+|++|||||+..+...++.+.+.+++++
T Consensus        81 il~~R~~~~l~~~~~~l~~~~~~~~~~~~~~Dl~~~~~~~~~~l~~~~~~~didilVnnAG~~~~~~~~~~~~~~~~~~~  160 (320)
T PLN02780         81 VLVARNPDKLKDVSDSIQSKYSKTQIKTVVVDFSGDIDEGVKRIKETIEGLDVGVLINNVGVSYPYARFFHEVDEELLKN  160 (320)
T ss_pred             EEEECCHHHHHHHHHHHHHHCCCcEEEEEEEECCCCcHHHHHHHHHHhcCCCccEEEEecCcCCCCCcccccCCHHHHHH
Confidence            99999999999999988876556678889999997666778888888888788899999998754334578899999999


Q ss_pred             HHhhhhhHHHHHHHHHhhhhHhCCCCceEEEeccccccc
Q 028656          161 LIKVNVEGTTKVTQAVLPGMLKRKKGLSMLNIGKAELMC  199 (206)
Q Consensus       161 ~~~~N~~g~~~~~~~~~~~~~~~~~g~~iv~isS~~~~~  199 (206)
                      ++++|+.|++.++++++|.|++++.|+ ||++||.++..
T Consensus       161 ~~~vN~~g~~~l~~~~lp~m~~~~~g~-IV~iSS~a~~~  198 (320)
T PLN02780        161 LIKVNVEGTTKVTQAVLPGMLKRKKGA-IINIGSGAAIV  198 (320)
T ss_pred             HHHHhHHHHHHHHHHHHHHHHhcCCcE-EEEEechhhcc
Confidence            999999999999999999999888888 99999999865



>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1610 consensus Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism; General function prediction only] Back     alignment and domain information
>KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG1210 consensus Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>KOG1207 consensus Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>KOG1611 consensus Predicted short chain-type dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG1199 consensus Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1478 consensus 3-keto sterol reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>KOG1204 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF08643 DUF1776: Fungal family of unknown function (DUF1776); InterPro: IPR013952 This is a fungal protein of unknown function Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG1221 consensus Acyl-CoA reductase [Lipid transport and metabolism] Back     alignment and domain information
>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>KOG4039 consensus Serine/threonine kinase TIP30/CC3 [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>KOG1203 consensus Predicted dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>KOG2865 consensus NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion] Back     alignment and domain information
>PF04127 DFP: DNA / pantothenate metabolism flavoprotein; InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>KOG2733 consensus Uncharacterized membrane protein [Function unknown] Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>COG4982 3-oxoacyl-[acyl-carrier protein] Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>KOG0747 consensus Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>COG3268 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>KOG4022 consensus Dihydropteridine reductase DHPR/QDPR [Amino acid transport and metabolism] Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>PF12242 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2-enoyl-CoA reductase; PDB: 3ZU5_A 3ZU3_A 3ZU4_A 3ZU2_A 3S8M_A Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>cd05282 ETR_like 2-enoyl thioester reductase-like Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>cd05286 QOR2 Quinone oxidoreductase (QOR) Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PTZ00354 alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08241 QOR1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>KOG0025 consensus Zn2+-binding dehydrogenase (nuclear receptor binding factor-1) [Transcription; Energy production and conversion] Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>cd08290 ETR 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>TIGR01751 crot-CoA-red crotonyl-CoA reductase Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>cd08246 crotonyl_coA_red crotonyl-CoA reductase Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>KOG1372 consensus GDP-mannose 4,6 dehydratase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05195 enoyl_red enoyl reductase of polyketide synthase Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>smart00829 PKS_ER Enoylreductase Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>PF12076 Wax2_C: WAX2 C-terminal domain; InterPro: IPR021940 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>cd05285 sorbitol_DH Sorbitol dehydrogenase Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>cd08251 polyketide_synthase polyketide synthase Back     alignment and domain information
>cd08249 enoyl_reductase_like enoyl_reductase_like Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query206
3t4x_A 267 Short Chain DehydrogenaseREDUCTASE FAMILY OXIDOREDU 9e-12
2pnf_A248 Structure Of Aquifex Aeolicus Fabg 3-oxoacyl-(acyl- 2e-10
1yb1_A272 Crystal Structure Of Human 17-Beta-Hydroxysteroid D 4e-08
3f5q_A262 Crystal Structure Of Putative Short Chain Dehydroge 7e-08
3ai1_A 263 The Crystal Structure Of L-Sorbose Reductase From G 7e-08
1xkq_A 280 Crystal Structure Of Short-Chain DehydrogenaseREDUC 2e-07
3ai3_A 263 The Crystal Structure Of L-Sorbose Reductase From G 3e-07
3rih_A 293 Crystal Structure Of A Putative Short Chain Dehydro 5e-07
3sj7_A252 Structure Of Beta-Ketoacetyl-Coa Reductase (Fabg) F 5e-07
3f1l_A252 The 0.95 A Structure Of An Oxidoreductase, Ycik Fro 6e-07
3rku_A287 Substrate Fingerprint And The Structure Of Nadp+ De 6e-07
2yz7_A 260 X-Ray Analyses Of 3-Hydroxybutyrate Dehydrogenase F 7e-07
4b79_A242 The Aeropath Project And Pseudomonas Aeruginosa Hig 8e-07
3g1t_A258 Crystal Structure Of Short Chain Dehydrogenase From 9e-07
3asu_A 248 Crystal Structure Of Serine Dehydrogenase From Esch 1e-06
3f5s_A255 Crystal Structure Of Putatitve Short Chain Dehydrog 1e-06
3s55_A 281 Crystal Structure Of A Putative Short-Chain Dehydro 2e-06
3rkr_A262 Crystal Structure Of A Metagenomic Short-Chain Oxid 3e-06
1geg_A 256 Cryatal Structure Analysis Of Meso-2,3-Butanediol D 5e-06
3osu_A246 Crystal Structure Of The 3-Oxoacyl-Acyl Carrier Pro 5e-06
3grp_A266 2.1 Angstrom Crystal Structure Of 3-Ketoacyl-(Acyl- 5e-06
1xhl_A 297 Crystal Structure Of Putative Tropinone Reductase-I 7e-06
4ibo_A271 Crystal Structure Of A Putative Gluconate Dehydroge 9e-06
2zat_A260 Crystal Structure Of A Mammalian Reductase Length = 9e-06
2nwq_A 272 Short Chain Dehydrogenase From Pseudomonas Aerugino 1e-05
4egf_A266 Crystal Structure Of A L-Xylulose Reductase From My 1e-05
3rsh_A251 Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein)reduc 1e-05
3tzc_A251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 1e-05
3tzh_A251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 2e-05
4g81_D255 Crystal Structure Of A Hexonate Dehydrogenase Ortho 2e-05
1yxm_A 303 Crystal Structure Of Peroxisomal Trans 2-Enoyl Coa 2e-05
4dc0_A 281 Crystal Structure Of F189w Actinorhodin Polyketide 2e-05
1vl8_A267 Crystal Structure Of Gluconate 5-dehydrogenase (tm0 2e-05
4dbz_A 281 Crystal Structure Of V151l Actinorhodin Polyketide 2e-05
1spx_A 278 Crystal Structure Of Glucose Dehydrogenase Of Caeno 2e-05
2jap_A247 Clavulanic Acid Dehydrogenase: Structural And Bioch 2e-05
4dc1_A 281 Crystal Structure Of Y202f Actinorhodin Polyketide 2e-05
1w4z_A 281 Structure Of Actinorhodin Polyketide (Actiii) Reduc 2e-05
2rh4_A 277 Actinorhodin Ketoreductase, Actkr, With Nadph And I 2e-05
1x7g_A 261 Actinorhodin Polyketide Ketoreductase, Act Kr, With 2e-05
3uf0_A273 Crystal Structure Of A Putative Nad(P) Dependent Gl 3e-05
3v2h_A 281 The Crystal Structure Of D-Beta-Hydroxybutyrate Deh 4e-05
3lz6_A 263 Guinea Pig 11beta Hydroxysteroid Dehydrogenase With 4e-05
4bb6_A 292 Free-Wilson And Structural Approaches To Co-Optimis 4e-05
4bb5_A 292 Free-Wilson And Structural Approaches To Co-Optimis 4e-05
3g49_A 277 N-(Pyridin-2-Yl) Arylsulfonamide Inhibitors Of 11b- 5e-05
1edo_A244 The X-Ray Structure Of Beta-Keto Acyl Carrier Prote 5e-05
1xse_A 295 Crystal Structure Of Guinea Pig 11beta-Hydroxystero 5e-05
3dwf_A 276 Crystal Structure Of The Guinea Pig 11beta-Hydroxys 5e-05
4imr_A275 Crystal Structure Of 3-oxoacyl (acyl-carrier-protei 5e-05
2q2q_A 255 Structure Of D-3-Hydroxybutyrate Dehydrogenase From 6e-05
3tzk_A251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 6e-05
2bel_A 283 Structure Of Human 11-Beta-Hydroxysteroid Dehydroge 6e-05
2jah_A247 Biochemical And Structural Analysis Of The Clavulan 6e-05
3iah_A256 Crystal Structure Of Short Chain Dehydrogenase (yci 7e-05
2irw_A 264 Human 11-Beta-Hydroxysteroid Dehydrogenase (Hsd1) W 7e-05
3f1k_A252 Crystal Structure Of Ycik From E. Coli, An Oxidored 8e-05
2rbe_A 275 The Discovery Of 2-Anilinothiazolones As 11beta-Hsd 8e-05
1xu7_A 286 Crystal Structure Of The Interface Open Conformatio 8e-05
3d5q_A 272 Crystal Structure Of 11b-Hsd1 In Complex With Triaz 8e-05
3o4r_A261 Crystal Structure Of Human DehydrogenaseREDUCTASE ( 8e-05
2ilt_A 275 Human 11-Beta-Hydroxysteroid Dehydrogenase (Hsd1) W 8e-05
3pdj_A 273 Crystal Structure Of Human 11-Beta-Hydroxysteroid D 9e-05
3u09_A251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 1e-04
2b4q_A276 Pseudomonas Aeruginosa RhlgNADP ACTIVE-Site Complex 1e-04
2uvd_A246 The Crystal Structure Of A 3-Oxoacyl-(Acyl Carrier 1e-04
2wdz_A254 Crystal Structure Of The Short Chain Dehydrogenase 1e-04
3ch6_A 286 Crystal Structure Of 11beta-Hsd1 Double Mutant (L26 1e-04
4hfr_A 272 Human 11beta-Hydroxysteroid Dehydrogenase Type 1 In 1e-04
1q7c_A244 The Structure Of Betaketoacyl-[acp] Reductase Y151f 1e-04
2cf2_E226 Architecture Of Mammalian Fatty Acid Synthase Lengt 1e-04
1i01_A244 Crystal Structure Of Beta-Ketoacyl [acyl Carrier Pr 1e-04
2z1n_A 260 Crystal Structure Of Ape0912 From Aeropyrum Pernix 2e-04
3e9q_A273 Crystal Structure Of The Short Chain Dehydrogenase 2e-04
3l77_A235 X-Ray Structure Alcohol Dehydrogenase From Archaeon 2e-04
3tn7_A257 Crystal Structure Of Short-Chain Alcohol Dehydrogen 2e-04
3qiv_A253 Crystal Structure Of A Putative Short-Chain Dehydro 2e-04
1y5m_A 276 The Crystal Structure Of Murine 11b-Hydroxysteroid 3e-04
3gmd_A 264 Structure-Based Design Of 7-Azaindole-Pyrrolidines 3e-04
2hq1_A247 Crystal Structure Of Orf 1438 A Putative GlucoseRIB 3e-04
3nug_A247 Crystal Structure Of Wild Type Tetrameric Pyridoxal 3e-04
2qq5_A 260 Crystal Structure Of Human Sdr Family Member 1 Leng 3e-04
3oml_A 613 Structure Of Full-Length Peroxisomal Multifunctiona 3e-04
3csd_B 281 Actinorhodin Polyketide Ketoreductase Mutant P94l B 3e-04
2rhr_B 277 P94l Actinorhodin Ketordeuctase Mutant, With Nadph 4e-04
3kvo_A 346 Crystal Structure Of The Catalytic Domain Of Human 5e-04
3cxr_A 291 Crystal Structure Of Gluconate 5-Dehydrogase From S 5e-04
1o5i_A249 Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protei 5e-04
2cfc_A250 Structural Basis For Stereo Selectivity In The (R)- 6e-04
1ahi_A255 7 Alpha-Hydroxysteroid Dehydrogenase Complexed With 6e-04
2c07_A285 Oxoacyl-Acp Reductase Of Plasmodium Falciparum Leng 7e-04
3ndr_A247 Crystal Structure Of Tetrameric Pyridoxal 4-Dehydro 7e-04
3oec_A 317 Crystal Structure Of Carveol Dehydrogenase From Myc 8e-04
3pk0_A 262 Crystal Structure Of Short-Chain DehydrogenaseREDUC 8e-04
4afn_A269 Crystal Structure Of 3-ketoacyl-(acyl-carrier-prote 9e-04
>pdb|3T4X|A Chain A, Short Chain DehydrogenaseREDUCTASE FAMILY OXIDOREDUCTASE FROM Bacillus Anthracis Str. Ames Ancestor Length = 267 Back     alignment and structure

Iteration: 1

Score = 66.6 bits (161), Expect = 9e-12, Method: Compositional matrix adjust. Identities = 48/154 (31%), Positives = 80/154 (51%), Gaps = 7/154 (4%) Query: 53 GSWALVTGPTDGIGKSFAFQLAKTGLNLVLVGRNPDKLKDVSDSIQAKYAKTQIKSVVVD 112 G ALVTG T GIGK+ A L G N+++ GR + + + I+A+Y ++ VV D Sbjct: 10 GKTALVTGSTAGIGKAIATSLVAEGANVLINGRREENVNETIKEIRAQYPDAILQPVVAD 69 Query: 113 FSGDLDEGVERIKEAIEGLDVGVLINNVGISYPYARFFHEVDQVLLKNLIKVNVEGTTKV 172 ++G + + E +D +LINN+GI P +F D+ K L +VN+ ++ Sbjct: 70 LG--TEQGCQDVIEKYPKVD--ILINNLGIFEP-VEYFDIPDEDWFK-LFEVNIXSGVRL 123 Query: 173 TQAVLPGMLKRKKGLSMLNIGKAELMCSVRF-HY 205 T++ L ++RK+G + +A + S HY Sbjct: 124 TRSYLKKXIERKEGRVIFIASEAAIXPSQEXAHY 157
>pdb|2PNF|A Chain A, Structure Of Aquifex Aeolicus Fabg 3-oxoacyl-(acyl-carrier Protein) Reductase Length = 248 Back     alignment and structure
>pdb|1YB1|A Chain A, Crystal Structure Of Human 17-Beta-Hydroxysteroid Dehydrogenase Type Xi Length = 272 Back     alignment and structure
>pdb|3F5Q|A Chain A, Crystal Structure Of Putative Short Chain Dehydrogenase From Escherichia Coli Cft073 Length = 262 Back     alignment and structure
>pdb|3AI1|A Chain A, The Crystal Structure Of L-Sorbose Reductase From Gluconobacter Frateurii Complexed With Nadph And L-Sorbose Reveals The Structure Bases Of Its Catalytic Mechanism And High Substrate Selectivity Length = 263 Back     alignment and structure
>pdb|1XKQ|A Chain A, Crystal Structure Of Short-Chain DehydrogenaseREDUCTASE OF Unknown Function From Caenorhabditis Elegans With Cofactor Length = 280 Back     alignment and structure
>pdb|3AI3|A Chain A, The Crystal Structure Of L-Sorbose Reductase From Gluconobacter Frateurii Complexed With Nadph And L-Sorbose Length = 263 Back     alignment and structure
>pdb|3RIH|A Chain A, Crystal Structure Of A Putative Short Chain Dehydrogenase Or Reductase From Mycobacterium Abscessus Length = 293 Back     alignment and structure
>pdb|3SJ7|A Chain A, Structure Of Beta-Ketoacetyl-Coa Reductase (Fabg) From Staphylococcus Aureus Complex With Nadph Length = 252 Back     alignment and structure
>pdb|3F1L|A Chain A, The 0.95 A Structure Of An Oxidoreductase, Ycik From E.Coli Length = 252 Back     alignment and structure
>pdb|3RKU|A Chain A, Substrate Fingerprint And The Structure Of Nadp+ Dependent Serine Dehydrogenase From Saccharomyces Cerevisiae Complexed With Nadp+ Length = 287 Back     alignment and structure
>pdb|2YZ7|A Chain A, X-Ray Analyses Of 3-Hydroxybutyrate Dehydrogenase From Alcaligenes Faecalis Length = 260 Back     alignment and structure
>pdb|4B79|A Chain A, The Aeropath Project And Pseudomonas Aeruginosa High-throughput Crystallographic Studies For Assessment Of Potential Targets In Early Stage Drug Discovery. Length = 242 Back     alignment and structure
>pdb|3G1T|A Chain A, Crystal Structure Of Short Chain Dehydrogenase From Salmonella Enterica Subsp. Enterica Serovar Typhi Str. Ct18 Length = 258 Back     alignment and structure
>pdb|3ASU|A Chain A, Crystal Structure Of Serine Dehydrogenase From Escherichia Coli Length = 248 Back     alignment and structure
>pdb|3F5S|A Chain A, Crystal Structure Of Putatitve Short Chain Dehydrogenase From Shigella Flexneri 2a Str. 301 Length = 255 Back     alignment and structure
>pdb|3S55|A Chain A, Crystal Structure Of A Putative Short-Chain DehydrogenaseREDUCTASE From Mycobacterium Abscessus Bound To Nad Length = 281 Back     alignment and structure
>pdb|3RKR|A Chain A, Crystal Structure Of A Metagenomic Short-Chain Oxidoreductase (Sdr) In Complex With Nadp Length = 262 Back     alignment and structure
>pdb|1GEG|A Chain A, Cryatal Structure Analysis Of Meso-2,3-Butanediol Dehydrogenase Length = 256 Back     alignment and structure
>pdb|3OSU|A Chain A, Crystal Structure Of The 3-Oxoacyl-Acyl Carrier Protein Reductase, Fabg, From Staphylococcus Aureus Length = 246 Back     alignment and structure
>pdb|3GRP|A Chain A, 2.1 Angstrom Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Bartonella Henselae Length = 266 Back     alignment and structure
>pdb|1XHL|A Chain A, Crystal Structure Of Putative Tropinone Reductase-Ii From Caenorhabditis Elegans With Cofactor And Substrate Length = 297 Back     alignment and structure
>pdb|4IBO|A Chain A, Crystal Structure Of A Putative Gluconate Dehydrogenase From Agrobacterium Tumefaciens (Target Efi-506446) Length = 271 Back     alignment and structure
>pdb|2ZAT|A Chain A, Crystal Structure Of A Mammalian Reductase Length = 260 Back     alignment and structure
>pdb|2NWQ|A Chain A, Short Chain Dehydrogenase From Pseudomonas Aeruginosa Length = 272 Back     alignment and structure
>pdb|4EGF|A Chain A, Crystal Structure Of A L-Xylulose Reductase From Mycobacterium Smegmatis Length = 266 Back     alignment and structure
>pdb|3RSH|A Chain A, Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein)reductase (Fabg) From Vibrio Cholerae O1 Complexed With Nadp+ (Space Group P62) Length = 251 Back     alignment and structure
>pdb|3TZC|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(Y155f) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|3TZH|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(F187a) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|4G81|D Chain D, Crystal Structure Of A Hexonate Dehydrogenase Ortholog (Target Efi- 506402 From Salmonella Enterica, Unliganded Structure Length = 255 Back     alignment and structure
>pdb|1YXM|A Chain A, Crystal Structure Of Peroxisomal Trans 2-Enoyl Coa Reductase Length = 303 Back     alignment and structure
>pdb|4DC0|A Chain A, Crystal Structure Of F189w Actinorhodin Polyketide Ketoreductase With Nadph Length = 281 Back     alignment and structure
>pdb|1VL8|A Chain A, Crystal Structure Of Gluconate 5-dehydrogenase (tm0441) From Thermotoga Maritima At 2.07 A Resolution Length = 267 Back     alignment and structure
>pdb|4DBZ|A Chain A, Crystal Structure Of V151l Actinorhodin Polyketide Ketoreductase With Nadph Length = 281 Back     alignment and structure
>pdb|1SPX|A Chain A, Crystal Structure Of Glucose Dehydrogenase Of Caenorhabditis Elegans In The Apo-Form Length = 278 Back     alignment and structure
>pdb|2JAP|A Chain A, Clavulanic Acid Dehydrogenase: Structural And Biochemical Analysis Of The Final Step In The Biosynthesis Of The Beta- Lactamase Inhibitor Clavulanic Acid Length = 247 Back     alignment and structure
>pdb|4DC1|A Chain A, Crystal Structure Of Y202f Actinorhodin Polyketide Ketoreductase With Nadph Length = 281 Back     alignment and structure
>pdb|1W4Z|A Chain A, Structure Of Actinorhodin Polyketide (Actiii) Reductase Length = 281 Back     alignment and structure
>pdb|2RH4|A Chain A, Actinorhodin Ketoreductase, Actkr, With Nadph And Inhibitor Emodin Length = 277 Back     alignment and structure
>pdb|1X7G|A Chain A, Actinorhodin Polyketide Ketoreductase, Act Kr, With Nadp Bound Length = 261 Back     alignment and structure
>pdb|3UF0|A Chain A, Crystal Structure Of A Putative Nad(P) Dependent Gluconate 5- Dehydrogenase From Beutenbergia Cavernae(Efi Target Efi-502044) With Bound Nadp (Low Occupancy) Length = 273 Back     alignment and structure
>pdb|3V2H|A Chain A, The Crystal Structure Of D-Beta-Hydroxybutyrate Dehydrogenase From Sinorhizobium Meliloti Length = 281 Back     alignment and structure
>pdb|3LZ6|A Chain A, Guinea Pig 11beta Hydroxysteroid Dehydrogenase With Pf-877423 Length = 263 Back     alignment and structure
>pdb|4BB6|A Chain A, Free-Wilson And Structural Approaches To Co-Optimising Human And Rodent Isoform Potency For 11b-Hydroxysteroid Dehydrogenase Type 1 11b-Hsd1 Inhibitors Length = 292 Back     alignment and structure
>pdb|4BB5|A Chain A, Free-Wilson And Structural Approaches To Co-Optimising Human And Rodent Isoform Potency For 11b-Hydroxysteroid Dehydrogenase Type 1 11b-Hsd1 Inhibitors Length = 292 Back     alignment and structure
>pdb|3G49|A Chain A, N-(Pyridin-2-Yl) Arylsulfonamide Inhibitors Of 11b-Hydroxysteroid Dehydrogenase Type 1: Discovery Of Pf-915275 Length = 277 Back     alignment and structure
>pdb|1EDO|A Chain A, The X-Ray Structure Of Beta-Keto Acyl Carrier Protein Reductase From Brassica Napus Complexed With Nadp+ Length = 244 Back     alignment and structure
>pdb|1XSE|A Chain A, Crystal Structure Of Guinea Pig 11beta-Hydroxysteroid Dehydrogenase Type 1 Length = 295 Back     alignment and structure
>pdb|3DWF|A Chain A, Crystal Structure Of The Guinea Pig 11beta-Hydroxysteroid Dehydrogenase Type 1 Mutant F278e Length = 276 Back     alignment and structure
>pdb|4IMR|A Chain A, Crystal Structure Of 3-oxoacyl (acyl-carrier-protein) Reductase (target Efi-506442) From Agrobacterium Tumefaciens C58 With Nadp Bound Length = 275 Back     alignment and structure
>pdb|2Q2Q|A Chain A, Structure Of D-3-Hydroxybutyrate Dehydrogenase From Pseudomonas Putida Length = 255 Back     alignment and structure
>pdb|3TZK|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(G92a) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|2BEL|A Chain A, Structure Of Human 11-Beta-Hydroxysteroid Dehydrogenase In Complex With Nadp And Carbenoxolone Length = 283 Back     alignment and structure
>pdb|2JAH|A Chain A, Biochemical And Structural Analysis Of The Clavulanic Acid Dehydeogenase (Cad) From Streptomyces Clavuligerus Length = 247 Back     alignment and structure
>pdb|3IAH|A Chain A, Crystal Structure Of Short Chain Dehydrogenase (ycik) From Salmonella Enterica Subsp. Enterica Serovar Typhimurium Str. Lt2 In Complex With Nadp And Acetate. Length = 256 Back     alignment and structure
>pdb|2IRW|A Chain A, Human 11-Beta-Hydroxysteroid Dehydrogenase (Hsd1) With Nadp And Adamantane Ether Inhibitor Length = 264 Back     alignment and structure
>pdb|3F1K|A Chain A, Crystal Structure Of Ycik From E. Coli, An Oxidoreductase, Complexed With Nadp+ At 2.6a Resolution Length = 252 Back     alignment and structure
>pdb|2RBE|A Chain A, The Discovery Of 2-Anilinothiazolones As 11beta-Hsd1 Inhibitors Length = 275 Back     alignment and structure
>pdb|1XU7|A Chain A, Crystal Structure Of The Interface Open Conformation Of Tetrameric 11b-hsd1 Length = 286 Back     alignment and structure
>pdb|3D5Q|A Chain A, Crystal Structure Of 11b-Hsd1 In Complex With Triazole Inhibitor Length = 272 Back     alignment and structure
>pdb|3O4R|A Chain A, Crystal Structure Of Human DehydrogenaseREDUCTASE (SDR FAMILY) MEMBER 4 (Dhrs4) Length = 261 Back     alignment and structure
>pdb|2ILT|A Chain A, Human 11-Beta-Hydroxysteroid Dehydrogenase (Hsd1) With Nadp And Adamantane Sulfone Inhibitor Length = 275 Back     alignment and structure
>pdb|3PDJ|A Chain A, Crystal Structure Of Human 11-Beta-Hydroxysteroid Dehydrogenase 1 (11b-Hsd1) In Complex With 4,4-Disubstituted Cyclohexylbenzamide Inhibitor Length = 273 Back     alignment and structure
>pdb|3U09|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(G92d) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|2B4Q|A Chain A, Pseudomonas Aeruginosa RhlgNADP ACTIVE-Site Complex Length = 276 Back     alignment and structure
>pdb|2UVD|A Chain A, The Crystal Structure Of A 3-Oxoacyl-(Acyl Carrier Protein) Reductase From Bacillus Anthracis (Ba3989) Length = 246 Back     alignment and structure
>pdb|2WDZ|A Chain A, Crystal Structure Of The Short Chain Dehydrogenase Galactitol-Dehydrogenase (Gatdh) Of Rhodobacter Sphaeroides In Complex With Nad+ And 1,2-Pentandiol Length = 254 Back     alignment and structure
>pdb|3CH6|A Chain A, Crystal Structure Of 11beta-Hsd1 Double Mutant (L262r, F278e) Complexed With (3,3-Dimethylpiperidin-1-Yl)(6-(3- Fluoro-4-Methylphenyl)pyridin-2-Yl)methanone Length = 286 Back     alignment and structure
>pdb|4HFR|A Chain A, Human 11beta-Hydroxysteroid Dehydrogenase Type 1 In Complex With An Orally Bioavailable Acidic Inhibitor Azd4017. Length = 272 Back     alignment and structure
>pdb|1Q7C|A Chain A, The Structure Of Betaketoacyl-[acp] Reductase Y151f Mutant In Complex With Nadph Fragment Length = 244 Back     alignment and structure
>pdb|2CF2|E Chain E, Architecture Of Mammalian Fatty Acid Synthase Length = 226 Back     alignment and structure
>pdb|1I01|A Chain A, Crystal Structure Of Beta-Ketoacyl [acyl Carrier Protein] Reductase From E. Coli. Length = 244 Back     alignment and structure
>pdb|2Z1N|A Chain A, Crystal Structure Of Ape0912 From Aeropyrum Pernix K1 Length = 260 Back     alignment and structure
>pdb|3E9Q|A Chain A, Crystal Structure Of The Short Chain Dehydrogenase From Shigella Flexneri Length = 273 Back     alignment and structure
>pdb|3L77|A Chain A, X-Ray Structure Alcohol Dehydrogenase From Archaeon Thermococcus Sibiricus Complexed With 5-Hydroxy-Nadp Length = 235 Back     alignment and structure
>pdb|3TN7|A Chain A, Crystal Structure Of Short-Chain Alcohol Dehydrogenase From Hyperthermophilic Archaeon Thermococcus Sibiricus Complexed With 5- Hydroxy-Nadp Length = 257 Back     alignment and structure
>pdb|3QIV|A Chain A, Crystal Structure Of A Putative Short-Chain Dehydrogenase Or 3- Oxoacyl-[acyl-Carrier-Protein] Reductase From Mycobacterium Paratuberculosis Atcc Baa-968 K-10 Length = 253 Back     alignment and structure
>pdb|1Y5M|A Chain A, The Crystal Structure Of Murine 11b-Hydroxysteroid Dehydrogenase: An Important Therapeutic Target For Diabetes Length = 276 Back     alignment and structure
>pdb|3GMD|A Chain A, Structure-Based Design Of 7-Azaindole-Pyrrolidines As Inhibitors Of 11beta-Hydroxysteroid-Dehydrogenase Type I Length = 264 Back     alignment and structure
>pdb|2HQ1|A Chain A, Crystal Structure Of Orf 1438 A Putative GlucoseRIBITOL Dehydrogenase From Clostridium Thermocellum Length = 247 Back     alignment and structure
>pdb|3NUG|A Chain A, Crystal Structure Of Wild Type Tetrameric Pyridoxal 4-Dehydrogenase From Mesorhizobium Loti Length = 247 Back     alignment and structure
>pdb|2QQ5|A Chain A, Crystal Structure Of Human Sdr Family Member 1 Length = 260 Back     alignment and structure
>pdb|3OML|A Chain A, Structure Of Full-Length Peroxisomal Multifunctional Enzyme Type 2 From Drosophila Melanogaster Length = 613 Back     alignment and structure
>pdb|3CSD|B Chain B, Actinorhodin Polyketide Ketoreductase Mutant P94l Bound To Nadph And The Inhibitor Emodin Length = 281 Back     alignment and structure
>pdb|2RHR|B Chain B, P94l Actinorhodin Ketordeuctase Mutant, With Nadph And Inhibitor Emodin Length = 277 Back     alignment and structure
>pdb|3KVO|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Hydroxysteroid Dehydrogenase Like 2 (Hsdl2) Length = 346 Back     alignment and structure
>pdb|3CXR|A Chain A, Crystal Structure Of Gluconate 5-Dehydrogase From Streptococcus Suis Type 2 Length = 291 Back     alignment and structure
>pdb|1O5I|A Chain A, Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protein) Reductase (Tm1169) From Thermotoga Maritima At 2.50 A Resolution Length = 249 Back     alignment and structure
>pdb|2CFC|A Chain A, Structural Basis For Stereo Selectivity In The (R)- And (S)- Hydroxypropylethane Thiosulfonate Dehydrogenases Length = 250 Back     alignment and structure
>pdb|1AHI|A Chain A, 7 Alpha-Hydroxysteroid Dehydrogenase Complexed With Nadh And 7-Oxo Glycochenodeoxycholic Acid Length = 255 Back     alignment and structure
>pdb|2C07|A Chain A, Oxoacyl-Acp Reductase Of Plasmodium Falciparum Length = 285 Back     alignment and structure
>pdb|3NDR|A Chain A, Crystal Structure Of Tetrameric Pyridoxal 4-Dehydrogenase From Mesorhizobium Loti Length = 247 Back     alignment and structure
>pdb|3OEC|A Chain A, Crystal Structure Of Carveol Dehydrogenase From Mycobacterium Thermoresistibile Length = 317 Back     alignment and structure
>pdb|3PK0|A Chain A, Crystal Structure Of Short-Chain DehydrogenaseREDUCTASE SDR FROM Mycobacterium Smegmatis Length = 262 Back     alignment and structure
>pdb|4AFN|A Chain A, Crystal Structure Of 3-ketoacyl-(acyl-carrier-protein) Reductase (fabg) From Pseudomonas Aeruginosa At 2.3a Resolution Length = 269 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query206
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 1e-26
2nwq_A 272 Probable short-chain dehydrogenase; oxidoreductase 3e-26
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 2e-25
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 3e-25
2z1n_A 260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 5e-25
3t4x_A 267 Oxidoreductase, short chain dehydrogenase/reducta; 1e-24
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 2e-24
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 1e-23
3asu_A 248 Short-chain dehydrogenase/reductase SDR; SDR famil 1e-23
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 1e-23
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 2e-23
3tfo_A 264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 4e-23
1xu9_A 286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 4e-23
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 1e-22
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 2e-22
3ai3_A 263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 7e-22
2ae2_A 260 Protein (tropinone reductase-II); oxidoreductase, 8e-22
1ae1_A 273 Tropinone reductase-I; oxidoreductase, tropane alk 2e-21
1sby_A 254 Alcohol dehydrogenase; ternary complex, NAD, trifl 3e-21
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 4e-21
3lf2_A 265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 5e-21
1xkq_A 280 Short-chain reductase family member (5D234); parra 6e-21
3cxt_A 291 Dehydrogenase with different specificities; rossma 6e-21
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 6e-21
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 6e-21
3svt_A 281 Short-chain type dehydrogenase/reductase; ssgcid, 6e-21
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 8e-21
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 1e-20
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 1e-20
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 2e-20
1xhl_A 297 Short-chain dehydrogenase/reductase family member 2e-20
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 2e-20
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 2e-20
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 2e-20
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 3e-20
1xq1_A 266 Putative tropinone reducatse; structural genomics, 4e-20
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 5e-20
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 6e-20
3p19_A 266 BFPVVD8, putative blue fluorescent protein; rossma 6e-20
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 7e-20
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 7e-20
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 1e-19
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 2e-19
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 3e-19
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 3e-19
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 3e-19
1geg_A 256 Acetoin reductase; SDR family, oxidoreductase; HET 3e-19
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 4e-19
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 5e-19
3imf_A 257 Short chain dehydrogenase; structural genomics, in 6e-19
3v2h_A 281 D-beta-hydroxybutyrate dehydrogenase; structural g 6e-19
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 6e-19
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 9e-19
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 1e-18
3ak4_A 263 NADH-dependent quinuclidinone reductase; SDR, (R)- 1e-18
1x1t_A 260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 1e-18
3ucx_A 264 Short chain dehydrogenase; ssgcid, seattle structu 2e-18
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 2e-18
1zem_A 262 Xylitol dehydrogenase; rossmann fold, dinucleotide 2e-18
1spx_A 278 Short-chain reductase family member (5L265); paral 3e-18
3rih_A 293 Short chain dehydrogenase or reductase; structural 3e-18
1iy8_A 267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 3e-18
3pk0_A 262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 4e-18
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 4e-18
3sju_A 279 Keto reductase; short-chain dehydrogenase, oxidore 4e-18
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 4e-18
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 4e-18
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 5e-18
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 6e-18
2gdz_A 267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 6e-18
3kzv_A 254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 7e-18
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 8e-18
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 1e-17
2rhc_B 277 Actinorhodin polyketide ketoreductase; oxidoreduct 1e-17
4fc7_A 277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 1e-17
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 1e-17
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 2e-17
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 2e-17
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 2e-17
3a28_C 258 L-2.3-butanediol dehydrogenase; chiral substrate r 2e-17
4e6p_A 259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 2e-17
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 2e-17
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 3e-17
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 5e-17
3v8b_A 283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 5e-17
2q2v_A 255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 6e-17
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 6e-17
1h5q_A 265 NADP-dependent mannitol dehydrogenase; oxidoreduct 7e-17
2ag5_A 246 DHRS6, dehydrogenase/reductase (SDR family) member 7e-17
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 9e-17
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 1e-16
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 1e-16
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 2e-16
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 2e-16
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 3e-16
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 3e-16
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 3e-16
1zmt_A 254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 4e-16
3n74_A 261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 6e-16
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 7e-16
3tox_A 280 Short chain dehydrogenase; structural genomics, PS 8e-16
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 8e-16
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 9e-16
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 1e-15
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 1e-15
4eso_A 255 Putative oxidoreductase; NADP, structural genomics 2e-15
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 2e-15
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 2e-15
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 2e-15
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 2e-15
3m1a_A 281 Putative dehydrogenase; short, PSI, MCSG, structur 3e-15
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 5e-15
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 6e-15
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 6e-15
4dqx_A 277 Probable oxidoreductase protein; structural genomi 7e-15
3oid_A 258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 8e-15
3tzq_B 271 Short-chain type dehydrogenase/reductase; ssgcid, 8e-15
3sc4_A 285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 1e-14
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 1e-14
1gee_A 261 Glucose 1-dehydrogenase; short-chain dehydrogenase 1e-14
4fgs_A 273 Probable dehydrogenase protein; PSI-biology, nysgr 1e-14
1wma_A 276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 1e-14
3i4f_A 264 3-oxoacyl-[acyl-carrier protein] reductase; struct 1e-14
3uxy_A 266 Short-chain dehydrogenase/reductase SDR; structura 2e-14
3vtz_A 269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 2e-14
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 2e-14
3zv4_A 281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 4e-14
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 5e-14
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 6e-14
3e03_A 274 Short chain dehydrogenase; structural genomics, PS 7e-14
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 7e-14
2d1y_A 256 Hypothetical protein TT0321; strucrtural genomics, 8e-14
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 8e-14
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 1e-13
2a4k_A 263 3-oxoacyl-[acyl carrier protein] reductase; reduct 2e-13
3gvc_A 277 Oxidoreductase, probable short-chain type dehydrog 2e-13
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 3e-13
2bgk_A 278 Rhizome secoisolariciresinol dehydrogenase; oxidor 3e-13
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 4e-13
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 4e-13
1yde_A 270 Retinal dehydrogenase/reductase 3; oxidoreductase, 4e-13
2dtx_A 264 Glucose 1-dehydrogenase related protein; rossmann 6e-13
2fwm_X 250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 6e-13
1hdc_A 254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 6e-13
3oec_A 317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 1e-12
3t7c_A 299 Carveol dehydrogenase; structural genomics, seattl 2e-12
1nff_A 260 Putative oxidoreductase RV2002; directed evolution 3e-12
3gem_A260 Short chain dehydrogenase; structural genomics, AP 3e-12
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 4e-12
2dkn_A 255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 5e-12
1ooe_A236 Dihydropteridine reductase; structural genomics, P 5e-12
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 5e-12
3s55_A 281 Putative short-chain dehydrogenase/reductase; stru 6e-12
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 7e-12
3tsc_A 277 Putative oxidoreductase; structural genomics, seat 7e-12
3edm_A259 Short chain dehydrogenase; structural genomics, ox 9e-12
1fjh_A 257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 1e-11
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 2e-11
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 3e-11
1hxh_A 253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 3e-11
3uve_A 286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 3e-11
3pgx_A 280 Carveol dehydrogenase; structural genomics, seattl 4e-11
4e4y_A 244 Short chain dehydrogenase family protein; structur 4e-11
3sx2_A 278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 5e-11
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 5e-11
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 6e-11
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 9e-11
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 1e-10
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 1e-10
2o23_A 265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 2e-10
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 2e-10
1gz6_A 319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 3e-10
3rd5_A 291 Mypaa.01249.C; ssgcid, structural genomics, seattl 4e-10
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 5e-10
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 1e-09
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 1e-09
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 2e-09
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 5e-09
1g0o_A 283 Trihydroxynaphthalene reductase; protein-NADPH-act 3e-09
1ja9_A 274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 4e-09
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 6e-09
3is3_A 270 17BETA-hydroxysteroid dehydrogenase; short chain d 7e-09
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 1e-08
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 2e-08
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 5e-08
3qlj_A 322 Short chain dehydrogenase; structural genomics, se 3e-07
3tl3_A 257 Short-chain type dehydrogenase/reductase; ssgcid, 6e-07
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Length = 230 Back     alignment and structure
 Score =  100 bits (252), Expect = 1e-26
 Identities = 23/140 (16%), Positives = 52/140 (37%), Gaps = 16/140 (11%)

Query: 56  ALVTGPTDGIGKSFAFQLAKTGLNLVLVGRNPDKLKDVSDSIQAKYAKTQIKSVVVDFS- 114
            ++TG + G+G   A      G    L GR+  KL  V++ +              D + 
Sbjct: 4   IVITGASSGLGAELAKLYDAEGKATYLTGRSESKLSTVTNCLSNNV-----GYRARDLAS 58

Query: 115 -GDLDEGVERIKEAIEGLDVGVLINNVGISYPYARFFHEVDQVLLKNLIKVNVEGTTKVT 173
             ++++  E++           ++++ G    Y     E D   ++ LI+ N+     V 
Sbjct: 59  HQEVEQLFEQLDSIPS-----TVVHSAGSG--YFGLLQEQDPEQIQTLIENNLSSAINVL 111

Query: 174 QAVLPGMLKRKKGLSMLNIG 193
           + ++     +   +  + I 
Sbjct: 112 RELVKRYKDQPVNV--VMIM 129


>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Length = 272 Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Length = 259 Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Length = 287 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Length = 260 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Length = 267 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Length = 250 Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} Length = 235 Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Length = 248 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Length = 279 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Length = 252 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Length = 264 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Length = 286 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Length = 252 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} Length = 247 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Length = 263 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Length = 260 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Length = 273 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Length = 254 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Length = 234 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Length = 265 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 280 Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Length = 255 Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Length = 207 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Length = 281 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} Length = 235 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Length = 262 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Length = 302 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Length = 249 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 297 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Length = 279 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Length = 260 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Length = 272 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Length = 266 Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Length = 247 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Length = 266 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Length = 260 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Length = 244 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Length = 276 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Length = 254 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} Length = 247 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Length = 285 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Length = 303 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Length = 257 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Length = 260 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Length = 255 Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Length = 270 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Length = 263 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Length = 260 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} Length = 264 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Length = 256 Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Length = 262 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 278 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Length = 293 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} Length = 262 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Length = 253 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Length = 279 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Length = 264 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 245 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Length = 319 Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} PDB: 3rsh_A* 3rro_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Length = 248 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Length = 254 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Length = 266 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} Length = 249 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Length = 277 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Length = 277 Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Length = 239 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Length = 245 Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Length = 276 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Length = 258 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Length = 259 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Length = 248 Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Length = 254 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Length = 272 Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Length = 283 Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Length = 255 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Length = 247 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Length = 265 Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Length = 246 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Length = 247 Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} Length = 273 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Length = 245 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Length = 246 Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} PDB: 3sj7_A* Length = 246 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Length = 244 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Length = 269 Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} PDB: 3gdf_A Length = 267 Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Length = 254 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Length = 261 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Length = 346 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Length = 269 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Length = 260 Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} Length = 256 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Length = 255 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Length = 251 Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Length = 249 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Length = 244 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Length = 281 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Length = 301 Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Length = 324 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Length = 277 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Length = 258 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} Length = 271 Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Length = 285 Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Length = 250 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Length = 261 Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Length = 273 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Length = 276 Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} Length = 264 Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Length = 266 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Length = 269 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Length = 281 Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 250 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Length = 251 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Length = 274 Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Length = 247 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Length = 253 Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Length = 258 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Length = 263 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Length = 277 Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3q6i_A* 3m1l_A Length = 454 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Length = 278 Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Length = 327 Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} Length = 311 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Length = 270 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Length = 264 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Length = 250 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Length = 254 Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Length = 317 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Length = 299 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Length = 260 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Length = 260 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Length = 288 Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Length = 255 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 236 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Length = 241 Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} Length = 281 Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Length = 328 Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} Length = 277 Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Length = 259 Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Length = 257 Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Length = 291 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Length = 272 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Length = 253 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} PDB: 3uwr_A* Length = 286 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} Length = 280 Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Length = 244 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Length = 278 Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Length = 257 Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Length = 202 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Length = 271 Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Length = 267 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Length = 276 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Length = 265 Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Length = 262 Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Length = 319 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Length = 291 Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Length = 613 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Length = 281 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} Length = 287 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Length = 283 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Length = 274 Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Length = 294 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Length = 270 Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Length = 255 Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Length = 287 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Length = 291 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Length = 322 Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Length = 257 Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 242 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query206
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 100.0
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 100.0
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 99.97
4fgs_A 273 Probable dehydrogenase protein; PSI-biology, nysgr 99.97
3ged_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.97
4gkb_A 258 3-oxoacyl-[acyl-carrier protein] reductase; putati 99.97
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 99.97
4h15_A 261 Short chain alcohol dehydrogenase-related dehydro; 99.97
3lf2_A 265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 99.97
3t4x_A 267 Oxidoreductase, short chain dehydrogenase/reducta; 99.96
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 99.96
3pk0_A 262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 99.96
3tfo_A 264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 99.96
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 99.96
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 99.96
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 99.96
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 99.96
3s55_A 281 Putative short-chain dehydrogenase/reductase; stru 99.96
1iy8_A 267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 99.96
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 99.96
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 99.96
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.96
4dqx_A 277 Probable oxidoreductase protein; structural genomi 99.96
3tsc_A 277 Putative oxidoreductase; structural genomics, seat 99.96
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 99.96
3imf_A 257 Short chain dehydrogenase; structural genomics, in 99.96
3tzq_B 271 Short-chain type dehydrogenase/reductase; ssgcid, 99.96
3pgx_A 280 Carveol dehydrogenase; structural genomics, seattl 99.96
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 99.96
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 99.96
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 99.96
3v8b_A 283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 99.96
3sc4_A 285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 99.96
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 99.96
3svt_A 281 Short-chain type dehydrogenase/reductase; ssgcid, 99.96
3t7c_A 299 Carveol dehydrogenase; structural genomics, seattl 99.96
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 99.96
3rih_A 293 Short chain dehydrogenase or reductase; structural 99.96
3e03_A 274 Short chain dehydrogenase; structural genomics, PS 99.95
3uve_A 286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 99.95
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 99.95
3oid_A 258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 99.95
4fc7_A 277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 99.95
3gvc_A 277 Oxidoreductase, probable short-chain type dehydrog 99.95
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 99.95
2ae2_A 260 Protein (tropinone reductase-II); oxidoreductase, 99.95
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 99.95
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 99.95
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 99.95
3sju_A 279 Keto reductase; short-chain dehydrogenase, oxidore 99.95
3ucx_A 264 Short chain dehydrogenase; ssgcid, seattle structu 99.95
3v2h_A 281 D-beta-hydroxybutyrate dehydrogenase; structural g 99.95
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 99.95
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 99.95
1ae1_A 273 Tropinone reductase-I; oxidoreductase, tropane alk 99.95
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 99.95
4e6p_A 259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 99.95
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.95
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 99.95
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 99.95
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 99.95
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 99.95
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 99.95
3tox_A 280 Short chain dehydrogenase; structural genomics, PS 99.95
3oec_A 317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 99.95
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 99.95
3ai3_A 263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 99.95
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 99.95
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 99.95
3cxt_A 291 Dehydrogenase with different specificities; rossma 99.95
2z1n_A 260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 99.95
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 99.95
1zem_A 262 Xylitol dehydrogenase; rossmann fold, dinucleotide 99.95
3a28_C 258 L-2.3-butanediol dehydrogenase; chiral substrate r 99.95
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 99.95
1hdc_A 254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 99.95
4eso_A 255 Putative oxidoreductase; NADP, structural genomics 99.95
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 99.95
2rhc_B 277 Actinorhodin polyketide ketoreductase; oxidoreduct 99.95
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 99.95
1geg_A 256 Acetoin reductase; SDR family, oxidoreductase; HET 99.95
1x1t_A 260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 99.95
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 99.95
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 99.95
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 99.95
3n74_A 261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 99.95
1xhl_A 297 Short-chain dehydrogenase/reductase family member 99.95
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 99.94
1nff_A 260 Putative oxidoreductase RV2002; directed evolution 99.94
3p19_A 266 BFPVVD8, putative blue fluorescent protein; rossma 99.94
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 99.94
3gem_A260 Short chain dehydrogenase; structural genomics, AP 99.94
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 99.94
3sx2_A 278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 99.94
1hxh_A 253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 99.94
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 99.94
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 99.94
3ksu_A 262 3-oxoacyl-acyl carrier protein reductase; structur 99.94
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 99.94
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.94
3vtz_A 269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 99.94
2d1y_A 256 Hypothetical protein TT0321; strucrtural genomics, 99.94
2q2v_A 255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 99.94
3is3_A 270 17BETA-hydroxysteroid dehydrogenase; short chain d 99.94
3dii_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.94
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 99.94
1xkq_A 280 Short-chain reductase family member (5D234); parra 99.94
3kzv_A 254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 99.94
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 99.94
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 99.94
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.94
3m1a_A 281 Putative dehydrogenase; short, PSI, MCSG, structur 99.94
3zv4_A 281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 99.94
1spx_A 278 Short-chain reductase family member (5L265); paral 99.94
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 99.94
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.94
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 99.94
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 99.94
3edm_A 259 Short chain dehydrogenase; structural genomics, ox 99.94
3asu_A 248 Short-chain dehydrogenase/reductase SDR; SDR famil 99.94
3ak4_A 263 NADH-dependent quinuclidinone reductase; SDR, (R)- 99.94
3qlj_A 322 Short chain dehydrogenase; structural genomics, se 99.94
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 99.94
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 99.94
2nwq_A 272 Probable short-chain dehydrogenase; oxidoreductase 99.94
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 99.94
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.94
1xq1_A 266 Putative tropinone reducatse; structural genomics, 99.94
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 99.94
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.94
1g0o_A 283 Trihydroxynaphthalene reductase; protein-NADPH-act 99.93
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 99.93
2a4k_A 263 3-oxoacyl-[acyl carrier protein] reductase; reduct 99.93
1gee_A 261 Glucose 1-dehydrogenase; short-chain dehydrogenase 99.93
2bgk_A 278 Rhizome secoisolariciresinol dehydrogenase; oxidor 99.93
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 99.93
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 99.93
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 99.93
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 99.93
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 99.93
2ag5_A 246 DHRS6, dehydrogenase/reductase (SDR family) member 99.93
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 99.93
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 99.93
2dtx_A 264 Glucose 1-dehydrogenase related protein; rossmann 99.93
3k31_A 296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 99.93
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.93
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 99.93
3i4f_A 264 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.93
1yde_A 270 Retinal dehydrogenase/reductase 3; oxidoreductase, 99.93
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 99.93
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 99.93
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 99.93
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 99.93
3oig_A 266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 99.93
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 99.93
3uxy_A 266 Short-chain dehydrogenase/reductase SDR; structura 99.93
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 99.93
1zmt_A 254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 99.93
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 99.93
1h5q_A 265 NADP-dependent mannitol dehydrogenase; oxidoreduct 99.93
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 99.93
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 99.93
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 99.93
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 99.93
2fwm_X 250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 99.93
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 99.93
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 99.92
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 99.92
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 99.92
3grk_A 293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.92
1gz6_A 319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 99.92
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 99.92
2p91_A 285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 99.92
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 99.92
1xu9_A 286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 99.92
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 99.92
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 99.92
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 99.92
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 99.92
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 99.92
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 99.92
3ek2_A 271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.92
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 99.92
2pd4_A 275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 99.92
2wyu_A 261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 99.92
3nrc_A 280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 99.92
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 99.92
1sby_A 254 Alcohol dehydrogenase; ternary complex, NAD, trifl 99.92
2gdz_A 267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 99.92
1ja9_A 274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 99.91
3rd5_A 291 Mypaa.01249.C; ssgcid, structural genomics, seattl 99.91
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 99.91
1qsg_A 265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 99.91
3lt0_A 329 Enoyl-ACP reductase; triclosan, triclosan variant, 99.91
4e4y_A 244 Short chain dehydrogenase family protein; structur 99.91
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 99.9
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 99.9
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 99.9
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 99.9
2h7i_A 269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 99.9
1ooe_A236 Dihydropteridine reductase; structural genomics, P 99.9
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 99.89
2ptg_A 319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 99.89
1d7o_A 297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 99.89
3qp9_A 525 Type I polyketide synthase pikaii; rossmann fold, 99.89
2o2s_A 315 Enoyl-acyl carrier reductase; enoyl reductase, tri 99.89
1wma_A 276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 99.89
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 99.89
3zu3_A 405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 99.89
3s8m_A 422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 99.88
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 99.87
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 99.86
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 99.86
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 99.86
3mje_A 496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 99.85
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 99.85
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 99.84
4eue_A 418 Putative reductase CA_C0462; TER, biofuel, synthet 99.84
2fr1_A 486 Erythromycin synthase, eryai; short chain dehydrog 99.83
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 99.83
1fjh_A 257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 99.82
2z5l_A 511 Tylkr1, tylactone synthase starter module and modu 99.82
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 99.78
3rft_A 267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.76
2dkn_A 255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.76
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 99.75
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.73
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 99.72
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 99.72
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 99.71
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 99.7
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 99.7
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.69
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 99.68
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 99.67
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 99.67
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 99.66
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 99.66
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 99.65
3r6d_A 221 NAD-dependent epimerase/dehydratase; structural ge 99.65
1xq6_A 253 Unknown protein; structural genomics, protein stru 99.65
2hrz_A 342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 99.65
2pk3_A 321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 99.65
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 99.65
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 99.65
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 99.64
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 99.63
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 99.62
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 99.62
1udb_A 338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 99.62
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 99.61
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 99.61
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 99.6
2p4h_X 322 Vestitone reductase; NADPH-dependent reductase, is 99.6
3dqp_A 219 Oxidoreductase YLBE; alpha-beta protein., structur 99.59
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 99.59
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 99.59
1kew_A 361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 99.58
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 99.58
2rh8_A 338 Anthocyanidin reductase; flavonoids, rossmann fold 99.57
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 99.57
2hun_A 336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 99.57
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 99.56
3dhn_A 227 NAD-dependent epimerase/dehydratase; reductase, PF 99.55
3ko8_A 312 NAD-dependent epimerase/dehydratase; isomerase, UD 99.55
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 99.55
4f6c_A 427 AUSA reductase domain protein; thioester reductase 99.55
3ay3_A 267 NAD-dependent epimerase/dehydratase; glucuronic ac 99.55
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 99.54
3h2s_A 224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 99.53
3ew7_A 221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 99.53
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 99.53
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 99.52
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 99.52
4ggo_A 401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 99.52
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 99.51
1oc2_A 348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 99.51
2ggs_A 273 273AA long hypothetical DTDP-4-dehydrorhamnose red 99.51
1vl0_A 292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 99.5
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 99.5
2p5y_A 311 UDP-glucose 4-epimerase; TTHA0591, structural geno 99.5
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 99.5
1r6d_A 337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 99.49
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 99.49
2yy7_A 312 L-threonine dehydrogenase; thermolabIle, flavobact 99.48
3ehe_A 313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 99.47
3ajr_A 317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 99.45
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 99.44
2x6t_A 357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 99.44
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 99.42
3sc6_A 287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 99.41
2b69_A 343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 99.41
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrola 99.41
1e6u_A 321 GDP-fucose synthetase; epimerase/reductase, SDR, R 99.39
2jl1_A 287 Triphenylmethane reductase; oxidoreductase, biorem 99.38
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 99.37
2v6g_A 364 Progesterone 5-beta-reductase; tyrosine-dependent 99.37
1n2s_A 299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 99.36
1eq2_A 310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 99.36
4b8w_A 319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 99.34
3e48_A 289 Putative nucleoside-diphosphate-sugar epimerase; a 99.34
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 99.31
3vps_A 321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 99.29
4f6l_B 508 AUSA reductase domain protein; thioester reductase 99.29
2zcu_A 286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 99.28
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 99.23
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 99.19
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 99.13
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 99.1
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 99.06
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 99.06
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 99.05
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 99.03
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 99.03
4b4o_A 298 Epimerase family protein SDR39U1; isomerase; HET: 99.02
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 99.01
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 98.95
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 98.91
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 98.84
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 98.78
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.76
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 98.69
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 98.69
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 98.65
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 98.65
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 98.62
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 98.61
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 98.6
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 98.59
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 98.58
1y7t_A 327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 98.56
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 98.55
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 98.53
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 98.52
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 98.45
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 98.44
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 98.41
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 98.41
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 98.39
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 98.38
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 98.38
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 98.37
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 98.36
3gms_A340 Putative NADPH:quinone reductase; structural genom 98.36
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 98.35
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 98.34
4eye_A342 Probable oxidoreductase; structural genomics, niai 98.31
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 98.24
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 98.21
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 98.17
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 98.13
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 98.12
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 98.11
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 98.1
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 98.1
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 98.08
1b8p_A 329 Protein (malate dehydrogenase); oxidoreductase; 1. 98.08
1smk_A 326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 98.0
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 97.99
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 97.98
3fbg_A346 Putative arginate lyase; structural genomics, unkn 97.96
1hye_A 313 L-lactate/malate dehydrogenase; nucleotide binding 97.94
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.91
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 97.9
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 97.89
1o6z_A 303 MDH, malate dehydrogenase; halophilic, ION-binding 97.88
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.82
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 97.82
3krt_A456 Crotonyl COA reductase; structural genomics, prote 97.82
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 97.81
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 97.76
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 97.75
1lss_A140 TRK system potassium uptake protein TRKA homolog; 97.74
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 97.74
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 97.73
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 97.69
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 97.68
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 97.65
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 97.63
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 97.57
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 97.57
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 97.56
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 97.55
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 97.55
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 97.54
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 97.52
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 97.52
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 97.51
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 97.5
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 97.5
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 97.47
1p9o_A 313 Phosphopantothenoylcysteine synthetase; ligase; 2. 97.47
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 97.47
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 97.45
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 97.45
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 97.44
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 97.43
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 97.4
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 97.39
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 97.39
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 97.38
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 97.37
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 97.36
3fi9_A 343 Malate dehydrogenase; structural genomics, oxidore 97.36
3rui_A 340 Ubiquitin-like modifier-activating enzyme ATG7; au 97.36
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 97.35
3c85_A183 Putative glutathione-regulated potassium-efflux S 97.34
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 97.32
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 97.3
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 97.3
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 97.29
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 97.27
3pqe_A 326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 97.26
1mld_A 314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 97.24
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 97.24
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 97.23
3vku_A 326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 97.21
4aj2_A 331 L-lactate dehydrogenase A chain; oxidoreductase-in 97.2
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 97.19
1oju_A 294 MDH, malate dehydrogenase; hyperthermophilic, oxid 97.15
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 97.14
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 97.14
5mdh_A 333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 97.11
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 97.1
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 97.09
4gsl_A 615 Ubiquitin-like modifier-activating enzyme ATG7; ub 97.08
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 97.07
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.05
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 97.04
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 97.03
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 97.0
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 96.99
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 96.99
4h7p_A 345 Malate dehydrogenase; ssgcid, structural G seattle 96.97
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 96.95
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 96.88
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 96.87
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 96.86
3tl2_A 315 Malate dehydrogenase; center for structural genomi 96.86
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 96.84
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 96.84
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 96.8
3gvi_A 324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 96.79
2x0j_A 294 Malate dehydrogenase; oxidoreductase, hyperthermop 96.78
3ldh_A 330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 96.74
1pzg_A 331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 96.67
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 96.65
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 96.65
3p2o_A285 Bifunctional protein fold; structural genomics, ce 96.64
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 96.61
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 96.56
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 96.54
3p7m_A 321 Malate dehydrogenase; putative dehydrogenase, enzy 96.54
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 96.52
2rir_A300 Dipicolinate synthase, A chain; structural genomic 96.5
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 96.49
1tt5_B 434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 96.48
3nep_X 314 Malate dehydrogenase; halophIle, molecular adpatat 96.48
3d0o_A 317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 96.42
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 96.42
2zqz_A 326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 96.38
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 96.35
1ur5_A 309 Malate dehydrogenase; oxidoreductase, tricarboxyli 96.34
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 96.33
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 96.33
1y8q_B 640 Anthracycline-, ubiquitin-like 2 activating enzyme 96.32
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 96.31
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 96.31
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 96.3
1y8q_A 346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 96.3
1ez4_A 318 Lactate dehydrogenase; rossmann fold, oxidoreducta 96.29
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 96.29
2xxj_A 310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 96.28
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 96.27
3hhp_A 312 Malate dehydrogenase; MDH, citric acid cycle, TCA 96.27
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 96.26
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 96.24
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 96.23
4e12_A 283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 96.22
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 96.2
3l07_A285 Bifunctional protein fold; structural genomics, ID 96.2
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 96.17
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 96.15
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 96.11
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 96.06
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 96.05
2v6b_A 304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 96.05
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 95.99
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 95.97
2pv7_A 298 T-protein [includes: chorismate mutase (EC 5.4.99 95.97
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 95.97
3c24_A 286 Putative oxidoreductase; YP_511008.1, structural g 95.95
1f0y_A 302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 95.94
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 95.93
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 95.92
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 95.92
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 95.91
1ldn_A 316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 95.9
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 95.82
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 95.81
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
Probab=100.00  E-value=7.5e-34  Score=223.16  Aligned_cols=150  Identities=27%  Similarity=0.312  Sum_probs=135.3

Q ss_pred             cccCCcEEEEECCCChHHHHHHHHHHHCCCcEEEEEcChhhHHHHHHHHHHhcCCceEEEEEEecCCC--chHHHHHHHH
Q 028656           49 LRKYGSWALVTGPTDGIGKSFAFQLAKTGLNLVLVGRNPDKLKDVSDSIQAKYAKTQIKSVVVDFSGD--LDEGVERIKE  126 (206)
Q Consensus        49 ~~~~~k~vlItGas~giG~~~a~~l~~~g~~V~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~--~~~~~~~~~~  126 (206)
                      .+++||+++||||++|||+++|++|+++|++|++++|+.++++++.+++++.  +.++..+.+|+++.  +++.++++.+
T Consensus         3 ~sL~gKvalVTGas~GIG~aiA~~la~~Ga~Vv~~~~~~~~~~~~~~~i~~~--g~~~~~~~~Dvt~~~~v~~~~~~~~~   80 (254)
T 4fn4_A            3 QSLKNKVVIVTGAGSGIGRAIAKKFALNDSIVVAVELLEDRLNQIVQELRGM--GKEVLGVKADVSKKKDVEEFVRRTFE   80 (254)
T ss_dssp             GGGTTCEEEEETTTSHHHHHHHHHHHHTTCEEEEEESCHHHHHHHHHHHHHT--TCCEEEEECCTTSHHHHHHHHHHHHH
T ss_pred             CCCCCCEEEEeCCCCHHHHHHHHHHHHcCCEEEEEECCHHHHHHHHHHHHhc--CCcEEEEEccCCCHHHHHHHHHHHHH
Confidence            3578999999999999999999999999999999999999999999999874  56788999999985  3677889999


Q ss_pred             HhcCCCccEEEEeccccCCcccccccCCHHHHHHHHhhhhhHHHHHHHHHhhhhHhCCCCceEEEeccccccccccCC
Q 028656          127 AIEGLDVGVLINNVGISYPYARFFHEVDQVLLKNLIKVNVEGTTKVTQAVLPGMLKRKKGLSMLNIGKAELMCSVRFH  204 (206)
Q Consensus       127 ~~~~~~id~lvnnAg~~~~~~~~~~~~~~~~~~~~~~~N~~g~~~~~~~~~~~~~~~~~g~~iv~isS~~~~~~~~~~  204 (206)
                      +++++|  ++|||||+..+ .+++++.++|+|++++++|+.|+|+++|+++|+|++++.|+ |||+||.++..+.|.+
T Consensus        81 ~~G~iD--iLVNNAGi~~~-~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~p~m~~~~~G~-IVnisS~~g~~~~~~~  154 (254)
T 4fn4_A           81 TYSRID--VLCNNAGIMDG-VTPVAEVSDELWERVLAVNLYSAFYSSRAVIPIMLKQGKGV-IVNTASIAGIRGGFAG  154 (254)
T ss_dssp             HHSCCC--EEEECCCCCCT-TCCGGGCCHHHHHHHHHHHTHHHHHHHHHHHHHHHHHTCEE-EEEECCGGGTCSSSSC
T ss_pred             HcCCCC--EEEECCcccCC-CCChhhCCHHHHHHHHHHHhHHHHHHHHHHHHHHHHcCCcE-EEEEechhhcCCCCCC
Confidence            999755  99999998753 24689999999999999999999999999999999988787 9999999999998864



>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>1p9o_A Phosphopantothenoylcysteine synthetase; ligase; 2.30A {Homo sapiens} SCOP: c.72.3.1 Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 206
d1xg5a_257 c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC41 9e-24
d1xkqa_ 272 c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorh 1e-20
d1yb1a_244 c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase 2e-20
d1spxa_ 264 c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nemato 8e-20
d1zk4a1251 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase 1e-19
d2gdza1 254 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrog 3e-19
d1wmaa1 275 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydrox 3e-19
d1xq1a_ 259 c.2.1.2 (A:) Tropinone reductase {Thale cress (Ara 9e-19
d1yo6a1250 c.2.1.2 (A:1-250) Putative carbonyl reductase snif 9e-19
d2ew8a1247 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenas 1e-18
d2bgka1 268 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol de 2e-18
d1pr9a_244 c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapie 3e-18
d1cyda_242 c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus muscul 3e-18
d2d1ya1248 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T 2e-17
d2ae2a_ 259 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 2e-17
d1oaaa_259 c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus mus 1e-16
d1hdca_ 254 c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydr 1e-16
d1gz6a_ 302 c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase do 2e-16
d1bdba_ 276 c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehy 2e-16
d1ydea1250 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 4e-16
d1xhla_ 274 c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorh 6e-16
d1h5qa_ 260 c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Aga 3e-15
d1hxha_ 253 c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydroge 3e-15
d1yxma1 297 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA re 6e-15
d1zmta1 252 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Ag 7e-15
d1vl8a_251 c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga 1e-14
d1iy8a_ 258 c.2.1.2 (A:) Levodione reductase {Corynebacterium 2e-14
d2bd0a1240 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase 2e-14
d1xu9a_ 269 c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 7e-14
d1sbya1 254 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase 1e-13
d2rhca1 257 c.2.1.2 (A:5-261) beta-keto acyl carrier protein r 1e-13
d1ulsa_242 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 2e-13
d1fmca_255 c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase 2e-13
d2ag5a1245 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR fami 8e-13
d1ae1a_ 258 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 2e-12
d1k2wa_ 256 c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter s 4e-12
d1q7ba_243 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 5e-12
d1edoa_244 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 8e-12
d1gega_ 255 c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Kl 1e-11
d2c07a1251 c.2.1.2 (A:54-304) beta-keto acyl carrier protein 1e-11
d1ja9a_ 259 c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reduc 2e-11
d1nffa_244 c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycob 3e-11
d1geea_ 261 c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megat 4e-11
d1mxha_266 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 4e-11
d1snya_248 c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly 6e-11
d1fjha_ 257 c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase 8e-11
d1g0oa_ 272 c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase 9e-11
d1jtva_ 285 c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroi 1e-10
d1zema1 260 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconoba 2e-10
d1ulua_256 c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermoph 2e-10
d2a4ka1241 c.2.1.2 (A:2-242) beta-keto acyl carrier protein r 4e-10
d1dhra_236 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 7e-10
d1o5ia_234 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 1e-09
d1w6ua_ 294 c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondr 1e-09
d1ooea_235 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 2e-09
d1x1ta1 260 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydroge 3e-09
d1e7wa_284 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 3e-08
d1uzma1237 c.2.1.2 (A:9-245) beta-keto acyl carrier protein r 5e-08
d2o23a1248 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydr 9e-07
d1qsga_258 c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli 1e-06
d1uaya_241 c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogena 4e-06
d1jaya_212 c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase 5e-06
d2pd4a1 274 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacte 6e-06
d2fr1a1259 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI 7e-06
d2h7ma1 268 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacteri 3e-05
d1d7oa_ 297 c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (B 4e-05
d1luaa1191 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopter 1e-04
d1uh5a_ 329 c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite 2e-04
d1y1pa1 342 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolo 5e-04
d1xgka_ 350 c.2.1.2 (A:) Negative transcriptional regulator Nm 0.003
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Length = 257 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Putative dehydrogenase ARPG836 (MGC4172)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 92.7 bits (230), Expect = 9e-24
 Identities = 34/141 (24%), Positives = 59/141 (41%), Gaps = 7/141 (4%)

Query: 56  ALVTGPTDGIGKSFAFQLAKTGLNLVLVGRNPDKLKDVSDSIQAKYAKTQIKSVVVDFS- 114
           ALVTG + GIG + A  L + GL +V   R    +++++   ++      +     D S 
Sbjct: 13  ALVTGASGGIGAAVARALVQQGLKVVGCARTVGNIEELAAECKSAGYPGTLIPYRCDLSN 72

Query: 115 -GDLDEGVERIKEAIEGLDVGVLINNVGISYPYARFFHEVDQVLLKNLIKVNVEGTTKVT 173
             D+      I+    G+D  + INN G++ P             K++  VNV   +  T
Sbjct: 73  EEDILSMFSAIRSQHSGVD--ICINNAGLARP--DTLLSGSTSGWKDMFNVNVLALSICT 128

Query: 174 QAVLPGMLKRK-KGLSMLNIG 193
           +     M +R      ++NI 
Sbjct: 129 REAYQSMKERNVDDGHIININ 149


>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Length = 272 Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 264 Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Length = 251 Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 259 Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Length = 250 Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Length = 247 Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Length = 268 Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Length = 259 Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 259 Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Length = 254 Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 302 Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Length = 276 Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 250 Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Length = 274 Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Length = 260 Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 253 Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Length = 252 Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 251 Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Length = 258 Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Length = 240 Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Length = 257 Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Length = 242 Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Length = 255 Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Length = 258 Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 256 Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Length = 243 Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 244 Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Length = 255 Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 251 Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 259 Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 244 Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Length = 261 Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Length = 266 Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 248 Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 257 Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 272 Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Length = 260 Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Length = 256 Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Length = 234 Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 235 Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Length = 260 Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Length = 284 Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 237 Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Length = 258 Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 212 Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Length = 274 Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Length = 259 Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Length = 268 Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 297 Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Length = 191 Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 329 Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Length = 342 Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Length = 350 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query206
d1iy8a_ 258 Levodione reductase {Corynebacterium aquaticum [Ta 100.0
d2ae2a_ 259 Tropinone reductase {Jimsonweed (Datura stramonium 100.0
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 100.0
d1xq1a_ 259 Tropinone reductase {Thale cress (Arabidopsis thal 100.0
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 99.98
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 99.98
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 99.98
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 99.98
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 99.98
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 99.97
d1geea_ 261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 99.97
d1x1ta1 260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 99.97
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 99.97
d1k2wa_ 256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 99.97
d1hdca_ 254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 99.97
d1gega_ 255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 99.97
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 99.97
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 99.97
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 99.97
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 99.97
d2rhca1 257 beta-keto acyl carrier protein reductase {Streptom 99.97
d1hxha_ 253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 99.97
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 99.97
d2d1ya1 248 Hypothetical protein TTHA0369 {Thermus thermophilu 99.97
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 99.97
d1ae1a_ 258 Tropinone reductase {Jimsonweed (Datura stramonium 99.97
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 99.97
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 99.97
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 99.97
d1gz6a_ 302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 99.97
d1spxa_ 264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 99.97
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 99.96
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 99.96
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 99.96
d1h5qa_ 260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 99.96
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 99.96
d1bdba_ 276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 99.96
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 99.96
d1wmaa1 275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 99.96
d1xu9a_ 269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 99.96
d2gdza1 254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 99.96
d1sbya1 254 Drosophila alcohol dehydrogenase {Fly (Drosophila 99.95
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 99.95
d1jtva_ 285 Human estrogenic 17beta-hydroxysteroid dehydrogena 99.95
d1zmta1 252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 99.95
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 99.94
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 99.94
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 99.94
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 99.94
d1ja9a_ 259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 99.94
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 99.94
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 99.94
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 99.92
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 99.92
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 99.9
d2fr1a1 259 Erythromycin synthase, eryAI, 1st ketoreductase mo 99.9
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 99.89
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 99.87
d1uh5a_ 329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 99.87
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 99.84
d1qsga_ 258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 99.8
d2h7ma1 268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 99.79
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 99.78
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 99.77
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 99.76
d2pd4a1 274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 99.76
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 99.57
d1fjha_ 257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 99.51
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.5
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 99.46
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.45
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 99.43
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 99.43
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 99.42
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.39
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 99.36
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 99.36
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 99.34
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 99.33
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.32
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 99.27
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 99.25
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 99.22
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 99.21
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 99.18
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.13
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 99.11
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.05
d2q46a1 252 Hypothetical protein At5g02240 (T7H20_290) {Thale 99.0
d1r6da_ 322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 98.95
d1n2sa_ 298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 98.92
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 98.88
d1vl0a_ 281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 98.85
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 98.82
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 98.76
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 98.6
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 98.44
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 98.42
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 98.39
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 98.37
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 98.3
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 98.26
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 98.24
d1eq2a_ 307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 98.16
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 98.12
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 98.01
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 98.01
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.99
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 97.98
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 97.96
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 97.95
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 97.94
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.88
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 97.82
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 97.82
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 97.77
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 97.74
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 97.66
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 97.61
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 97.59
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 97.59
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 97.58
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 97.58
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.57
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 97.57
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 97.57
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 97.55
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 97.53
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 97.48
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 97.47
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 97.44
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 97.42
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 97.38
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 97.33
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 97.32
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 97.31
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 97.28
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 97.27
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 97.26
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 97.23
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 97.22
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 97.21
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 97.15
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 97.13
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 97.13
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 97.11
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 97.11
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 97.08
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.07
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 97.07
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 97.01
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 97.01
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 97.0
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 96.99
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 96.95
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.93
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 96.93
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 96.87
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.85
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 96.83
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 96.77
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 96.75
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 96.68
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 96.65
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 96.57
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 96.51
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 96.45
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 96.45
d1id1a_153 Rck domain from putative potassium channel Kch {Es 96.41
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 96.39
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 96.25
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 96.23
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 96.16
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 96.06
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 96.03
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 95.94
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 95.89
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 95.89
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 95.83
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 95.72
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 95.67
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 95.56
d1p9oa_ 290 Phosphopantothenoylcysteine synthetase {Human (Hom 95.42
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 95.37
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 95.35
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 95.23
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 95.22
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 94.93
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 94.83
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 94.65
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 94.65
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 94.61
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 94.57
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 94.54
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 94.54
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 94.53
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 94.49
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 94.43
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 94.34
d1c0pa1 268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 94.32
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 94.32
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 94.32
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 94.26
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 94.25
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 93.88
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 93.82
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 93.82
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 93.74
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 93.63
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 93.57
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 93.52
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 93.43
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 93.42
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 93.38
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 93.19
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 93.16
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 93.11
d1ryia1 276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 93.07
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 92.99
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 92.94
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 92.89
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 92.88
d1ihua2 279 Arsenite-translocating ATPase ArsA {Escherichia co 92.79
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 92.75
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 92.69
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 92.68
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 92.59
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 92.54
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 92.38
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 92.34
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 92.24
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 92.19
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 91.96
d2csua3163 Acetate-CoA ligase alpha chain, AcdA, domains 2 an 91.95
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 91.87
d1f0ka_ 351 Peptidoglycan biosynthesis glycosyltransferase Mur 91.87
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 91.76
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 91.6
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 91.52
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 91.47
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 91.46
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 91.33
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 91.3
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 91.25
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 91.23
d2gf3a1 281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 91.22
d2voua1 265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 91.19
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 91.14
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 91.13
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 91.07
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 90.99
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 90.91
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 90.84
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 90.81
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 90.71
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 90.66
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 90.66
d1pj5a2 305 N,N-dimethylglycine oxidase {Arthrobacter globifor 90.66
d1hwxa1 293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 90.6
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 90.52
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 90.52
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 90.47
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 90.3
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 90.29
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 90.26
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 90.17
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 90.16
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 89.79
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 89.71
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 89.68
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 89.65
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 89.61
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 89.36
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 89.32
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 89.22
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 88.95
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 88.79
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 88.74
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 88.27
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 88.08
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 87.74
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 87.54
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 87.53
d1cp2a_ 269 Nitrogenase iron protein {Clostridium pasteurianum 87.42
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 87.41
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 87.31
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 87.26
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 87.25
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 87.0
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 86.81
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 86.44
d1ls1a2207 GTPase domain of the signal sequence recognition p 86.27
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 85.95
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 85.85
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 85.62
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 85.27
d1k0ia1 292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 85.03
d1y0pa2 308 Flavocytochrome c3 (respiratory fumarate reductase 84.93
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 84.62
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 84.59
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 84.57
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 84.56
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 84.52
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 84.02
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 83.82
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 83.77
d1n4wa1 367 Cholesterol oxidase of GMC family {Streptomyces sp 83.68
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 83.46
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 83.4
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 83.4
d2f5va1 379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 83.23
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 83.2
d1onfa1 259 Glutathione reductase {Plasmodium falciparum [TaxI 83.14
d2h00a1250 Methyltransferase 10 domain containing protein MET 83.03
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 82.86
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 82.52
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 82.5
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 82.45
d2afhe1 289 Nitrogenase iron protein {Azotobacter vinelandii [ 82.4
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 82.3
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 82.24
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 81.99
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 81.84
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 81.82
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 81.78
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 81.76
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 81.71
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 81.63
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 81.54
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 81.36
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 81.26
d1d4ca2 322 Flavocytochrome c3 (respiratory fumarate reductase 81.23
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 81.22
d1i8ta1 298 UDP-galactopyranose mutase, N-terminal domain {Esc 81.15
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 81.15
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 81.08
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 80.61
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 80.51
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 80.16
d1okkd2207 GTPase domain of the signal recognition particle r 80.07
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Levodione reductase
species: Corynebacterium aquaticum [TaxId: 144185]
Probab=100.00  E-value=4.8e-33  Score=217.88  Aligned_cols=151  Identities=21%  Similarity=0.289  Sum_probs=137.0

Q ss_pred             ccCCcEEEEECCCChHHHHHHHHHHHCCCcEEEEEcChhhHHHHHHHHHHhcCCceEEEEEEecCCC--chHHHHHHHHH
Q 028656           50 RKYGSWALVTGPTDGIGKSFAFQLAKTGLNLVLVGRNPDKLKDVSDSIQAKYAKTQIKSVVVDFSGD--LDEGVERIKEA  127 (206)
Q Consensus        50 ~~~~k~vlItGas~giG~~~a~~l~~~g~~V~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~--~~~~~~~~~~~  127 (206)
                      +++||+++||||++|||+++|++|+++|++|++++|+.+++++..+++.+.+++.++..+.+|++|.  +++.++++.++
T Consensus         1 rl~gK~alITGas~GIG~aia~~la~~Ga~V~i~~r~~~~l~~~~~~~~~~~~~~~~~~~~~Dvt~~~~v~~~~~~~~~~   80 (258)
T d1iy8a_           1 RFTDRVVLITGGGSGLGRATAVRLAAEGAKLSLVDVSSEGLEASKAAVLETAPDAEVLTTVADVSDEAQVEAYVTATTER   80 (258)
T ss_dssp             CCTTCEEEEETTTSHHHHHHHHHHHHTTCEEEEEESCHHHHHHHHHHHHHHCTTCCEEEEECCTTSHHHHHHHHHHHHHH
T ss_pred             CCCCCEEEEeCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHhhCCCCeEEEEeccCCCHHHHHHHHHHHHHH
Confidence            4679999999999999999999999999999999999999999999998887788999999999985  36777888999


Q ss_pred             hcCCCccEEEEeccccCCcccccccCCHHHHHHHHhhhhhHHHHHHHHHhhhhHhCCCCceEEEeccccccccccCC
Q 028656          128 IEGLDVGVLINNVGISYPYARFFHEVDQVLLKNLIKVNVEGTTKVTQAVLPGMLKRKKGLSMLNIGKAELMCSVRFH  204 (206)
Q Consensus       128 ~~~~~id~lvnnAg~~~~~~~~~~~~~~~~~~~~~~~N~~g~~~~~~~~~~~~~~~~~g~~iv~isS~~~~~~~~~~  204 (206)
                      ++++|  ++|||||+..+. .++++.+.|+|++++++|+.|+++++|+++|.|++++.|+ ||++||.++..+.|.+
T Consensus        81 ~G~iD--iLVnnAG~~~~~-~~~~~~~~~~~~~~~~vNl~g~~~~~~~~~~~m~~~~~G~-Ii~isS~~~~~~~~~~  153 (258)
T d1iy8a_          81 FGRID--GFFNNAGIEGKQ-NPTESFTAAEFDKVVSINLRGVFLGLEKVLKIMREQGSGM-VVNTASVGGIRGIGNQ  153 (258)
T ss_dssp             HSCCS--EEEECCCCCCCC-BCGGGSCHHHHHHHHHHHTHHHHHHHHHHHHHHHHHTCCE-EEEECCGGGTSBCSSB
T ss_pred             hCCCC--EEEECCcccccC-CchhhhhhhHHHHHhhhhccchhhhhhhhHhhhhhhcCCC-CcccccHhhccCCCCc
Confidence            99755  999999987542 4688999999999999999999999999999999988888 9999999999988854



>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9oa_ c.72.3.1 (A:) Phosphopantothenoylcysteine synthetase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2csua3 c.23.4.1 (A:291-453) Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure